[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39673.1

[Show Plain Result]


## Summary of Sequence Search
    1::441
   48::408     1e-45  34%  417 aa  AMIC_ECOLI RecName: Full=N-acetylmuramoyl-L-alanine amidase amiC;  
   48::408     1e-45  34%  417 aa  AMIC_ECOL6 RecName: Full=N-acetylmuramoyl-L-alanine amidase amiC;  
   13::416     6e-38  30%  416 aa  AMIC_NEIMB RecName: Full=N-acetylmuramoyl-L-alanine amidase amiC;  
   52::276     2e-34  38%  289 aa  AMIA_SALTY RecName: Full=Probable N-acetylmuramoyl-L-alanine
   47::276     8e-33  36%  289 aa  AMIA_ECOLI RecName: Full=Probable N-acetylmuramoyl-L-alanine
   25::234     4e-26  34%  432 aa  AMIB_HAEIN RecName: Full=Probable N-acetylmuramoyl-L-alanine
  149::411     8e-24  30%  439 aa  AMIB_SALTY RecName: Full=N-acetylmuramoyl-L-alanine amidase amiB;  
   19::416     6e-22  25%  445 aa  AMIB_ECOLI RecName: Full=N-acetylmuramoyl-L-alanine amidase amiB;  
   18::204     2e-18  35%  206 aa  YQII_BACSU RecName: Full=Uncharacterized protein yqiI;
  121::290     1e-16  40%  291 aa  LYTH_STAHJ RecName: Full=Probable cell wall amidase lytH;       
    7::230     2e-16  23%  237 aa  AMIB_BUCAI RecName: Full=Putative N-acetylmuramoyl-L-alanine
    2::213     2e-14  25%  217 aa  AMIB_BUCBP RecName: Full=Putative N-acetylmuramoyl-L-alanine
  346::517     6e-14  33%  518 aa  YRVJ_BACSU RecName: Full=Putative N-acetylmuramoyl-L-alanine
  122::290     2e-13  39%  291 aa  LYTH_STAAW RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAAU RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAAS RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAAN RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAAM RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAAC RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAAB RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAA8 RecName: Full=Probable cell wall amidase lytH;       
  122::290     2e-13  39%  291 aa  LYTH_STAA3 RecName: Full=Probable cell wall amidase lytH;       
    1::228     2e-13  22%  233 aa  AMIB_BUCAP RecName: Full=Putative N-acetylmuramoyl-L-alanine
  322::487     9e-13  33%  496 aa  CWLB_BACSU RecName: Full=N-acetylmuramoyl-L-alanine amidase cwlB;  
  122::290     2e-12  37%  291 aa  LYTH_STAEQ RecName: Full=Probable cell wall amidase lytH;       
  122::290     3e-12  35%  291 aa  LYTH_STAES RecName: Full=Probable cell wall amidase lytH;       
    4::184     3e-12  34%  255 aa  CWLC_BACSU RecName: Full=Sporulation-specific
  106::291     4e-12  31%  291 aa  LYTH_STAS1 RecName: Full=Probable cell wall amidase lytH;       
    4::156     2e-11  36%  253 aa  CWLM_BACLI RecName: Full=N-acetylmuramoyl-L-alanine amidase cwlM;  
  378::520     3e-08  33%  531 aa  Y6545_BACAN RecName: Full=Uncharacterized cell wall amidase
   63::232     4e-06  30%  237 aa  CWLD_BACSU RecName: Full=Germination-specific
    1::441

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTAGVAGEAVATSAPAPTSFPIAAEVRLAGDDTQTRFV
AMIC_ECOLI      ------------------------------------------------------------------TRVT
AMIC_ECOL6      ------------------------------------------------------------------TRVT
AMIC_NEIMB      ---------------------------------TAGTALSPIASAVAKTVRAPQFTAARIWPSHTYTRLT
AMIA_SALTY      ----------------------------------------------------------------------
AMIA_ECOLI      ----------------------------------------------------------------------
AMIB_HAEIN      ----------------------------------------------------------------------
AMIB_SALTY      ----------------------------------------------------------------------
AMIB_ECOLI      ------------------------------------------------PVGAATLSDIQVSNGNQQARIT
YQII_BACSU      ----------------------------------------------------------------------
LYTH_STAHJ      ----------------------------------------------------------------------
AMIB_BUCAI      ----------------------------------------------------------------------
AMIB_BUCBP      ----------------------------------------------------------------------
YRVJ_BACSU      ----------------------------------------------------------------------
LYTH_STAAW      ----------------------------------------------------------------------
LYTH_STAAU      ----------------------------------------------------------------------
LYTH_STAAS      ----------------------------------------------------------------------
LYTH_STAAN      ----------------------------------------------------------------------
LYTH_STAAM      ----------------------------------------------------------------------
LYTH_STAAC      ----------------------------------------------------------------------
LYTH_STAAB      ----------------------------------------------------------------------
LYTH_STAA8      ----------------------------------------------------------------------
LYTH_STAA3      ----------------------------------------------------------------------
AMIB_BUCAP      ----------------------------------------------------------------------
CWLB_BACSU      ----------------------------------------------------------------------
LYTH_STAEQ      ----------------------------------------------------------------------
LYTH_STAES      ----------------------------------------------------------------------
CWLC_BACSU      ----------------------------------------------------------------------
LYTH_STAS1      ----------------------------------------------------------------------
CWLM_BACLI      ----------------------------------------------------------------------
Y6545_BACAN     ----------------------------------------------------------------------
CWLD_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IDLDRTVPMRAFALADPYRVVIDLPQVNFRLPAASGGTGRGLIKAYRYGLVMPGGSRVVLELSGPAKITK
AMIC_ECOLI      VESNRQLKYKQFALSNPERVVVDIEDVNLNSVAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVK-PQ
AMIC_ECOL6      VESNRQLKYKQFALSNPERVVVDIEDVNLNSVAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVK-PQ
AMIC_NEIMB      LESTAALKYQHFTLDNPGRLVVDIQNANINTVSQKVMADDPFIRSIRAGQNTPTTVRLVIDLKQPTH-AQ
AMIA_SALTY      ----------------------------------------------------------------------
AMIA_ECOLI      ----------------------------------------------------------------------
AMIB_HAEIN      ----------------------------------------------------------------------
AMIB_SALTY      ----------------------------------------------------------------------
AMIB_ECOLI      LSFIGD-PDYAFSHQSKRTVALDIKQTGVIQGLPLLFSGNNLVKAIRSGTPKDAQTRLVVDLTENGK---
YQII_BACSU      ----------------------------------------------------------------------
LYTH_STAHJ      ----------------------------------------------------------------------
AMIB_BUCAI      ----------------------------------------------------------------------
AMIB_BUCBP      ----------------------------------------------------------------------
YRVJ_BACSU      ----------------------------------------------------------------------
LYTH_STAAW      ----------------------------------------------------------------------
LYTH_STAAU      ----------------------------------------------------------------------
LYTH_STAAS      ----------------------------------------------------------------------
LYTH_STAAN      ----------------------------------------------------------------------
LYTH_STAAM      ----------------------------------------------------------------------
LYTH_STAAC      ----------------------------------------------------------------------
LYTH_STAAB      ----------------------------------------------------------------------
LYTH_STAA8      ----------------------------------------------------------------------
LYTH_STAA3      ----------------------------------------------------------------------
AMIB_BUCAP      ----------------------------------------------------------------------
CWLB_BACSU      ----------------------------------------------------------------------
LYTH_STAEQ      ----------------------------------------------------------------------
LYTH_STAES      ----------------------------------------------------------------------
CWLC_BACSU      ----------------------------------------------------------------------
LYTH_STAS1      ----------------------------------------------------------------------
CWLM_BACLI      ----------------------------------------------------------------------
Y6545_BACAN     ----------------------------------------------------------------------
CWLD_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ADMLEAANGQPARMVIELGSVDRTAFVESLGVEKGPELRPAIGAADATSSVPHRVESPKLDAAKDDLRPV
AMIC_ECOLI      LFALAPVAGFKERLVMDLYPANAQDMQDPLLA-----LLEDYNKGDLEKQVPPAQSGPQPGKAGRDRPIV
AMIC_ECOL6      LFALAPVAGFKERLVMDLYPANAQDMQDPLLA-----LLEDYNKGDLEKQVPPAQSGPQPGKAGRDRPIV
AMIC_NEIMB      VFALPPVGGFKNRLVVDLYPHGMDADDPMMALLNGSLNKTLRGSPEADLA---QNTTXXXXXXXXXXXXV
AMIA_SALTY      ---------------------------------------------------------------KTGSKRL
AMIA_ECOLI      ----------------------------------------------------------KPKAKKSGGKRV
AMIB_HAEIN      ----------------------------------------------------------------------
AMIB_SALTY      ---------EPARNPFK-SSDDRLTGVTSSNTVTRPAARASAGAGD---------------------KVV
AMIB_ECOLI      TEAVKRQNGSNYTVVFTINADXXXXXXXXXXXAKRVET-PAVVAPRVSEPAPFKTESNRTTSSNTVTRPI
YQII_BACSU      --------------------------------------------------------APCAQAAEPIEGKT
LYTH_STAHJ      ---------------------------------------------------------------------V
AMIB_BUCAI      ----------------------------------------------------------------------
AMIB_BUCBP      ---------------------------------------------------------------------I
YRVJ_BACSU      ----------------------------------------------------------------------
LYTH_STAAW      ----------------------------------------------------------------------
LYTH_STAAU      ----------------------------------------------------------------------
LYTH_STAAS      ----------------------------------------------------------------------
LYTH_STAAN      ----------------------------------------------------------------------
LYTH_STAAM      ----------------------------------------------------------------------
LYTH_STAAC      ----------------------------------------------------------------------
LYTH_STAAB      ----------------------------------------------------------------------
LYTH_STAA8      ----------------------------------------------------------------------
LYTH_STAA3      ----------------------------------------------------------------------
AMIB_BUCAP      ----------------------------------------------------------------------
CWLB_BACSU      ----------------------------------------------------------------------
LYTH_STAEQ      ----------------------------------------------------------------------
LYTH_STAES      ----------------------------------------------------------------------
CWLC_BACSU      ----------------------------------------------------------------------
LYTH_STAS1      ------------------------------------------------------IQADKNPNAKPLKDKT
CWLM_BACLI      ----------------------------------------------------------------------
Y6545_BACAN     ----------------------------------------------------------------------
CWLD_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IVLDPGHGGIDNGTQSQSGVSEKALVLEFALALRDQMEKGGKYRVVLTRTDDTFIPLNDRVKIARAHSAA
AMIC_ECOLI      IMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRAD
AMIC_ECOL6      IMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRAD
AMIC_NEIMB      IMLDPGHGGEDPGAISPGGLQEKHVVLSIARETKNQLEALG-YNVFMTRNEDVFIPLXXXXXXXXXXXXD
AMIA_SALTY      VMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHG-IDARLTRTGDTFIPLYDRVEIAHKHGAD
AMIA_ECOLI      VVLDPGHGGIDTGAIGRNGSKEKHVVLAIAKNVRSILRNHG-IDARLTRSGDTFIPLYDRVEIAHKHGAD
AMIB_HAEIN      IAIDPGHGGKDPGAISRNGIYEKNVTLSIAKELKALLDKDPHFRGVLTRKSDYYISVPERSEIARKFKAN
AMIB_SALTY      IAIDXXXXXXXXXXXXXXXTREKNVTIAIARKLRTLLNNDPMFKGVLTRDGDYFISVMGRSDVARKQNAN
AMIB_ECOLI      IAIDXXXXXXXXXXXXXXXTREKNVTIAIARKLRTLLNDDPMFKGVLTRDGDYFISVMGRSDVARKQNAN
YQII_BACSU      VYIDAGHGGEDSGAVG-NGLFEKDINLAVSEHVTDKLKEEGA-NPVASRSDDHFLTLEERVAKASANQAD
LYTH_STAHJ      IVLDPGHGGNDQGASSNTSKKEKNYTLKTAKELRRALEKAGA-TVKLTRSDDTYVSLDDRKLNGDA----
AMIB_BUCAI      ILIDAGHGGYDPGAIGIRGLKEKNINIEIALKLEKLLNHDKMFCTILTRHNDSYXXXXXXXXXXXXNQVN
AMIB_BUCBP      IAIDAGHGGQDPGAIGKNKFQEKNITLSIAKKLTKLLNHTNFFKAVMIRRGNYFLSVFKRTQIAEKYHAN
YRVJ_BACSU      IIVDPGHGGKDSGTIGYSGKFEKNLTIKTAKLLASKLRSAGA-DVYVTRQDDTFVSLQSRVSTSHYRNAD
LYTH_STAAW      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAAU      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAAS      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAAN      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAAM      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAAC      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAAB      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAA8      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
LYTH_STAA3      IVLDPGHGGSDQGASSNTKYKEKDYTLKTAKELQRTLEKEGA-TVKMTRTDDTYVSLENRDIKGDA----
AMIB_BUCAP      -MIDPGHGGQDPGAINSLGLQEXXXXXXXXXXXXXXXQNSDLFYPVLTRNDDSYVSLKKRRDFLKNNHVS
CWLB_BACSU      IFIDPGHGDQDSGAIG-NGLLEKEVNLDIAKRVNTKLNASGALPV-LSRSNDTFYSLQERVNKAASAQAD
LYTH_STAEQ      IVLDPGHGGSDQGASSSSKSLEKNYXXXXXXXXXXXXXXXGAH-VKMTRSNDKYVSLDDRNIKGDA----
LYTH_STAES      IVLDPGHGGSDQGASSSSKSLEKNYXXXXXXXXXXXXXXXGAH-VKMTRSNDKYVSLDDRNIKGDA----
CWLC_BACSU      IFIDPGHGGSDPGATG-NGLQEKTLTLQIALALRTILTNEYEVSLLLSRTSDQYVSLNDRTNAANNWGAD
LYTH_STAS1      IVLDPGHGGSDQGASSNTHKKSKEKVYXXXXXXXXXXXXXXXXXXVMTRESDTYVTLDDRNIKGDA----
CWLM_BACLI      IFIDPGHGGSDTGA-SANGLQEKQLTLQTALALRNMLNEYQNVSVLLSRTSDQTVSLTQRTNAANSWGAD
Y6545_BACAN     -----------------------------ALLTRDAYSRPGK-----NATDS----LGKRVEFAKKNKGD
CWLD_BACSU      ---------------------EKDVTLEVAFRVRDYLQEQGAL-VIMTRESDTDLALRQRVKLINHSEAE


                         .         *         .         .         .         .         +:350
query           LFVSIHADALPRGEGDAQGATIYTLSDKASDAEAQRLADAENKADAIGGVNLTEEPTEVADILIDLAQRE
AMIC_ECOLI      LFVSIHADAFTSRQ--PSGSSVFALSTKATSTAAKYLAQTQNASDLIGGVSKSGD-RYVDHTMFDMVQSL
AMIC_ECOL6      LFVSIHADAFTSRQ--PSGSSVFALSTKATSTAAKYLAQTQNASDLIGGVSKSGD-RYVDHTMFDMVQSL
AMIC_NEIMB      VFVSIHADAFT--SPSARGTGVYMLNTKATSSAAKFLEQTQNNADAVGGVP-TSGNRNVDTALLDMTQTA
AMIA_SALTY      LFMSIHADGFTNPK--AAGASVFALSNRASSAMAKYLSERENRADEVAGKKATDRDHLLQQVLFDLVQTD
AMIA_ECOLI      LFMSIHADGFTNPK--AAGASVFALSNRASSAMAKYLSERENRADEVAGKKATDKDHLLQQVLFDLVQTD
AMIB_HAEIN      YLISIHADS--SKSPDRRGASVWVLSNRANDEMGQWLEDDEKRSELLGGAGLSHNNDKYLDTVLDLQFGH
AMIB_SALTY      FLVSIHADAAPNR--DATGASVWVLSNRRANSEANWLEQHEKQSELLGGANSQSDPY-LSQAVLDLQFGH
AMIB_ECOLI      FLVSIHADAAPNRS--ATGASVWVLSNRRANSEASWLEQHEKQSELLGGANSQSDPY-LSQAVLDLQFGH
YQII_BACSU      LFVSIHVNS---GVASASGTETYFQSD----------YEGEN----------------------------
LYTH_STAHJ      -YISIHNDSL--DSPNANGATVYWY---------------KNNQEAL-----------------------
AMIB_BUCAI      FLISIHADS--SRKQNVSGASIWIVSKTRINREINNY--LKNKSTLLFSKKINKNDFFLKKTILDLQSNN
AMIB_BUCBP      LLISIHANSSKNRK--ISGVSIWVLPKNVHNTRIQXXXXXXXXXXXXXXXXXXXXXKNFYEIEYDL----
YRVJ_BACSU      AFISIHYDSY--ADTSTRGSTAYYY----SPAKDQELA---------------------SDVHSEVVKRS
LYTH_STAAW      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAAU      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAAS      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAAN      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAAM      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAAC      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAAB      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAA8      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
LYTH_STAA3      -YLSIHNDALE--SSNANGMTVYWYHD-----NQRALADT-----------------------LDATIQK
AMIB_BUCAP      FLISIHADSSKKRY--VSGASIWITTNDRMHREINNFIKEENIYFPKNIQNLIQKNKHLKKTVLDLQFNN
CWLB_BACSU      LFLSIHANA----------------NDSSSPNGSETYYDTTYQA--------------------------
LYTH_STAEQ      -FISIHNDAL--DSSNANGVTVYWFKDK----------------------------------------QE
LYTH_STAES      -FISIHNDAL--DSSNANGVTVYWFKDK------------------------------------------
CWLC_BACSU      FFLSIHVNS-----GGGTGFESYIYPD-------------------VGAPTTTYQSTIHSEVIVDFADRG
LYTH_STAS1      -YISIHNDSLKSSK--ANGSTVYWFKDN------------------------------------------
CWLM_BACLI      YFLSIHMNA---GGGTGFEDYIY---------------------PGVGAPTTT-----------------
Y6545_BACAN     IFVSIHANGF---NGNAHGTETFYY----------------------------KAPTQKSNPYVN-----
CWLD_BACSU      LYISIHLNAIP--------------SQKWSGAQSFYYGKAEN-------------------------EKV


                         .         .         .         .         *         .         .:420
query           TKTFSNRFAQTLMREMKSATRLHKQPLKSAGFRVLKAPDVPSVLLELGYVSNKGDLKQLVSEQWRTKTVG
AMIC_ECOLI      TIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAE
AMIC_ECOL6      TIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAE
AMIC_NEIMB      TLRDSRKLGKLVLEELGRLNHLHKGRVDEANFAVLRAPDMPSILVETAFLSNPAEEKLLGSESFRRQCAQ
AMIA_SALTY      TIKNSLTLGSXXXXXXXXXXXXXSRTTEQAAFVVLKSPSIPSVLVETSFITNPEEERLLGTTAFRQKIAT
AMIA_ECOLI      TIKNSLTLGSHILKKIKPVHKLHSRNTEQAAFXXXXXXXXXXXXXETSFITNPEEERLLGTAAFRQKIAT
AMIB_HAEIN      SQRTGYVLGEHILHHFAKVTTLSRSTPQHASLGVLRSPDIPSVLVETGFLSNSEEEKKLNSQTYRRR---
AMIB_SALTY      SQRVGYDVATNVLSQLDGVGSLHKRRPEHASLGVLRSPDIPSILVETGFISNHGEERLLASDRYQQQIAD
AMIB_ECOLI      SQRVGYDVATSMISQLQRIGEIHKRRPEHASLGVLRSPDIPSVLVETGFISNNSEERLLASDDYQQQLAE
YQII_BACSU      ----SRRLASDIQSQLVSSLQTRDRGVKESDFYVITYSQMPSVLAELGFITNSSDADKLGSEEYQQKAAD
LYTH_STAHJ      --------AETLNTNIQKKAMLFNRGTRQENFQVLRQTNKPAVLLELGYISNPTDEVMIRNQIHRQVVEE
AMIB_BUCAI      FQKIELDLSKEILKQLEKNTKLNKKYPNYASLGILSSINTPSILIETGFITNILEGKKLKTTNYQNKIAN
AMIB_BUCBP      --------AKIIIQELRKVSTLNQKKPKYAKFGILKFSQFPSILVETGFISNPIEEQHLNKKFYQNLISK
YRVJ_BACSU      S--------------------IPDRGVLFGDYYVLRENRQPAMLYELGYVSHPQEEAIVHSNSYQEKVTD
LYTH_STAAW      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAAU      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAAS      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAAN      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAAM      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAAC      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAAB      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAA8      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
LYTH_STAA3      KGLLSNRGS------------------RQENYQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQ
AMIB_BUCAP      FQKMEINLSRYIFQQXXXXXXXXXXXXXYASLGILSSINTPSMLIETGFITNFLEEKKLRTNKYQNKIAN
CWLB_BACSU      --ANSKRLAEQIQPKLAANLGTRDRGVKTAAFYVIKYSKMPSVLVETAFITNASDASKLKQAVYKDKAAQ
LYTH_STAEQ      T------LAQTLNSAIQKKALLTNRGSRQQNYQVLRQTDIPAVLLELGYISNPTDESMINDQLHRQVVEQ
LYTH_STAES      ----QESLAQTLNSAIQKKALLTNRGSRQQNYQVLRQTDIPAVLLELGYISNPTDESMINDQLHRQVVEQ
CWLC_BACSU      KKT--------------------------ANFHVLRESAMPALLTENGFIDTVSDANKLKTSSFIQSLAR
LYTH_STAS1      ----QKALAETLSASLQKKALLTNKGARQENFQVLRQTNVPAVLLELGYISNPTDEDMITEKLHRHIVEQ
CWLM_BACLI      -------YRDIMHEEILKVVDFRDRGKKTANFHVLRETAMPALLTENGFVDNTNDAEKLKS---------
Y6545_BACAN     ---DSRILAEKIQKRLITALQTRDRGVKIGNLYVLRENTMPSVLTELGFVDNKADGKKLDSPEWRQRAAE
CWLD_BACSU      AKYIQDELRRNLENTTRKAKRIH-------GIYLMQNVTKPGALIEVGFLSNPSEATLLGKPKYQDKVAS


                         .         .         +         .         .         .         .:490
query           AVALAIDSFFAKRLVSAGxxx
AMIC_ECOLI      SILAGIKAYFA----------
AMIC_ECOL6      SILAGIKAYFA----------
AMIC_NEIMB      SIASGVQRYINTSVLKRG---
AMIA_SALTY      AIANGIISYF-----------
AMIA_ECOLI      AIAEGVISYF-----------
AMIB_HAEIN      ---------------------
AMIB_SALTY      AIYRGLRKYFA----------
AMIB_ECOLI      AIYKGLRNYF-----------
YQII_BACSU      AIVNGIDSYY-----------
LYTH_STAHJ      AVVDGLKQYFA----------
AMIB_BUCAI      SIYLGLKNYFTK---------
AMIB_BUCBP      SISIALKKYFLKRI-------
YRVJ_BACSU      GIESGLEKYF-----------
LYTH_STAAW      AIVDGLKIYFS----------
LYTH_STAAU      AIVDGLKIYFS----------
LYTH_STAAS      AIVDGLKIYFS----------
LYTH_STAAN      AIVDGLKIYFS----------
LYTH_STAAM      AIVDGLKIYFS----------
LYTH_STAAC      AIVDGLKIYFS----------
LYTH_STAAB      AIVDGLKIYFS----------
LYTH_STAA8      AIVDGLKIYFS----------
LYTH_STAA3      AIVDGLKIYFS----------
AMIB_BUCAP      AIYIALKNYFQDRLLS-----
CWLB_BACSU      AI-------------------
LYTH_STAEQ      AIVDGLKQYFS----------
LYTH_STAES      AIVDGLKQYFS----------
CWLC_BACSU      GHANGLEAFNLKKTSSSG---
LYTH_STAS1      AIVEGLRAYFSE---------
CWLM_BACLI      ---------------------
Y6545_BACAN     AIYAGILDYY-----------
CWLD_BACSU      SIYKGILRYFTEK--------