[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39592.1

[Show Plain Result]


## Summary of Sequence Search
    1::263
   26::255     6e-17  30%  282 aa  YIAJ_ECOLI RecName: Full=HTH-type transcriptional regulator
   28::224     6e-14  30%  254 aa  GYLR_STRGR RecName: Full=Glycerol operon regulatory protein;
   28::224     2e-13  32%  254 aa  GYLR_STRCO RecName: Full=Glycerol operon regulatory protein;
   48::270     2e-12  25%  291 aa  PCAR_PSEPU RecName: Full=Pca regulon regulatory protein;
   17::208     1e-11  24%  259 aa  SRPS_PSEPU RecName: Full=HTH-type transcriptional regulator
   17::208     2e-11  24%  259 aa  TTGV_PSEPU RecName: Full=HTH-type transcriptional regulator
   49::274     6e-11  23%  305 aa  KDGR_ERWCH RecName: Full=Pectin degradation repressor protein kdgR;
    3::221     3e-10  26%  260 aa  YFAX_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   27::253     4e-10  25%  274 aa  ICLR_ECOLI RecName: Full=Acetate operon repressor;
    7::238     7e-10  23%  263 aa  KDGR_ECOLI RecName: Full=Transcriptional regulator kdgR;
   27::253     3e-09  25%  274 aa  ICLR_SALTY RecName: Full=Acetate operon repressor;
   50::242     1e-08  27%  271 aa  ALLR_ECOUT RecName: Full=HTH-type transcriptional repressor
   50::242     1e-08  27%  271 aa  ALLR_ECOLI RecName: Full=HTH-type transcriptional repressor
   50::242     1e-08  27%  271 aa  ALLR_ECOL6 RecName: Full=HTH-type transcriptional repressor
   50::242     1e-08  27%  271 aa  ALLR_ECOL5 RecName: Full=HTH-type transcriptional repressor
   50::242     1e-08  27%  271 aa  ALLR_ECOK1 RecName: Full=HTH-type transcriptional repressor
   50::242     1e-08  27%  271 aa  ALLR_ECO57 RecName: Full=HTH-type transcriptional repressor
   23::204     2e-08  26%  250 aa  KIPR_BACSU RecName: Full=HTH-type transcriptional regulator
   18::240     3e-08  24%  268 aa  Y1032_HAEIN RecName: Full=Uncharacterized HTH-type transcriptional
   24::242     3e-08  23%  272 aa  ALLR_SALTI RecName: Full=HTH-type transcriptional repressor
   24::242     4e-08  23%  272 aa  ALLR_SALTY RecName: Full=HTH-type transcriptional repressor
   24::242     4e-08  23%  272 aa  ALLR_SALPA RecName: Full=HTH-type transcriptional repressor
   24::242     4e-08  23%  272 aa  ALLR_SALCH RecName: Full=HTH-type transcriptional repressor
   50::242     4e-08  25%  272 aa  ALLR_KLEPN RecName: Full=HTH-type transcriptional repressor
    9::231     1e-05  19%  252 aa  YAGI_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
   15::218     1e-05  23%  277 aa  MHPR_ECOLI RecName: Full=Mhp operon transcriptional activator;
   43::252     3e-05  25%  271 aa  POBR_ACIAD RecName: Full=P-hydroxybenzoate hydroxylase
   20::221     3e-04  23%  262 aa  YJHI_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
  224::319     6e-04  29%  436 aa  YHAM_SHIB3 RecName: Full=UPF0597 protein yhaM;
    1::263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxEASPGPLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAGRSYYVGE
YIAJ_ECOLI      ----------LFRGLMLIEILSNYPNGCPLAHLSELAGLNKSTVHRLLQGLQSCGYVTTAPAAGSYRLTT
GYLR_STRGR      ------------------------------SDIASTLGLAKGTAHGILRSLQAEGFVEQEPASGRYQLGA
GYLR_STRCO      ------------------------------SDIASSLGLAKGTAHGILRTLQQEGFVEQDDASGRYQLGA
PCAR_PSEPU      ----------LARGLAVIQAFQERKRHLTIAQISHRTEIPRAAVRRCLHTLIKLGYATSD--GRTYSLLP
SRPS_PSEPU      ----------IARAASIMRALGSHPHGLSLAAIAQLVGLPRSTVQRIINALEEEFLVEALGPAGGFRLGP
TTGV_PSEPU      ----------IARAASIMRALGSHPHGLSLAAIAQLVGLPRSTVQRIINALEEEFLVEALGPAGGFRLGP
KDGR_ERWCH      ----DKQPDSVSSVLKVFGILQALGEEIGITELSQRVMMSKSTVYRFLQTMKSLGYVAQEGESEKYSLTL
YFAX_ECOLI      ----ESSKVPLTRAIDILNLIARI-GPCSAATIIDTLGIPKSTAYLLLNELRRQRF-LSLDHQENFCLWT
ICLR_ECOLI      ----------LTRGLKLLEWIAESNGSVALTELAQQAGLPNSTTHRLLTTMQQQGFVRQGELGH-WAIGA
KDGR_ECOLI      ----DKQPDSVSSVLKVFGILQALGEEIGITELSQRVMMSKSTVYRFLQTMKTLGYVAQEGESEKYSLTL
ICLR_SALTY      ----------LTRGLKLLEWIAESNGSVALTELAQQAGLPNSTTHRLLTTMQQQGFVRQGELGH-WAVGA
ALLR_ECOUT      ------------------------------------LDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_ECOLI      ------------------------------------LDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_ECOL6      ------------------------------------LDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_ECOL5      ------------------------------------LDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_ECOK1      ------------------------------------LDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_ECO57      ------------------------------------LDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
KIPR_BACSU      --------------------------SLTLSELVSLTGMPKTSVHRMVSSLEEMGF-LSRDASGAYSLGL
Y1032_HAEIN     ----------LIRGLRLLDILSNYPNGCPXXXXXXXXXXXXSTAHRLLQGLQNEGYVKPANAAGSYRLTI
ALLR_SALTI      ----------LERGIAILQYLERXXXXXXXXXXXXXLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_SALTY      ----------LERGIAILQYLERXXXXXXXXXXXXXLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_SALPA      ----------LERGIAILQYLERXXXXXXXXXXXXXLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_SALCH      ----------LERGIAILQYLERXXXXXXXXXXXXXLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGL
ALLR_KLEPN      ------------------------------------LDLPLSTTFRLLKVLEGADFVYQDSQLGWWHIGL
YAGI_ECOLI      ------------RALQILDLFNEQATELKITDISKLMGXXXXXXXXXXXXXXXXGYIDQNPENGKYRLGM
MHPR_ECOLI      ----------LTRGLMLLNMLNKLDGGASVGLLAELSGLHRTTVRRLLETLQEEGYVRRSPSDDSFRLTI
POBR_ACIAD      ---------------------------LNVTQVAERTGISRTAARRYLKTLKFLGYL---DTDEHYFLTH
YJHI_ECOLI      ----------------------AWVGMASYMELLNKFQYPKSSLLNLLNVMVDCGFLIKNKNGY-YSLGI
YHAM_SHIB3      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RLTRLLHAGADDGWYASLAGPHLRALTEASTETCYLARLIGSRVVVALSYSPDVRWRGYVQPGIEMPVNA
YIAJ_ECOLI      KFIAVGQKALSSLNIIHIAAPHLEALNIATGETINFSSREDDHAILIYKLEPTLRTRAYI--GQHMPLYC
GYLR_STRGR      ELLALGNSYLDVHELRARALVWTDDLARSSGEAAYLGVLHQQGVLIVHHFRPDDS-RQVLEVGAMHPLHS
GYLR_STRCO      ELLRLGTTYLDVHELRARALVWTDDLARSSGESVHLGVLHQQGVLIVHHFRPDDS-RQVLEIGAMQPLHS
PCAR_PSEPU      KVLTLGHAYLSSTPLAISAQPYLDRISDQLHEAANMATLEGDDILIARSATVERLISVDLSVGGRLPAYC
SRPS_PSEPU      ALGQLINQAQSD--ILSLVKPYLRSLAEELEESVCLASLAGDKIYVLDRIVSERELRVVFPIGINVPXXX
TTGV_PSEPU      ALGQLINQAQTD--ILSLVKPYLRSLAEELDESVCLASLAGDKIYVLDRIVSERELRVVFPIGINVPXXX
KDGR_ERWCH      KLFELGAKALQNVDLIRSADIQMRELSALTRETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLHS
YFAX_ECOLI      RLVELSGHALSKMDLRELARPRLTQLMDTTGLLCHLGIIDNGSAYYILKVESSATISVRSHEGKSLSLYR
ICLR_ECOLI      HAFMVGSSFLQSRNLLAIVHPILRNLMEESGETVNMAVLDQSEAIIIDQVQCTHLMRMSAPIGGKLPMHA
KDGR_ECOLI      KLFELGARALQNVDLIRSADIQMRELSRLTKETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLYS
ICLR_SALTY      HAFIVGSSFLQSRNLLAIVHPILRKLMEDSGETVNLAVLDQSQAIIIDQVQCTQLMRMSAPIGGKLPMHA
ALLR_ECOUT      GVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHA
ALLR_ECOLI      GVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHA
ALLR_ECOL6      GVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHA
ALLR_ECOL5      GVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHA
ALLR_ECOK1      GVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHA
ALLR_ECO57      GVFNVGAAYIHNRDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHA
KIPR_BACSU      VFLEFGQLVADRLDIRKIAKPVMEELCREVDEAVQLIMRDGNEAIYVEKIEGTQTVRLYTAIGRRSPLYA
Y1032_HAEIN     KCLSIGQKVLSSMNIIHVASPYLEQLNLKLGETINFSKREDDHAIMIYKLEPTLKTRAYI--GQYLKLYC
ALLR_SALTI      GVFNVGSAYIHNRDVLSVAGPFMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHA
ALLR_SALTY      GVFNVGSAYIHNRDVLSVAGPFMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHA
ALLR_SALPA      GVFNVGSAYIHNRDVLSVAGPFMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHA
ALLR_SALCH      GVFNVGSAYIHNRDVLSVAGPFMHRLMLLSGETVNVAIRNGNEAVLIGQKECKSMVRMCAPLGSRLPLHA
ALLR_KLEPN      GAFNIGSAYIHNRDVLSVGGPFMRRLMLMSGETVNVAIRNGNEAVLIGQQECKSMVRMCAPLGSRLPLHA
YAGI_ECOLI      KLVERGHFVVGSIDIRQKAKGWLTELSRRTGQTTHLGILDGREGVYIEKIEGKLAAIAYSRIGRRLPVHA
MHPR_ECOLI      KVRQLSEGFRDEQWISALAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTHRFSRLSFHAMVGRRLPLLK
POBR_ACIAD      RVLRFSSSYLSSAHLPKVAQSFLNLLCAQTSLTFSIVVLDEHEVVVARSYLPNLRVSPYMHLGNRLPAHA
YJHI_ECOLI      KNYELGCQALHRQNIFEVTKRPMQELSLKSGLVCHLGAMESSAIYLDKIESPDSVPTSKSWIGKKLELHI
YHAM_SHIB3      -------------------GLHIGATLEKQCERGLLAKDLSSSIVIRTSAASDARMGGATLPAMS---NS


                         +         .         .         .         .         *         .:210
query           AATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRL
YIAJ_ECOLI      SAMGKIYMAFGHPDYVKESHQHEIQPLTRNTITELPAMFDELAHIRESGAAMDREENELGVSCIAVPVFD
GYLR_STRGR      TAHGKVISAFDP-VAHSEVLEGDRATLTGRTVTEAAAFEEVLDLTRARGWALDLEETWEGVASLAAPVHD
GYLR_STRCO      TALGKVLSAYDP-VAHSEALEADRKAFTDRTVCEPDSFEHVLDITRARGYAADVEETWEGIASIAAPIRM
PCAR_PSEPU      TSMGRILLAAMDDTSLREYLG----RADLKARTSRTLHDPEIQQVRAQGWCVVDQELEQGLRSIAVPIYD
SRPS_PSEPU      XXXXXXXXXXXPDETLQAALGEQLPVFTSNT-LRRKALVKQLSEVRQSGFASDLDEHIDGVCSFA-----
TTGV_PSEPU      XXXXXXXXXXXPDETLQAALGEQLPVLTSNT-LGRKALVKQLSEVRQSGVASDLDEHIDGVCSFA-----
KDGR_ERWCH      TAIGKVLLAWRDREEVKEILSQEFKRTTVHTIGSTEELLPQLDLVRQQGYGEDNEEQEEGLRCIAVPVFD
YFAX_ECOLI      SGIGKCLLAWQPAAVIIEGLVWEQATPTTITHPQQ--LHEELARIRRQGWSYDNGEDYADVRCVAAPVFN
ICLR_ECOLI      SGAGKAFLAQLSEEQVTKLLHRKLHAYTHATLVSPVHLKEDLAQTRKRGYSFDDEEHALGLRCLAACIFD
KDGR_ECOLI      TAIGKVLLAWRDRDEVKQILEGEYKRSTERTITSTEALLPVLDQVREQGYGEDNEEQEEGLRCIAVPVFD
ICLR_SALTY      SGAGKAFLSQLSEEQVTSLLHRKLHAYTHATLVSPLHLKDDLAQTRKRGYSFDDEEHALGLRCVASCIYD
ALLR_ECOUT      SGAGKALLYPLAEIILQTGLQQFTPTTLVDMPTLLKDLEQ----ARELGYTVDKEEHVVGLNCIASAIYD
ALLR_ECOLI      SGAGKALLYPLAEIILQTGLQQFTPTTLVDMPTLLKDLEQ----ARELGYTVDKEEHVVGLNCIASAIYD
ALLR_ECOL6      SGAGKALLYPLAEIILQTGLQQFTPTTLVDMPTLLKDLEQ----ARELGYTVDKEEHVVGLNCIASAIYD
ALLR_ECOL5      SGAGKALLYPLAEIILQTGLQQFTPTTLVDMPTLLKDLEQ----ARELGYTVDKEEHVVGLNCIASAIYD
ALLR_ECOK1      SGAGKALLYPLAEIILQTGLQQFTPTTLVDMPTLLKDLEQ----ARELGYTVDKEEHVVGLNCIASAIYD
ALLR_ECO57      SGAGKALLYPLAEIILQTGLQQFTPTTLVDMPTLLKDLEQ----ARELGYTVDKEEHVVGLNCIASAIYD
KIPR_BACSU      GACARSILSFLPREEI-EAYIKQTELISIGSGTPEKLLQEIDASVQ-NGYTVSYSELENYTAAIGAPI--
Y1032_HAEIN     SAMGKIFLAYEKKV---DYLSHEIKKLTRYTITELDDIKLELETIRQTAYAMDREENELGVTCIACPIFD
ALLR_SALTI      SGAGKALLPLTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLERAREQGYTVDQEEHVVGLNCIASAIYD
ALLR_SALTY      SGAGKALLPLTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLEQAREQGYTVDQEEHVVGLNCIASAIYD
ALLR_SALPA      SGAGKALLPLTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLEQAREQGYTVDQEEHVVGLNCIASAIYD
ALLR_SALCH      SGAGKALLPLTEEELVGIVVNTGLRRFTPTTLVDLPILLKNLEQAREQGYTVDQEEHVVGLNCIASAIYD
ALLR_KLEPN      SGAGKALLPLPAEELVDVIVKTGLQRFTPTTIVDLPVLQRNLDEARACGYSIDQEEHVTGLNCIASAVYD
YAGI_ECOLI      TAIGKVLIAWXXXXXXXXXXXYQYTTFTPATLASREALMSALAQTREQGYALDSEENEQGVRCVAVPVWN
MHPR_ECOLI      TASGLTWLAFCPEQDRKELIEMLASRPGDDYQLAREPLKLELARARKEGYGQNYWDQEEKIASIAVPLR-
POBR_ACIAD      TSTGKVLLSVLDREVQIEWIEYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGLIAIAVPVLN
YJHI_ECOLI      TALGKALLAWKTREELLEALT--LTPHTRNTFTDKKLFLEELQKTRLRGWAIDNEESTYGAVCLSMPVFN
YHAM_SHIB3      GSGNQGITATMSVVVVAEADDERLARALMLSHLSAIYIHNQLPRL-------------------------


                         .         .         .         +         .         .         .:280
query           PNGAVLHSVGMTGPLERIMNKQLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YIAJ_ECOLI      IHGRVPYAVSITSRLKQVGEKNL------------------------------
GYLR_STRGR      RRRMAVGAVGVTGPVERL-----------------------------------
GYLR_STRCO      PVGA----VGITGAVERL-----------------------------------
PCAR_PSEPU      ASGQVLAALNVSTHVGRVTRSEL------------------------------
SRPS_PSEPU      -----------------------------------------------------
TTGV_PSEPU      -----------------------------------------------------
KDGR_ERWCH      RFGVVIAGLSISFPTIR------------------------------------
YFAX_ECOLI      ANNELTAAISVVG----------------------------------------
ICLR_ECOLI      EHREPFAAISISGPISRITDDRVT-----------------------------
KDGR_ECOLI      RFGVVIAGLSISFPTLRFSEERL------------------------------
ICLR_SALTY      EHREPFAALSISGPCSRITDDRVT-----------------------------
ALLR_ECOUT      DVGSVVAAISISGPSSRL-----------------------------------
ALLR_ECOLI      DVGSVVAAISISGPSSRL-----------------------------------
ALLR_ECOL6      DVGSVVAAISISGPSSRL-----------------------------------
ALLR_ECOL5      DVGSVVAAISISGPSSRL-----------------------------------
ALLR_ECOK1      DVGSVVAAISISGPSSRL-----------------------------------
ALLR_ECO57      DVGSVVAAISISGPSSRL-----------------------------------
KIPR_BACSU      -----------------------------------------------------
Y1032_HAEIN     SFGQVEYAISVSMSIYRL-----------------------------------
ALLR_SALTI      DAGSVVAAISISGPASRL-----------------------------------
ALLR_SALTY      DAGSVVAAISISGPASRL-----------------------------------
ALLR_SALPA      DAGSVVAAISISGPASRL-----------------------------------
ALLR_SALCH      DAGSVVAAISISGPASRL-----------------------------------
ALLR_KLEPN      DVGSVVAAISISGPASRL-----------------------------------
YAGI_ECOLI      HESRVIAALSLSTLTSRVDDAELA-----------------------------
MHPR_ECOLI      -----------------------------------------------------
POBR_ACIAD      AQGLTIAALNCMSQTNRVQPQYL------------------------------
YJHI_ECOLI      MYNRVNYAISLSG----------------------------------------
YHAM_SHIB3      -----------------------------------------------------