[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39477.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
   20::127     3e-04  30%  132 aa  Y293_THEAC RecName: Full=Putative esterase Ta0293;       
  190::274     4e-04  33%  513 aa  CHLB_ZYGCR RecName: Full=Light-independent protochlorophyllide
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFLAAMLDDTMGP
Y293_THEAC      -------------------------IEFEVSYISEGSIEIKVPLKENLMRVGDIMNGGAIMA-ISDAIGG
CHLB_ZYGCR      ---------------------QDLGIQVNEVIPEGGSVENLRNLPKAWLNLVPYREVGLMTALLEKEFGM


                         .         .         *         .         .         .         .:140
query           ALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVATGTATAVIRRMG
Y293_THEAC      LTVMTYGSVINQVTVNFNTEFIRPI------GTGPVIFRSSMV-RIGKNIAYVDVAAIDGNGQLCSKSMG
CHLB_ZYGCR      PYVATVGTAEFVRQIQSHINKWAPMFLGKL----------------------------------------


                         +         .         .         .         .         *         .:210
query           Txxxxxxxxxxx
Y293_THEAC      T-----------
CHLB_ZYGCR      ------------