[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39447.1

[Show Plain Result]


## Summary of Sequence Search
    1::315
   11::284     4e-31  27%  291 aa  SAM_RICBR RecName: Full=S-adenosylmethionine uptake transporter;
    9::281     7e-31  27%  294 aa  SAM_RICTY RecName: Full=S-adenosylmethionine uptake transporter;
    9::281     2e-28  26%  294 aa  SAM_RICPR RecName: Full=S-adenosylmethionine uptake transporter;
    9::284     1e-25  25%  294 aa  SAM_RICFE RecName: Full=S-adenosylmethionine uptake transporter;
    9::284     5e-25  25%  294 aa  SAM_RICCN RecName: Full=S-adenosylmethionine uptake transporter;
    6::283     1e-13  21%  298 aa  Y1234_HELPY RecName: Full=Uncharacterized transporter HP_1234;
    6::283     5e-13  22%  298 aa  YC34_HELPJ RecName: Full=Uncharacterized transporter jhp_1155;
  109::339     6e-11  25%  353 aa  YP264_YEAST RecName: Full=Probable transport protein YPL264C;
    9::222     2e-07  23%  305 aa  YYAM_BACSU RecName: Full=Uncharacterized transporter yyaM;
    5::276     7e-07  21%  276 aa  Y266_ARCFU RecName: Full=Uncharacterized transporter AF_0266;
   10::270     2e-06  25%  270 aa  Y1552_ARCFU RecName: Full=Uncharacterized transporter AF_1552;
   44::339     7e-06  26%  343 aa  Y841_METTH RecName: Full=Uncharacterized transporter MTH_841;
   89::263     2e-05  20%  305 aa  YVBV_BACSU RecName: Full=Uncharacterized transporter yvbV;
    3::132     2e-05  27%  286 aa  Y215_LISIN RecName: Full=Putative sugar uptake protein lin0215;
    3::132     2e-05  27%  286 aa  Y176_LISMO RecName: Full=Putative sugar uptake protein lmo0176;
   45::153     4e-05  26%  253 aa  YSO2_ACIAM RecName: Full=Uncharacterized transporter in sor
    3::131     1e-04  29%  285 aa  Y2503_LACPL RecName: Full=Putative sugar uptake protein lp_2503;
   81::161     1e-04  21%  278 aa  Y1533_ARCFU RecName: Full=Uncharacterized transporter AF_1533;
   85::170     2e-04  22%  292 aa  YOAV_BACSU RecName: Full=Uncharacterized transporter yoaV;
   97::158     2e-04  34%  306 aa  YDFC_BACSU RecName: Full=Uncharacterized transporter ydfC;
   83::266     3e-04  23%  289 aa  Y510_ARCFU RecName: Full=Uncharacterized transporter AF_0510;
   90::293     4e-04  22%  296 aa  RARD_ECOLI RecName: Full=Protein rarD;
    4::111     9e-04  29%  282 aa  Y2594_LACPL RecName: Full=Putative sugar uptake protein lp_2594;
    1::315

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxLRGIALIVASTVFLACSDTLAKYLGRTLPPIEIGWIRFLVFLLIMLP
SAM_RICBR       -------------------------GIGWFLLSLVSSSANDVMSKYLGTRLHXXXXXXXXXXXXXIVLLP
SAM_RICTY       -----------------------LKGICWFLLSLVTSSVNDVISKYLGTRLHSFEVAFFRFLFSSIVLLP
SAM_RICPR       -----------------------LNGICWFLLSLVTSSINDVMSKYLGTRLHXXXXXXXXXXXXXIVLLP
SAM_RICFE       -----------------------LTGIGWFLLSLVSSSANDVMSKYLGTRLHXXXXXXXXXXXXXIVLLP
SAM_RICCN       -----------------------LTGIGWFLLSLVSSSANDVISKYLGTRLHXXXXXXXXXXXXXIVLLP
Y1234_HELPY     -----------------------LFGVSMILLANLCFGIMSAFVKITADYFSPMENVFYRSITMTLLLLL
YC34_HELPJ      -----------------------LFGVSMILLANLCFGIMSAFVKITADYFSPMENVFYRSITMTLLLLL
YP264_YEAST     ----------------------------------------------------------------------
YYAM_BACSU      ----------------------------MLLGFSIFTGATFNLAKYVGYFSPSSSAAW-RFGLAAAVMLI
Y266_ARCFU      ----------------------------IVLALTVFWGLAFTAIKYSVRFLSPIAIASLRFAIANTLFAV
Y1552_ARCFU     -------------------------GEAAIVLSAVLMGTVSVFVRNVGGDT--LSVTFLRLFFGFLAVLP
Y841_METTH      -----------------------LWGYISIITATIFFGISATLDKIMLSSMHPVTIGAYTYIIFLFFIRE
YVBV_BACSU      ----------------------------------------------------------------------
Y215_LISIN      ----------------------------------------------------------------------
Y176_LISMO      ----------------------------------------------------------------------
YSO2_ACIAM      ----------------------------------------------------------------------
Y2503_LACPL     ----------------------------------------------------------------------
Y1533_ARCFU     ----------------------------------------------------------------------
YOAV_BACSU      ----------------------------------------------------------------------
YDFC_BACSU      ----------------------------------------------------------------------
Y510_ARCFU      ----------------------------------------------------------------------
RARD_ECOLI      ----------------------------------------------------------------------
Y2594_LACPL     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VALASSESPLRSVRPKXXXXXXXXXXXXXXXFITGLRFLPIAEASATSFVAPLFVTALSIVLLGEAIGIR
SAM_RICBR       FVVYYGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLSIAPVTTATVISFSIPLFTLILAVFFLNENIIWQ
SAM_RICTY       FVVYYGKSTLKTRHPVIHVLRGLLLFFGMTSWTYGLTIAPVTTATVISFSIPLFTLILAVFILNENIIWQ
SAM_RICPR       FVVYYGKNALKTSRPFVHVLRGLLLFFGMTSWTYGLTIAPVTTATVVSFAIPLFTLILAVFILNENIIWQ
SAM_RICFE       FVFYHGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLTIAPVTTATVVSFSIPLFTLILAVFFLNENIIWQ
SAM_RICCN       FVVYYGKNTLKTSRPFVHILRGLLLFFGMTSWTYGLTIAPVTTATVVSFSIPLFTLILAVFFLNENIIWP
Y1234_HELPY     I-YPFKPYRLKSYKQKKLAFRVVVGGLAMLAFFYNIEKISLATATAFSQCAPIYTVXXXXXXXXXXXXRS
YC34_HELPJ      I-YPFKPYRLKSYKQKKLAFRVVVGGLAMLAFFYNIEKISLATATAFSQCAPIYTVXXXXXXXXXXXXRS
YP264_YEAST     -----------------------------------LMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKL
YYAM_BACSU      ILIFTEKSQLRKNAVSYIVLGIIGIFGFNALFFVGLKYTSPVNGALIMGLNPLLTAILARIILKDNMTKK
Y266_ARCFU      IIILGKRIKWKDL-PKVFALGIFGVSVYHVFLNLGEVYISSGVASVVISLAPIFVLILSAIFLRERITYS
Y1552_ARCFU     FCLRDVGRPDRTL-----LGLAVFNFLTVASYIAAIQSTEVAMAALLLYMAPVYVIPLS-VLMGERVEVK
Y841_METTH      TPLREGESEARIKRXXXXXXXXXSTVIAPLLFLTGLGDTTAVNASLILNVEVLFIILLGYLIFRETLQLK
YVBV_BACSU      ----------------------------------GLNYLPAGLFSAIVFFQPVLMGVFSWLWLGESMFVM
Y215_LISIN      ----------------------------------------------------------------------
Y176_LISMO      ----------------------------------------------------------------------
YSO2_ACIAM      ----------------------------------GLLYVEPSESAVLSYTMPLIAIPLSTLILREKTTKT
Y2503_LACPL     ----------------------------------------------------------------------
Y1533_ARCFU     -------------------------------YFASLKRSPVSIALPASSTYPVYVVLLSTVIYGAELSLN
YOAV_BACSU      ----------------------------------GMQFVDSGKTSVLVYTMPIFVTVISHFSLNEKMNVY
YDFC_BACSU      -------------------------------------------ASLLVTTAPIFSAMLSRLFYKEHFGFT
Y510_ARCFU      ------------------------------------QFLALKYTTATNASILINTSAVFVALWGLVKGER
RARD_ECOLI      -------------------------------FIWAVNNHHMLEASLGYFINPLVNIVLGMIFLGERFRRM
Y2594_LACPL     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RWVATLVGLIGVLIVIRPGSSTFNPAVILPILSALCWAITLILTRMISGADRAVVTMTFSALVGFLALSA
SAM_RICBR       RWVVTIVGFVGLVITLKPHAEDFNPEMLYFVLAAISFAMLDIINKKFVVKESMISMLFYSAIVTAVVSIP
SAM_RICTY       RWXXXXXXXXXXXXMLKPHTKDFNPEILYLILAAISFAMLDIINKKFVVKESMLSMLFYSAIVTAIVSLP
SAM_RICPR       RWXXXXXXXXXXXXMLKPHTKDFNPEILYLILAAISFAMLDIINKKFVVKESMLSMLFYSAIVTAMVSLP
SAM_RICFE       RWXXXXXXXXXXXXXXKPHTEDFNPEILYFVLAAISFAMLDIINKKFVIKESMISMLFYSAIVTAVVSLP
SAM_RICCN       RWXXXXXXXXXXXXXXKPHAEDFNPEILYFVLAAISFAMLDIINKKFVIKESMISMLFYSAIVTAIVSLP
Y1234_HELPY     TLISACIGIVGVVLISDPSVENVGPVIFMGILSGIFVSLAYITLRDLREYDKQAVILAFASLLGLVGMFI
YC34_HELPJ      ALISACIGLVGVVLISDPSVENVGLVIIMGILSGIFVSLAYITLRDLREYDKQAVILAFAFGMSLLGLAG
YP264_YEAST     EALGSLISFSGVVLIIRPTFETQNPAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSXXXXXSMSL
YYAM_BACSU      QVLGIFFAFIGVLLVITQGSLSISGGDLIIFTGNVCWALYGVLGRRFVKDGTPLSTTTYTMVIGAVSLIV
Y266_ARCFU      KVVGIIIAFLGVVVISEPSYANIY-GIALVMVSTVAAAIYTTFGKSLLSKYNPITLTSNAMVLGSIPLYP
Y1552_ARCFU     TXXXXXXXXXXXXXXXTPAELTF--GIIFGIVSGLSYAIVFVLSKE-ARKKHSPWRITFYNL--GLGSAA
Y841_METTH      DFLGIVLIILGAVYLLTEGDSTINVAVFLVMAAAFFWSLDTVLSKFLSKRDLIFISGVKSSVGGFVLLII
YVBV_BACSU      KVIGLILGFAGVAVISAAGFGGHISGVLLALGSAVSWALGTVYMKKTGSRVDSIWMVALQLTIGSV----
Y215_LISIN      --------------------------IMIALIPALLWGVPLIITKFGGSTRQQTMGMTLGALT-----FA
Y176_LISMO      --------------------------IMIALIPALLWGVPLIITKFGGSTRQQTMGMTLGALT-----FA
YSO2_ACIAM      EVIGILIGFSGVVIYLNLGIYFSLIGIVLTLINAFFWALFTVYFRKLRGFDATSVN-AVQLLLGSLIFFT
Y2503_LACPL     --------------------------ILIALIPAIAWSIGLISGRMGGTARQQTLGMTMGALVFGLALWA
Y1533_ARCFU     ALISAILVFVAVYIIYGSGEKGETSGLFYALLAAFSWALAIL----------------------------
YOAV_BACSU      KTMGLVCGLFGLLFIFGKEMLNIDQSALFVLVAALSWGIANVFSKL------------------------
YDFC_BACSU      KWLGSMISLLGVLLIFGAGDFTYSMSGILVILLA------------------------------------
Y510_ARCFU      KLAGVFLSFAGVVLIVSKGTLEFFSSKVLMIVDGFLWAVYTVLSKMLLKYDHETLTAYAFALIPFALMSG
RARD_ECOLI      QWLAVILAICGVLVQL----WTFGSLPIIALGLAFSFAFGLVRKKIAVEAQTGMLIETMAAIYLFAIADS
Y2594_LACPL     ---------------------------LIAIIPALCWGINPLLVGKINGHSE---NEMFGMGIGD-GLIA


                         .         .         .         +         .         .         .:280
query           MVPFVWVTPSWTDIAIGVGVGLASTIGQWIVVLAFRYADASALAPFSYSQLLWVTILGYAVFSEIPDAWT
SAM_RICBR       AAANYWLTPTLFELAXXXXXXXXXXXXXXXXXKAFSMVDATATAPYRYLELVISAIAAYFIFNEFPDKST
SAM_RICTY       VSMEYWITPSSFELTLLFVLGSSGSFILFFLLKAFTMVDATATAPYRYLELVISAIAAYFIFNEFPDKST
SAM_RICPR       VAMQYWITPSSFELALLFVLGSSGSFILFFLLKAFSIVDATATAPYRYLELVISAIAAYFIFNEFPDKST
SAM_RICFE       VASQYWLTPSGFEXXXXXXXXXXXXXXXXXXXKAFSMVDATATAPYRYLELVISAIAAYFIFSEFPDKST
SAM_RICCN       VASQYWLTPSSFEXXXXXXXXXXXXXXXXXXXKAFSMVDATATAPYRYLELVISVIAAYFIFNEFPDKST
Y1234_HELPY     DIPFLSTVPRKEDILWISLIGISGTLGQYFLTYAYMNAPAGIIAPIEYTRIVWGLLFGLYLGDTFLDLKS
YC34_HELPJ      MIPFLSTIPRKEDILWISLIGISGTLGQYFLTYAYMNAPAGIIAPIEYTRIVWGLLFGLYLGDTFLDLKS
YP264_YEAST     QLPH-----SWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHHWPNIWT
YYAM_BACSU      VSLFTSKPVSLSNIPIGVWGAIA-----------------------------------------------
Y266_ARCFU      FLPDSIRSLGGDLNLIGVFLGIFSTFFGYLGWYYFLEKEEASRASVFLLAIPVVSLLAGNILLAEPLTLR
Y1552_ARCFU     LLPYFLMVGSWL-WAIGLGV-VPTAVPFVLFSYGMKYVKVQRAPILALIEPLCAGLVGYFYFGETLTLTQ
Y841_METTH      MLILGINTELPLELPYALGVSVFSIGCSFILIIAIREIGASMVGALFPLSSLFGAIFAFIILREPFSIMQ
YVBV_BACSU      ---FLLISGFWTESFSAI---------QWTAPFITSLLFISVFV-IALGWLVFFTLVGSGEASKVASYTF
Y215_LISIN      VIVFFFTDPVYTLKTVGISTGCLWTVGQMFQLRAFKIIGVSKAMPISTGQLVGTTLCGVILFHEWDTTLR
Y176_LISMO      VIVFFFTDPVYTLKTVGISTGCLWTVGQMFQLQAFKIIGVSKAMPISTGQLVGTTLCGVILFHEWDTTLR
YSO2_ACIAM      LSP-------------------------------------------------------------------
Y2503_LACPL     VEQPTLTSKIW---LIGIVSGLFWSIGQGQQFTSMKAVGISRTTPISTGQLVANALAGVLLFNEWHGNMY
Y1533_ARCFU     ----------------------------------------------------------------------
YOAV_BACSU      ----------------------------------------------------------------------
YDFC_BACSU      ----------------------------------------------------------------------
Y510_ARCFU      FANPVTFNPETVAALLYLSI-LCSVFAYVVWYYALTNADSTSVAVYVYLVPLFTAIFAFYALNEKPD---
RARD_ECOLI      STSHMGQNPMSLNLLL-IAAGIVTTVPLLCFTAAATRLRLSTLGFFQYIGPTLMFLLAVTFYGEKPGAFI
Y2594_LACPL     LIFWLFSQPTVTISGVTFGLGAAWAIGQLGQYISYRLLGVSKTMPISTAQLVGTSLIGVLMFGE------


                         .         *         .         .         .         .         +:350
query           FVGAVVIICSGVYIAHRERLRRKQNVAPAExxxxx
SAM_RICBR       LHGAVIIIPATLFIIYSEK----------------
SAM_RICTY       AHGAVIIIPATLFIMY-------------------
SAM_RICPR       VHGAVIIIPATLFIIY-------------------
SAM_RICFE       LHGAVIIIPATLFIIYSEK----------------
SAM_RICCN       LHGAVIIIPTTLFIIYSEK----------------
Y1234_HELPY     SLGVALILCSG------------------------
YC34_HELPJ      SLGVALILCSG------------------------
YP264_YEAST     WCGMAVIVSSTIWVINM-RASKQNVVATAE-----
YYAM_BACSU      -----------------------------------
Y266_ARCFU      TVAGSGLVLLGIYIVVRKR----------------
Y1552_ARCFU     LIGGAMIL-AGVLIAWRE-----------------
Y841_METTH      GISGIVML-TGVFILY-------------------
YVBV_BACSU      LIPLISIVASSIFL---------------------
Y215_LISIN      IIIALALIVGGIFL---------------------
Y176_LISMO      IIIALALIVGGIFL---------------------
YSO2_ACIAM      -----------------------------------
Y2503_LACPL     WIGSVIVLIAGAVL---------------------
Y1533_ARCFU     -----------------------------------
YOAV_BACSU      -----------------------------------
YDFC_BACSU      -----------------------------------
Y510_ARCFU      -----------------------------------
RARD_ECOLI      WVALAIFVMDAIYTQRR------------------
Y2594_LACPL     -----------------------------------