[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39735.1

[Show Plain Result]


## Summary of Sequence Search
    1::351
   38::321     5e-43  41%  325 aa  SYK3_PROMH RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     3e-41  38%  325 aa  SYK3_KLEP7 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     3e-41  38%  325 aa  SYK3_KLEP3 RecName: Full=Putative lysyl-tRNA synthetase;       
   38::316     3e-40  40%  323 aa  SYK3_MANSM RecName: Full=Putative lysyl-tRNA synthetase;       
   38::318     3e-40  38%  325 aa  SYK3_ERWCT RecName: Full=Putative lysyl-tRNA synthetase;       
   38::318     9e-40  38%  325 aa  SYK3_PECCP RecName: Full=Putative lysyl-tRNA synthetase;       
   37::320     1e-39  37%  324 aa  SYK3_VIBCH RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-39  36%  325 aa  SYK3_ESCF3 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     2e-39  36%  325 aa  SYK3_SALAR RecName: Full=Putative lysyl-tRNA synthetase;       
   38::318     2e-39  38%  325 aa  SYK3_EDWI9 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::316     3e-39  37%  323 aa  SYK3_HAES2 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::316     3e-39  37%  323 aa  SYK3_HAES1 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_SHIFL RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_SHIF8 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_SHIB3 RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     7e-39  37%  325 aa  SYK3_SERP5 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALSV RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALPK RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALPC RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALPB RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALPA RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALNS RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  36%  325 aa  SYK3_SALCH RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOUT RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOSM RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOSE RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOLU RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOLI RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOL6 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOL5 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOHS RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECODH RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECOBW RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO8A RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO81 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO7I RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO5E RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO57 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO55 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO45 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO27 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     7e-39  35%  325 aa  SYK3_ECO24 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  36%  325 aa  SYK3_SALDC RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  35%  325 aa  SYK3_ECOLC RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  36%  325 aa  SYK3_SALTY RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  36%  325 aa  SYK3_SALTI RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  36%  325 aa  SYK3_SALHS RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  36%  325 aa  SYK3_SALEP RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     1e-38  36%  325 aa  SYK3_SALA4 RecName: Full=Putative lysyl-tRNA synthetase;       
   42::320     2e-38  38%  327 aa  SYK3_HAEDU RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     2e-38  35%  325 aa  SYK3_ENT38 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     2e-38  36%  325 aa  SYK3_SODGM RecName: Full=Putative lysyl-tRNA synthetase;       
   37::315     5e-38  39%  322 aa  SYK3_HAEGA RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     8e-38  37%  325 aa  SYK3_YERE8 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::318     8e-38  36%  325 aa  SYK3_ERWT9 RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPY RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPS RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPP RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPN RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPG RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPE RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPB RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERPA RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     2e-37  37%  325 aa  SYK3_YERP3 RecName: Full=Putative lysyl-tRNA synthetase;       
   38::318     3e-37  38%  325 aa  SYK3_PHOLL RecName: Full=Putative lysyl-tRNA synthetase;       
    2::316     3e-37  36%  323 aa  SYK3_ACTSZ RecName: Full=Putative lysyl-tRNA synthetase;       
    5::319     5e-37  33%  323 aa  SYK3_VIBPA RecName: Full=Putative lysyl-tRNA synthetase;       
    5::319     2e-36  34%  323 aa  SYK3_VIBHB RecName: Full=Putative lysyl-tRNA synthetase;       
   38::321     6e-36  36%  325 aa  SYK3_HAMD5 RecName: Full=Putative lysyl-tRNA synthetase;       
    5::319     6e-35  37%  323 aa  SYK3_VIBVY RecName: Full=Putative lysyl-tRNA synthetase;       
    5::319     6e-35  37%  323 aa  SYK3_VIBVU RecName: Full=Putative lysyl-tRNA synthetase;       
    7::316     1e-34  35%  323 aa  SYK3_PASMU RecName: Full=Putative lysyl-tRNA synthetase;       
   37::317     2e-34  37%  324 aa  SYK3_PSEHT RecName: Full=Putative lysyl-tRNA synthetase;       
    5::319     2e-34  33%  323 aa  SYK3_PHOPR RecName: Full=Putative lysyl-tRNA synthetase;       
   74::320     1e-31  39%  327 aa  SYK3_BAUCH RecName: Full=Putative lysyl-tRNA synthetase;       
   36::317     1e-31  34%  324 aa  SYK3_BUCAP RecName: Full=Putative lysyl-tRNA synthetase;       
  157::486     7e-31  33%  498 aa  SYK_DEHSC RecName: Full=Lysyl-tRNA synthetase;       
  157::486     7e-31  33%  498 aa  SYK_DEHSB RecName: Full=Lysyl-tRNA synthetase;       
   37::320     7e-31  33%  324 aa  SYK3_BUCAI RecName: Full=Putative lysyl-tRNA synthetase;       
  157::486     1e-30  33%  498 aa  SYK_DEHE1 RecName: Full=Lysyl-tRNA synthetase;       
  206::500     4e-30  31%  506 aa  SYK_PELTS RecName: Full=Lysyl-tRNA synthetase;       
  167::496     1e-29  34%  503 aa  SYK_IDILO RecName: Full=Lysyl-tRNA synthetase;       
  224::488     9e-29  31%  501 aa  SYK_CAMJR RecName: Full=Lysyl-tRNA synthetase;       
  224::488     9e-29  31%  501 aa  SYK_CAMJ8 RecName: Full=Lysyl-tRNA synthetase;       
  202::495     2e-28  31%  501 aa  SYK_MAGSM RecName: Full=Lysyl-tRNA synthetase;       
  224::488     3e-28  31%  501 aa  SYK_CAMJJ RecName: Full=Lysyl-tRNA synthetase;       
  224::488     3e-28  31%  501 aa  SYK_CAMJE RecName: Full=Lysyl-tRNA synthetase;       
  219::514     3e-28  31%  520 aa  SYK_VARPS RecName: Full=Lysyl-tRNA synthetase;       
  224::488     3e-28  31%  501 aa  SYK_CAMJD RecName: Full=Lysyl-tRNA synthetase;       
   37::320     4e-28  36%  324 aa  SYK3_BUCAT RecName: Full=Putative lysyl-tRNA synthetase;       
   37::320     4e-28  36%  324 aa  SYK3_BUCA5 RecName: Full=Putative lysyl-tRNA synthetase;       
   26::282     6e-28  36%  293 aa  SYK3_AQUAE RecName: Full=Putative lysyl-tRNA synthetase;       
  211::503     1e-27  40%  525 aa  SYK_DEIRA RecName: Full=Lysyl-tRNA synthetase;       
  183::496     2e-27  32%  501 aa  SYK_DECAR RecName: Full=Lysyl-tRNA synthetase;       
  219::482     2e-27  29%  488 aa  SYK_CARHZ RecName: Full=Lysyl-tRNA synthetase;       
  197::489     2e-27  32%  497 aa  SYK_RUTMC RecName: Full=Lysyl-tRNA synthetase;       
  172::502     2e-27  35%  509 aa  SYK_ACIBY RecName: Full=Lysyl-tRNA synthetase;       
  172::502     2e-27  35%  509 aa  SYK_ACIBT RecName: Full=Lysyl-tRNA synthetase;       
  172::502     2e-27  35%  509 aa  SYK_ACIBS RecName: Full=Lysyl-tRNA synthetase;       
  172::502     2e-27  35%  509 aa  SYK_ACIB3 RecName: Full=Lysyl-tRNA synthetase;       
  191::487     3e-27  32%  489 aa  SYK_MYCPN RecName: Full=Lysyl-tRNA synthetase;       
  169::496     4e-27  30%  501 aa  SYK_PELLD RecName: Full=Lysyl-tRNA synthetase;       
  197::489     5e-27  31%  496 aa  SYK_VESOH RecName: Full=Lysyl-tRNA synthetase;       
  225::490     5e-27  29%  495 aa  SYK_STAS1 RecName: Full=Lysyl-tRNA synthetase;       
  200::493     6e-27  36%  499 aa  SYK_THISH RecName: Full=Lysyl-tRNA synthetase;       
  229::492     6e-27  30%  499 aa  SYK_THEP3 RecName: Full=Lysyl-tRNA synthetase;       
  161::500     6e-27  32%  507 aa  SYK_HAHCH RecName: Full=Lysyl-tRNA synthetase;       
  239::504     8e-27  33%  510 aa  SYK_PSYWF RecName: Full=Lysyl-tRNA synthetase;       
  224::489     8e-27  30%  494 aa  SYK_BACST RecName: Full=Lysyl-tRNA synthetase;       
  172::502     1e-26  35%  509 aa  SYK_ACIAD RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-26  29%  499 aa  SYK_THEPX RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-26  30%  498 aa  SYK_PEDPA RecName: Full=Lysyl-tRNA synthetase;       
  226::492     1e-26  31%  496 aa  SYK_LEGPL RecName: Full=Lysyl-tRNA synthetase;       
  226::492     1e-26  31%  496 aa  SYK_LEGPH RecName: Full=Lysyl-tRNA synthetase;       
  226::492     1e-26  31%  496 aa  SYK_LEGPC RecName: Full=Lysyl-tRNA synthetase;       
  221::484     1e-26  31%  492 aa  SYK_HERA2 RecName: Full=Lysyl-tRNA synthetase;       
  223::486     1e-26  30%  501 aa  SYK_HELPY RecName: Full=Lysyl-tRNA synthetase;       
  223::486     1e-26  32%  501 aa  SYK_HELPJ RecName: Full=Lysyl-tRNA synthetase;       
  223::486     1e-26  32%  501 aa  SYK_HELPG RecName: Full=Lysyl-tRNA synthetase;       
  223::486     1e-26  30%  501 aa  SYK_HELP2 RecName: Full=Lysyl-tRNA synthetase;       
  226::492     2e-26  31%  496 aa  SYK_LEGPA RecName: Full=Lysyl-tRNA synthetase;       
  223::486     2e-26  30%  501 aa  SYK_HELPS RecName: Full=Lysyl-tRNA synthetase;       
  223::486     2e-26  30%  501 aa  SYK_HELPH RecName: Full=Lysyl-tRNA synthetase;       
  223::486     2e-26  32%  501 aa  SYK_HELAH RecName: Full=Lysyl-tRNA synthetase;       
  198::491     2e-26  30%  498 aa  SYK_SINMW RecName: Full=Lysyl-tRNA synthetase;       
  234::498     2e-26  34%  503 aa  SYK_NEIMF RecName: Full=Lysyl-tRNA synthetase;       
  198::491     3e-26  30%  498 aa  SYK_RHIME RecName: Full=Lysyl-tRNA synthetase;       
  241::506     3e-26  33%  514 aa  SYK_PSYA2 RecName: Full=Lysyl-tRNA synthetase;       
  234::498     3e-26  34%  503 aa  SYK_NEIMB RecName: Full=Lysyl-tRNA synthetase;       
  189::502     3e-26  29%  508 aa  SYK_METPP RecName: Full=Lysyl-tRNA synthetase;       
  170::499     3e-26  31%  505 aa  SYK_ENTS8 RecName: Full=Lysyl-tRNA synthetase;       
  202::495     3e-26  33%  502 aa  SYK_CHRSD RecName: Full=Lysyl-tRNA synthetase;       
  232::495     3e-26  31%  500 aa  SYK_AZOSB RecName: Full=Lysyl-tRNA synthetase;       
  225::495     4e-26  36%  496 aa  SYK_MYCGA RecName: Full=Lysyl-tRNA synthetase;       
  225::490     5e-26  30%  495 aa  SYK_STAAW RecName: Full=Lysyl-tRNA synthetase;       
  225::490     5e-26  30%  495 aa  SYK_STAAS RecName: Full=Lysyl-tRNA synthetase;       
  225::490     5e-26  30%  495 aa  SYK_STAAR RecName: Full=Lysyl-tRNA synthetase;       
  242::510     5e-26  30%  516 aa  SYK_RALEJ RecName: Full=Lysyl-tRNA synthetase;       
  230::493     5e-26  31%  505 aa  SYK_LACSS RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAAN RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAAM RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAAC RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAAB RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAA8 RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAA3 RecName: Full=Lysyl-tRNA synthetase;       
  225::490     7e-26  30%  495 aa  SYK_STAA1 RecName: Full=Lysyl-tRNA synthetase;       
  191::493     7e-26  30%  502 aa  SYK_BACSK RecName: Full=Lysyl-tRNA synthetase;       
  214::505     7e-26  31%  511 aa  SYK2_METMA RecName: Full=Lysyl-tRNA synthetase 2;       
  159::493     9e-26  32%  498 aa  SYK_TERTT RecName: Full=Lysyl-tRNA synthetase;       
  206::507     9e-26  33%  514 aa  SYK_POLSQ RecName: Full=Lysyl-tRNA synthetase;       
  234::498     9e-26  34%  503 aa  SYK_NEIMA RecName: Full=Lysyl-tRNA synthetase;       
  234::498     9e-26  34%  503 aa  SYK_NEIG2 RecName: Full=Lysyl-tRNA synthetase;       
  234::498     9e-26  34%  503 aa  SYK_NEIG1 RecName: Full=Lysyl-tRNA synthetase;       
  170::499     1e-25  30%  505 aa  SYK_SERP5 RecName: Full=Lysyl-tRNA synthetase;       
  165::496     1e-25  34%  501 aa  SYK_PASMU RecName: Full=Lysyl-tRNA synthetase;       
  229::493     2e-25  29%  499 aa  SYK_THETN RecName: Full=Lysyl-tRNA synthetase;       
  235::507     2e-25  32%  514 aa  SYK_POLNS RecName: Full=Lysyl-tRNA synthetase;       
  224::499     2e-25  32%  505 aa  SYK_METHJ RecName: Full=Lysyl-tRNA synthetase;       
  229::492     2e-25  29%  498 aa  SYK_LISW6 RecName: Full=Lysyl-tRNA synthetase;       
  243::511     2e-25  31%  517 aa  SYK_CUPTR RecName: Full=Lysyl-tRNA synthetase;       
  223::487     2e-25  35%  499 aa  SYK_CAMHC RecName: Full=Lysyl-tRNA synthetase;       
  232::507     2e-25  33%  513 aa  SYK_ANASK RecName: Full=Lysyl-tRNA synthetase;       
  232::507     2e-25  33%  513 aa  SYK_ANAD2 RecName: Full=Lysyl-tRNA synthetase;       
    7::119     2e-25  44%  325 aa  SYK3_SALG2 RecName: Full=Putative lysyl-tRNA synthetase;       
    7::119     2e-25  44%  325 aa  SYK3_CITK8 RecName: Full=Putative lysyl-tRNA synthetase;       
  166::495     2e-25  30%  501 aa  SYK_THIDA RecName: Full=Lysyl-tRNA synthetase;       
  225::490     2e-25  30%  495 aa  SYK_STAAU RecName: Full=Lysyl-tRNA synthetase;       
  204::497     2e-25  30%  502 aa  SYK_AZOSE RecName: Full=Lysyl-tRNA synthetase;       
  192::488     3e-25  29%  490 aa  SYK_MYCGE RecName: Full=Lysyl-tRNA synthetase;       
  208::506     4e-25  32%  513 aa  SYK_TOLAT RecName: Full=Lysyl-tRNA synthetase;       
  220::483     5e-25  29%  489 aa  SYK_ROSCS RecName: Full=Lysyl-tRNA synthetase;       
  224::487     5e-25  33%  508 aa  SYK_METMJ RecName: Full=Lysyl-tRNA synthetase;       
  166::497     5e-25  35%  502 aa  SYK_HAEIG RecName: Full=Lysyl-tRNA synthetase;       
  166::497     5e-25  35%  502 aa  SYK_HAEI8 RecName: Full=Lysyl-tRNA synthetase;       
  164::493     5e-25  32%  498 aa  SYK_HAEDU RecName: Full=Lysyl-tRNA synthetase;       
   68::318     5e-25  32%  322 aa  SYK3_BUCBP RecName: Full=Putative lysyl-tRNA synthetase;       
  196::495     6e-25  30%  501 aa  SYK_VIBF1 RecName: Full=Lysyl-tRNA synthetase;       
  227::491     6e-25  31%  504 aa  SYK_SYNP6 RecName: Full=Lysyl-tRNA synthetase;       
  227::491     6e-25  31%  504 aa  SYK_SYNE7 RecName: Full=Lysyl-tRNA synthetase;       
  225::490     6e-25  29%  495 aa  SYK_STAES RecName: Full=Lysyl-tRNA synthetase;       
  225::490     6e-25  29%  495 aa  SYK_STAEQ RecName: Full=Lysyl-tRNA synthetase;       
  173::502     6e-25  32%  509 aa  SYK_PSYIN RecName: Full=Lysyl-tRNA synthetase;       
  241::506     6e-25  32%  514 aa  SYK_PSYCK RecName: Full=Lysyl-tRNA synthetase;       
  179::506     6e-25  29%  511 aa  SYK_PELPB RecName: Full=Lysyl-tRNA synthetase;       
  170::499     6e-25  29%  505 aa  SYK_PECCP RecName: Full=Lysyl-tRNA synthetase;       
  174::503     6e-25  33%  509 aa  SYK_METFK RecName: Full=Lysyl-tRNA synthetase;       
  242::505     6e-25  29%  511 aa  SYK2_METAC RecName: Full=Lysyl-tRNA synthetase 2;       
  170::499     8e-25  34%  505 aa  SYK_YERPY RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPS RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPP RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPN RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPG RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPE RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPB RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERPA RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERP3 RecName: Full=Lysyl-tRNA synthetase;       
  170::499     8e-25  34%  505 aa  SYK_YERE8 RecName: Full=Lysyl-tRNA synthetase;       
  236::504     8e-25  30%  510 aa  SYK_RALSO RecName: Full=Lysyl-tRNA synthetase;       
  240::509     8e-25  30%  515 aa  SYK_RALME RecName: Full=Lysyl-tRNA synthetase;       
  234::498     8e-25  33%  503 aa  SYK_LARHH RecName: Full=Lysyl-tRNA synthetase;       
  228::491     8e-25  29%  518 aa  SYK_HELHP RecName: Full=Lysyl-tRNA synthetase;       
  238::506     8e-25  30%  512 aa  SYK_BURP8 RecName: Full=Lysyl-tRNA synthetase;       
  231::494     8e-25  29%  499 aa  SYK_BACSU RecName: Full=Lysyl-tRNA synthetase;       
   38::119     8e-25  50%  323 aa  SYK3_HAEIN RecName: Full=Putative lysyl-tRNA synthetase;       
   38::119     8e-25  50%  323 aa  SYK3_HAEIG RecName: Full=Putative lysyl-tRNA synthetase;       
   38::119     8e-25  50%  323 aa  SYK3_HAEIE RecName: Full=Putative lysyl-tRNA synthetase;       
  170::490     1e-24  28%  497 aa  SYK_RHILW RecName: Full=Lysyl-tRNA synthetase;       
  196::495     1e-24  29%  501 aa  SYK_VIBFM RecName: Full=Lysyl-tRNA synthetase;       
  226::491     1e-24  29%  496 aa  SYK_STAHJ RecName: Full=Lysyl-tRNA synthetase;       
  207::498     1e-24  32%  578 aa  SYK_PORGI RecName: Full=Lysyl-tRNA synthetase;       
  207::498     1e-24  30%  569 aa  SYK_GRAFK RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SHIDS RecName: Full=Lysyl-tRNA synthetase;       
  171::491     2e-24  32%  498 aa  SYK_RHIEC RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_CITK8 RecName: Full=Lysyl-tRNA synthetase;       
  203::500     2e-24  34%  506 aa  SYK_BORPD RecName: Full=Lysyl-tRNA synthetase;       
  171::505     2e-24  31%  511 aa  SYK_AERHH RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SHIF8 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SHIBS RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SHIB3 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALSV RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALPK RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALPB RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALPA RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALNS RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALHS RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALG2 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALEP RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALDC RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALCH RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK_SALA4 RecName: Full=Lysyl-tRNA synthetase;       
  220::483     2e-24  29%  489 aa  SYK_ROSS1 RecName: Full=Lysyl-tRNA synthetase;       
  240::508     2e-24  30%  514 aa  SYK_RALEH RecName: Full=Lysyl-tRNA synthetase;       
  179::493     2e-24  28%  561 aa  SYK_ANASP RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK1_SHIFL RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK1_SALTY RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK1_ECOLI RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK1_ECOL6 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-24  30%  505 aa  SYK1_ECO57 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     3e-24  30%  505 aa  SYK_XANOM RecName: Full=Lysyl-tRNA synthetase;       
  206::499     3e-24  30%  505 aa  SYK_SALPC RecName: Full=Lysyl-tRNA synthetase;       
  240::508     3e-24  30%  514 aa  SYK_RALPJ RecName: Full=Lysyl-tRNA synthetase;       
  229::492     3e-24  29%  499 aa  SYK_BACCR RecName: Full=Lysyl-tRNA synthetase;       
  229::492     3e-24  29%  499 aa  SYK_BACC4 RecName: Full=Lysyl-tRNA synthetase;       
  179::493     3e-24  28%  561 aa  SYK_ANAVT RecName: Full=Lysyl-tRNA synthetase;       
  206::499     3e-24  30%  505 aa  SYK1_SALTI RecName: Full=Lysyl-tRNA synthetase;       
  181::495     4e-24  28%  506 aa  SYK_THEEB RecName: Full=Lysyl-tRNA synthetase;       
  206::499     4e-24  30%  505 aa  SYK_SALAR RecName: Full=Lysyl-tRNA synthetase;       
  166::497     4e-24  36%  503 aa  SYK_MANSM RecName: Full=Lysyl-tRNA synthetase;       
  179::506     4e-24  29%  511 aa  SYK_CHLCH RecName: Full=Lysyl-tRNA synthetase;       
  234::502     4e-24  30%  508 aa  SYK_BURCJ RecName: Full=Lysyl-tRNA synthetase;       
  234::502     4e-24  30%  508 aa  SYK_BURCH RecName: Full=Lysyl-tRNA synthetase;       
  234::502     4e-24  30%  508 aa  SYK_BURCC RecName: Full=Lysyl-tRNA synthetase;       
  234::502     4e-24  30%  508 aa  SYK_BURCA RecName: Full=Lysyl-tRNA synthetase;       
  232::500     4e-24  34%  506 aa  SYK_BORPA RecName: Full=Lysyl-tRNA synthetase;       
  166::497     4e-24  34%  503 aa  SYK_ACTSZ RecName: Full=Lysyl-tRNA synthetase;       
  166::495     4e-24  32%  500 aa  SYK_ACTPJ RecName: Full=Lysyl-tRNA synthetase;       
  166::495     4e-24  32%  500 aa  SYK_ACTP2 RecName: Full=Lysyl-tRNA synthetase;       
  205::498     5e-24  31%  504 aa  SYK_PROMH RecName: Full=Lysyl-tRNA synthetase;       
  220::489     5e-24  30%  491 aa  SYK_CHLAA RecName: Full=Lysyl-tRNA synthetase;       
  199::492     5e-24  33%  499 aa  SYK_AGRT5 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     7e-24  30%  505 aa  SYK_XANC5 RecName: Full=Lysyl-tRNA synthetase;       
  198::491     7e-24  35%  498 aa  SYK_RHIL3 RecName: Full=Lysyl-tRNA synthetase;       
  171::491     7e-24  31%  498 aa  SYK_RHIE6 RecName: Full=Lysyl-tRNA synthetase;       
  234::502     7e-24  29%  508 aa  SYK_BURCM RecName: Full=Lysyl-tRNA synthetase;       
  234::502     7e-24  29%  508 aa  SYK_BURA4 RecName: Full=Lysyl-tRNA synthetase;       
  232::500     7e-24  34%  506 aa  SYK_BORPE RecName: Full=Lysyl-tRNA synthetase;       
  232::500     7e-24  34%  506 aa  SYK_BORBR RecName: Full=Lysyl-tRNA synthetase;       
  169::498     9e-24  31%  504 aa  SYK_PHOLL RecName: Full=Lysyl-tRNA synthetase;       
  179::493     9e-24  29%  561 aa  SYK_NOSP7 RecName: Full=Lysyl-tRNA synthetase;       
  227::490     9e-24  32%  495 aa  SYK_LEPIN RecName: Full=Lysyl-tRNA synthetase;       
  227::490     9e-24  32%  495 aa  SYK_LEPIC RecName: Full=Lysyl-tRNA synthetase;       
  228::491     9e-24  30%  499 aa  SYK_LACPL RecName: Full=Lysyl-tRNA synthetase;       
  196::495     9e-24  30%  501 aa  SYK_ALISL RecName: Full=Lysyl-tRNA synthetase;       
  202::495     9e-24  32%  500 aa  SYK_ACTP7 RecName: Full=Lysyl-tRNA synthetase;       
  219::482     1e-23  30%  489 aa  SYK_MOOTA RecName: Full=Lysyl-tRNA synthetase;       
  206::499     1e-23  30%  506 aa  SYK_ERWT9 RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-23  27%  502 aa  SYK_CLOTE RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-23  27%  504 aa  SYK_CLOBH RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-23  27%  504 aa  SYK_CLOB1 RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-23  29%  508 aa  SYK_BURVG RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-23  29%  508 aa  SYK_BURM1 RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACWK RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACHK RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACCZ RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACC7 RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACC2 RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACC1 RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACAN RecName: Full=Lysyl-tRNA synthetase;       
  229::492     1e-23  29%  499 aa  SYK_BACAH RecName: Full=Lysyl-tRNA synthetase;       
  171::505     1e-23  31%  512 aa  SYK_AERS4 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     1e-23  29%  505 aa  SYK2_ECOLI RecName: Full=Lysyl-tRNA synthetase, heat inducible;    
  206::499     1e-23  29%  505 aa  SYK2_ECOL6 RecName: Full=Lysyl-tRNA synthetase, heat inducible;    
  206::499     1e-23  29%  505 aa  SYK2_ECO57 RecName: Full=Lysyl-tRNA synthetase, heat inducible;    
  224::494     1e-23  29%  500 aa  SYK_SHELP RecName: Full=Lysyl-tRNA synthetase;       
  228::491     1e-23  28%  497 aa  SYK_LACF3 RecName: Full=Lysyl-tRNA synthetase;       
  239::507     1e-23  30%  513 aa  SYK_BURXL RecName: Full=Lysyl-tRNA synthetase;       
  244::512     1e-23  30%  518 aa  SYK_BURPP RecName: Full=Lysyl-tRNA synthetase;       
  206::499     2e-23  30%  505 aa  SYK_XANOP RecName: Full=Lysyl-tRNA synthetase;       
  207::498     2e-23  32%  578 aa  SYK_PORG3 RecName: Full=Lysyl-tRNA synthetase;       
  179::499     2e-23  27%  505 aa  SYK_ERWCT RecName: Full=Lysyl-tRNA synthetase;       
  206::499     3e-23  30%  505 aa  SYK_XANAC RecName: Full=Lysyl-tRNA synthetase;       
  196::488     3e-23  29%  493 aa  SYK_OCEIH RecName: Full=Lysyl-tRNA synthetase;       
  185::505     3e-23  28%  511 aa  SYK_HERAR RecName: Full=Lysyl-tRNA synthetase;       
  195::494     3e-23  31%  502 aa  SYK_PHOPR RecName: Full=Lysyl-tRNA synthetase;       
  227::490     3e-23  29%  495 aa  SYK_LEPBL RecName: Full=Lysyl-tRNA synthetase;       
  227::490     3e-23  29%  495 aa  SYK_LEPBJ RecName: Full=Lysyl-tRNA synthetase;       
  230::493     3e-23  30%  498 aa  SYK_DICNV RecName: Full=Lysyl-tRNA synthetase;       
  229::492     3e-23  28%  499 aa  SYK_BACC0 RecName: Full=Lysyl-tRNA synthetase;       
  206::499     4e-23  30%  505 aa  SYK_XANCP RecName: Full=Lysyl-tRNA synthetase;       
  206::499     4e-23  30%  505 aa  SYK_XANC8 RecName: Full=Lysyl-tRNA synthetase;       
  235::499     4e-23  30%  510 aa  SYK_SYNY3 RecName: Full=Lysyl-tRNA synthetase;       
  171::500     4e-23  33%  506 aa  SYK_SODGM RecName: Full=Lysyl-tRNA synthetase;       
  224::494     4e-23  29%  500 aa  SYK_SHEDO RecName: Full=Lysyl-tRNA synthetase;       
  238::504     4e-23  30%  510 aa  SYK_CLONN RecName: Full=Lysyl-tRNA synthetase;       
  229::492     4e-23  28%  499 aa  SYK_BACCN RecName: Full=Lysyl-tRNA synthetase;       
  228::493     6e-23  30%  502 aa  SYK_PROMA RecName: Full=Lysyl-tRNA synthetase;       
  206::499     7e-23  30%  505 aa  SYK_XANCB RecName: Full=Lysyl-tRNA synthetase;       
  168::494     7e-23  30%  500 aa  SYK_SHEAM RecName: Full=Lysyl-tRNA synthetase;       
  205::496     7e-23  31%  576 aa  SYK_PARD8 RecName: Full=Lysyl-tRNA synthetase;       
  185::505     7e-23  29%  511 aa  SYK_JANMA RecName: Full=Lysyl-tRNA synthetase;       
  162::490     1e-22  30%  507 aa  SYK_WOLSU RecName: Full=Lysyl-tRNA synthetase;       
  227::492     1e-22  27%  512 aa  SYK_PROM9 RecName: Full=Lysyl-tRNA synthetase;       
  189::516     1e-22  31%  524 aa  SYK_CHLMU RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURPS RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURP6 RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURP1 RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURP0 RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURMS RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURMA RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURM9 RecName: Full=Lysyl-tRNA synthetase;       
  234::502     1e-22  31%  508 aa  SYK_BURM7 RecName: Full=Lysyl-tRNA synthetase;       
  229::499     1e-22  33%  505 aa  SYK_VIBPA RecName: Full=Lysyl-tRNA synthetase;       
  194::487     1e-22  31%  502 aa  SYK_SYNSC RecName: Full=Lysyl-tRNA synthetase;       
  224::494     1e-22  29%  500 aa  SYK_SHEPW RecName: Full=Lysyl-tRNA synthetase;       
  203::496     1e-22  30%  502 aa  SYK_NITEU RecName: Full=Lysyl-tRNA synthetase;       
  221::484     1e-22  32%  491 aa  SYK_MYCHJ RecName: Full=Lysyl-tRNA synthetase;       
  221::484     1e-22  32%  491 aa  SYK_MYCH7 RecName: Full=Lysyl-tRNA synthetase;       
  222::482     2e-22  29%  502 aa  SYK_THEMA RecName: Full=Lysyl-tRNA synthetase;       
  224::494     2e-22  29%  500 aa  SYK_SHEB9 RecName: Full=Lysyl-tRNA synthetase;       
  224::494     2e-22  29%  500 aa  SYK_SHEB8 RecName: Full=Lysyl-tRNA synthetase;       
  224::494     2e-22  29%  500 aa  SYK_SHEB5 RecName: Full=Lysyl-tRNA synthetase;       
  229::492     2e-22  28%  498 aa  SYK_LISMF RecName: Full=Lysyl-tRNA synthetase;       
  205::502     2e-22  30%  508 aa  SYK_BURTA RecName: Full=Lysyl-tRNA synthetase;       
  232::496     2e-22  29%  503 aa  SYK_BUCAP RecName: Full=Lysyl-tRNA synthetase;       
  222::482     2e-22  29%  502 aa  SYK_THESQ RecName: Full=Lysyl-tRNA synthetase;       
  222::482     2e-22  29%  502 aa  SYK_THEP1 RecName: Full=Lysyl-tRNA synthetase;       
  194::487     2e-22  33%  502 aa  SYK_SYNPX RecName: Full=Lysyl-tRNA synthetase;       
  224::494     2e-22  31%  500 aa  SYK_SHEFN RecName: Full=Lysyl-tRNA synthetase;       
  229::492     2e-22  28%  498 aa  SYK_LISMO RecName: Full=Lysyl-tRNA synthetase;       
  229::495     2e-22  27%  504 aa  SYK_CLOBL RecName: Full=Lysyl-tRNA synthetase;       
  229::495     2e-22  27%  504 aa  SYK_CLOBK RecName: Full=Lysyl-tRNA synthetase;       
  180::494     3e-22  34%  500 aa  SYK_PSEU2 RecName: Full=Lysyl-tRNA synthetase;       
  227::492     3e-22  27%  512 aa  SYK_PROM0 RecName: Full=Lysyl-tRNA synthetase;       
  229::492     3e-22  28%  498 aa  SYK_LISIN RecName: Full=Lysyl-tRNA synthetase;       
  228::491     3e-22  29%  494 aa  SYK_LACLS RecName: Full=Lysyl-tRNA synthetase;       
  228::491     3e-22  29%  494 aa  SYK_LACLM RecName: Full=Lysyl-tRNA synthetase;       
  228::491     3e-22  29%  494 aa  SYK_LACLA RecName: Full=Lysyl-tRNA synthetase;       
  229::495     3e-22  26%  504 aa  SYK_CLOBM RecName: Full=Lysyl-tRNA synthetase;       
  189::516     3e-22  31%  526 aa  SYK_CHLTR RecName: Full=Lysyl-tRNA synthetase;       
  189::516     3e-22  31%  526 aa  SYK_CHLTB RecName: Full=Lysyl-tRNA synthetase;       
  189::516     3e-22  31%  526 aa  SYK_CHLTA RecName: Full=Lysyl-tRNA synthetase;       
  189::516     3e-22  31%  526 aa  SYK_CHLT2 RecName: Full=Lysyl-tRNA synthetase;       
  205::497     3e-22  31%  576 aa  SYK_BACTN RecName: Full=Lysyl-tRNA synthetase;       
  190::479     4e-22  31%  509 aa  SYK_FERNB RecName: Full=Lysyl-tRNA synthetase;       
  164::493     5e-22  28%  496 aa  SYK_STRSV RecName: Full=Lysyl-tRNA synthetase;       
  224::494     5e-22  29%  501 aa  SYK_SHEPA RecName: Full=Lysyl-tRNA synthetase;       
  224::494     5e-22  29%  501 aa  SYK_SHEHH RecName: Full=Lysyl-tRNA synthetase;       
  227::492     5e-22  27%  512 aa  SYK_PROM2 RecName: Full=Lysyl-tRNA synthetase;       
  159::486     5e-22  29%  497 aa  SYK_PHYAS RecName: Full=Lysyl-tRNA synthetase;       
  198::490     5e-22  31%  493 aa  SYK_LEUCK RecName: Full=Lysyl-tRNA synthetase;       
  206::499     5e-22  27%  506 aa  SYK_BUCAI RecName: Full=Lysyl-tRNA synthetase;       
  225::495     6e-22  29%  501 aa  SYK_SHEWM RecName: Full=Lysyl-tRNA synthetase;       
  161::489     6e-22  32%  497 aa  SYK_GLOVI RecName: Full=Lysyl-tRNA synthetase;       
  192::484     8e-22  28%  493 aa  SYK_SYNWW RecName: Full=Lysyl-tRNA synthetase;       
  229::494     8e-22  28%  503 aa  SYK_PROM4 RecName: Full=Lysyl-tRNA synthetase;       
  164::493     8e-22  28%  498 aa  SYK_COXBU RecName: Full=Lysyl-tRNA synthetase;       
  164::493     8e-22  28%  498 aa  SYK_COXBR RecName: Full=Lysyl-tRNA synthetase;       
  164::493     8e-22  28%  498 aa  SYK_COXBN RecName: Full=Lysyl-tRNA synthetase;       
  164::493     8e-22  28%  498 aa  SYK_COXB2 RecName: Full=Lysyl-tRNA synthetase;       
  164::493     8e-22  28%  498 aa  SYK_COXB1 RecName: Full=Lysyl-tRNA synthetase;       
  219::483     1e-21  29%  489 aa  SYK_SYNS3 RecName: Full=Lysyl-tRNA synthetase;       
  230::493     1e-21  28%  496 aa  SYK_STRA1 RecName: Full=Lysyl-tRNA synthetase;       
  223::487     1e-21  33%  502 aa  SYK_SYNS9 RecName: Full=Lysyl-tRNA synthetase;       
  230::493     1e-21  28%  496 aa  SYK_STRA5 RecName: Full=Lysyl-tRNA synthetase;       
  230::493     1e-21  28%  496 aa  SYK_STRA3 RecName: Full=Lysyl-tRNA synthetase;       
  244::506     1e-21  28%  511 aa  SYK_CHLTE RecName: Full=Lysyl-tRNA synthetase;       
  164::493     2e-21  27%  496 aa  SYK_STRGC RecName: Full=Lysyl-tRNA synthetase;       
  243::516     2e-21  32%  527 aa  SYK_CHLPN RecName: Full=Lysyl-tRNA synthetase;       
  234::510     2e-21  30%  575 aa  SYK_BACFR RecName: Full=Lysyl-tRNA synthetase;       
  234::510     2e-21  30%  575 aa  SYK_BACFN RecName: Full=Lysyl-tRNA synthetase;       
  193::482     3e-21  29%  502 aa  SYK_THEM4 RecName: Full=Lysyl-tRNA synthetase;       
  227::492     3e-21  26%  512 aa  SYK_PROMP RecName: Full=Lysyl-tRNA synthetase;       
  181::495     4e-21  35%  501 aa  SYK_PSEAE RecName: Full=Lysyl-tRNA synthetase;       
  165::494     4e-21  27%  500 aa  SYK_MYCCT RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-21  28%  500 aa  SYK_LYSSC RecName: Full=Lysyl-tRNA synthetase;       
  223::487     4e-21  29%  493 aa  SYK_FUSNN RecName: Full=Lysyl-tRNA synthetase;       
  232::279     4e-21  41%  513 aa  SYK_ANADE RecName: Full=Lysyl-tRNA synthetase;       
  165::494     5e-21  31%  500 aa  SYK_MYCMS RecName: Full=Lysyl-tRNA synthetase;       
  196::487     5e-21  31%  496 aa  SYK_AYWBP RecName: Full=Lysyl-tRNA synthetase;       
  224::490     7e-21  27%  500 aa  SYK_SULAC RecName: Full=Lysyl-tRNA synthetase;       
  234::496     9e-21  29%  576 aa  SYK_BACV8 RecName: Full=Lysyl-tRNA synthetase;       
  164::493     1e-20  27%  496 aa  SYK_STRSY RecName: Full=Lysyl-tRNA synthetase;       
  164::493     1e-20  27%  496 aa  SYK_STRS2 RecName: Full=Lysyl-tRNA synthetase;       
  219::483     2e-20  30%  489 aa  SYK_SYNPW RecName: Full=Lysyl-tRNA synthetase;       
  230::493     2e-20  27%  496 aa  SYK_STRMU RecName: Full=Lysyl-tRNA synthetase;       
  207::500     2e-20  34%  506 aa  SYK_BAUCH RecName: Full=Lysyl-tRNA synthetase;       
  244::506     2e-20  27%  511 aa  SYK_CHLP8 RecName: Full=Lysyl-tRNA synthetase;       
  189::516     2e-20  29%  526 aa  SYK_CHLFF RecName: Full=Lysyl-tRNA synthetase;       
  223::486     3e-20  26%  493 aa  SYK_UREPA RecName: Full=Lysyl-tRNA synthetase;       
  223::486     3e-20  26%  493 aa  SYK_UREP2 RecName: Full=Lysyl-tRNA synthetase;       
  223::486     3e-20  26%  493 aa  SYK_UREU1 RecName: Full=Lysyl-tRNA synthetase;       
  170::499     3e-20  28%  505 aa  SYK_ENT38 RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-20  26%  496 aa  SYK_STRTD RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-20  27%  497 aa  SYK_STRPZ RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-20  27%  497 aa  SYK_STRPG RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-20  27%  497 aa  SYK_STRP8 RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-20  27%  497 aa  SYK_STRP6 RecName: Full=Lysyl-tRNA synthetase;       
  230::493     4e-20  27%  497 aa  SYK_STRP3 RecName: Full=Lysyl-tRNA synthetase;       
  241::506     4e-20  31%  515 aa  SYK_CLOAB RecName: Full=Lysyl-tRNA synthetase;       
  222::482     8e-20  27%  502 aa  SYK_THEAB RecName: Full=Lysyl-tRNA synthetase;       
  190::493     8e-20  32%  496 aa  SYK_STRR6 RecName: Full=Lysyl-tRNA synthetase;       
  190::493     8e-20  32%  496 aa  SYK_STRPS RecName: Full=Lysyl-tRNA synthetase;       
  190::493     8e-20  32%  496 aa  SYK_STRPN RecName: Full=Lysyl-tRNA synthetase;       
  190::493     8e-20  30%  496 aa  SYK_STRPI RecName: Full=Lysyl-tRNA synthetase;       
  190::493     8e-20  32%  496 aa  SYK_STRP4 RecName: Full=Lysyl-tRNA synthetase;       
  190::493     8e-20  32%  496 aa  SYK_STRP2 RecName: Full=Lysyl-tRNA synthetase;       
    5::119     1e-19  40%  323 aa  SYK3_VIBSL RecName: Full=Putative lysyl-tRNA synthetase;       
  220::483     1e-19  27%  494 aa  SYK_SULSO RecName: Full=Lysyl-tRNA synthetase;       
  230::493     1e-19  27%  497 aa  SYK_STRP1 RecName: Full=Lysyl-tRNA synthetase;       
  221::482     1e-19  27%  490 aa  SYK_MYCA5 RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-19  25%  502 aa  SYK_CLOK5 RecName: Full=Lysyl-tRNA synthetase;       
  229::491     2e-19  28%  500 aa  SYK_AZOPC RecName: Full=Lysyl-tRNA synthetase;       
  244::583     3e-19  25%  588 aa  SYK_SOLLC RecName: Full=Lysyl-tRNA synthetase;       
  222::481     3e-19  29%  488 aa  SYK_MYCFE RecName: Full=Lysyl-tRNA synthetase;       
  321::585     3e-19  28%  597 aa  SYK_AQUAE RecName: Full=Lysyl-tRNA synthetase;       
  189::479     5e-19  33%  492 aa  SYK_THETH RecName: Full=Lysyl-tRNA synthetase;       
  189::479     5e-19  33%  492 aa  SYK_THET8 RecName: Full=Lysyl-tRNA synthetase;       
  189::479     5e-19  33%  492 aa  SYK_THET2 RecName: Full=Lysyl-tRNA synthetase;       
  298::574     8e-19  29%  591 aa  SYKC_YEAST RecName: Full=Lysyl-tRNA synthetase, cytoplasmic;       
  190::483     1e-18  29%  502 aa  SYK_SYNR3 RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-18  25%  501 aa  SYK_CLOPS RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-18  25%  501 aa  SYK_CLOPE RecName: Full=Lysyl-tRNA synthetase;       
  229::495     1e-18  25%  501 aa  SYK_CLOP1 RecName: Full=Lysyl-tRNA synthetase;       
  221::482     2e-18  27%  487 aa  SYK_MYCMO RecName: Full=Lysyl-tRNA synthetase;       
  222::494     2e-18  26%  500 aa  SYK_BUCBP RecName: Full=Lysyl-tRNA synthetase;       
  236::500     3e-18  26%  508 aa  SYK_PROMM RecName: Full=Lysyl-tRNA synthetase;       
  236::500     3e-18  31%  508 aa  SYK_PROM3 RecName: Full=Lysyl-tRNA synthetase;       
  227::492     4e-18  25%  512 aa  SYK_PROM5 RecName: Full=Lysyl-tRNA synthetase;       
  223::482     4e-18  27%  491 aa  SYK_MYCS5 RecName: Full=Lysyl-tRNA synthetase;       
  212::484     4e-18  30%  491 aa  SYK1_MYCPU RecName: Full=Lysyl-tRNA synthetase 1;       
  195::484     5e-18  29%  491 aa  SYK2_MYCPU RecName: Full=Lysyl-tRNA synthetase 2;       
  198::490     7e-18  29%  495 aa  SYK_LEUMM RecName: Full=Lysyl-tRNA synthetase;       
  166::283     2e-17  41%  502 aa  SYK_HAEIE RecName: Full=Lysyl-tRNA synthetase;       
  196::487     2e-17  29%  511 aa  SYK_ONYPE RecName: Full=Lysyl-tRNA synthetase;       
  274::551     2e-17  28%  572 aa  SYK_CAEEL RecName: Full=Lysyl-tRNA synthetase;       
  165::282     3e-17  41%  502 aa  SYK_HAES2 RecName: Full=Lysyl-tRNA synthetase;       
  232::495     3e-17  26%  498 aa  SYK_ENTFA RecName: Full=Lysyl-tRNA synthetase;       
  234::287     1e-16  38%  510 aa  SYK_VIBVY RecName: Full=Lysyl-tRNA synthetase;       
  234::287     1e-16  38%  510 aa  SYK_VIBVU RecName: Full=Lysyl-tRNA synthetase;       
  234::287     1e-16  38%  510 aa  SYK_VIBHB RecName: Full=Lysyl-tRNA synthetase;       
  234::287     1e-16  38%  510 aa  SYK_VIBCH RecName: Full=Lysyl-tRNA synthetase;       
  166::283     1e-16  41%  502 aa  SYK_HAEIN RecName: Full=Lysyl-tRNA synthetase;       
  225::282     1e-16  38%  501 aa  SYK_BACHD RecName: Full=Lysyl-tRNA synthetase;       
  193::482     2e-16  26%  498 aa  SYK_THELT RecName: Full=Lysyl-tRNA synthetase;       
  180::283     2e-16  39%  500 aa  SYK_PSEPW RecName: Full=Lysyl-tRNA synthetase;       
  180::283     2e-16  39%  500 aa  SYK_PSEPK RecName: Full=Lysyl-tRNA synthetase;       
  180::283     2e-16  39%  500 aa  SYK_PSEPG RecName: Full=Lysyl-tRNA synthetase;       
  180::283     2e-16  39%  500 aa  SYK_PSEP1 RecName: Full=Lysyl-tRNA synthetase;       
  180::283     2e-16  39%  500 aa  SYK_PSEE4 RecName: Full=Lysyl-tRNA synthetase;       
  257::596     3e-16  24%  602 aa  SYK_ORYSJ RecName: Full=Lysyl-tRNA synthetase;       
  170::288     5e-16  37%  505 aa  SYK_EDWI9 RecName: Full=Lysyl-tRNA synthetase;       
  331::605     5e-16  25%  626 aa  SYK_ARATH RecName: Full=Lysyl-tRNA synthetase;       
  299::575     5e-16  25%  591 aa  SYKC_SCHPO RecName: Full=Lysyl-tRNA synthetase, cytoplasmic;       
  173::282     7e-16  39%  499 aa  SYK_PSEPF RecName: Full=Lysyl-tRNA synthetase;       
  180::283     7e-16  40%  500 aa  SYK_PSEF5 RecName: Full=Lysyl-tRNA synthetase;       
  174::283     9e-16  39%  500 aa  SYK_PSESM RecName: Full=Lysyl-tRNA synthetase;       
  185::288     9e-16  40%  505 aa  SYK_PSEMY RecName: Full=Lysyl-tRNA synthetase;       
  224::277     1e-15  41%  500 aa  SYK_SHESW RecName: Full=Lysyl-tRNA synthetase;       
  224::277     1e-15  41%  500 aa  SYK_SHESR RecName: Full=Lysyl-tRNA synthetase;       
  224::277     1e-15  41%  500 aa  SYK_SHESM RecName: Full=Lysyl-tRNA synthetase;       
  224::277     1e-15  41%  500 aa  SYK_SHESA RecName: Full=Lysyl-tRNA synthetase;       
  224::277     1e-15  41%  500 aa  SYK_SHEPC RecName: Full=Lysyl-tRNA synthetase;       
  224::277     1e-15  41%  500 aa  SYK_SHEON RecName: Full=Lysyl-tRNA synthetase;       
  181::284     1e-15  38%  501 aa  SYK_PSEAB RecName: Full=Lysyl-tRNA synthetase;       
  181::284     1e-15  38%  501 aa  SYK_PSEA8 RecName: Full=Lysyl-tRNA synthetase;       
  181::284     1e-15  38%  501 aa  SYK_PSEA7 RecName: Full=Lysyl-tRNA synthetase;       
  218::482     1e-15  27%  488 aa  SYK_MYCHO RecName: Full=Lysyl-tRNA synthetase;       
  225::279     1e-15  39%  504 aa  SYK_ARCB4 RecName: Full=Lysyl-tRNA synthetase;       
  195::277     2e-15  40%  500 aa  SYK_SHESH RecName: Full=Lysyl-tRNA synthetase;       
  228::569     2e-15  24%  595 aa  SYK_MOUSE RecName: Full=Lysyl-tRNA synthetase;       
  266::571     3e-15  24%  597 aa  SYK_CRIGR RecName: Full=Lysyl-tRNA synthetase;       
  174::283     3e-15  39%  500 aa  SYK_PSE14 RecName: Full=Lysyl-tRNA synthetase;       
  211::266     3e-15  40%  485 aa  SYK_BLOFL RecName: Full=Lysyl-tRNA synthetase;       
  233::286     6e-15  40%  502 aa  SYK_CHRVO RecName: Full=Lysyl-tRNA synthetase;       
  236::291     7e-15  40%  506 aa  SYK_XYLFA RecName: Full=Lysyl-tRNA synthetase;       
  223::276     7e-15  35%  493 aa  SYK_WIGBR RecName: Full=Lysyl-tRNA synthetase;       
  180::461     7e-15  27%  500 aa  SYK_KINRD RecName: Full=Lysyl-tRNA synthetase;       
  174::282     7e-15  35%  524 aa  SYK_COLP3 RecName: Full=Lysyl-tRNA synthetase;       
  234::286     2e-14  38%  502 aa  SYK_BUCCC RecName: Full=Lysyl-tRNA synthetase;       
  236::291     6e-14  39%  506 aa  SYK_XYLFT RecName: Full=Lysyl-tRNA synthetase;       
  236::291     6e-14  39%  506 aa  SYK_XYLFM RecName: Full=Lysyl-tRNA synthetase;       
  236::291     6e-14  39%  506 aa  SYK_XYLF2 RecName: Full=Lysyl-tRNA synthetase;       
  266::571     6e-14  24%  597 aa  SYK_HUMAN RecName: Full=Lysyl-tRNA synthetase;       
  255::523     6e-14  24%  531 aa  SYKM_SCHPO RecName: Full=Lysyl-tRNA synthetase, mitochondrial;     
  213::297     4e-13  40%  525 aa  SYK_CHLCV RecName: Full=Lysyl-tRNA synthetase;       
  231::490     7e-13  27%  507 aa  SYK_MYCLE RecName: Full=Lysyl-tRNA synthetase;       
  237::292     7e-13  41%  509 aa  SYK_BLOPB RecName: Full=Lysyl-tRNA synthetase;       
  828::945     6e-12  39% 1172 aa  SYK2_MYCTU RecName: Full=Putative lysyl-tRNA synthetase 2;       
  828::945     6e-12  39% 1172 aa  SYK2_MYCBO RecName: Full=Putative lysyl-tRNA synthetase 2;       
  189::298     2e-11  36%  526 aa  SYK_CHLAB RecName: Full=Lysyl-tRNA synthetase;       
  217::273     1e-10  33%  489 aa  SYK_MYCPE RecName: Full=Lysyl-tRNA synthetase;       
  200::276     5e-10  35%  505 aa  SYK_MYCTA RecName: Full=Lysyl-tRNA synthetase;       
  200::276     5e-10  35%  505 aa  SYK_MYCBT RecName: Full=Lysyl-tRNA synthetase;       
  200::276     5e-10  35%  505 aa  SYK_MYCBP RecName: Full=Lysyl-tRNA synthetase;       
  200::276     5e-10  35%  505 aa  SYK1_MYCTU RecName: Full=Lysyl-tRNA synthetase 1;       
  200::276     5e-10  35%  505 aa  SYK1_MYCBO RecName: Full=Lysyl-tRNA synthetase 1;       
  278::565     9e-08  26%  576 aa  SYKM_YEAST RecName: Full=Lysyl-tRNA synthetase, mitochondrial;     
  200::277     6e-07  38%  501 aa  SYK_MYCGI RecName: Full=Lysyl-tRNA synthetase;       
  245::322     1e-06  35%  464 aa  GPA_LEIDO RecName: Full=Putative guanine nucleotide-binding protein
  440::544     4e-06  39%  579 aa  SYD_THEFY RecName: Full=Aspartyl-tRNA synthetase;       
  127::235     4e-06  34%  592 aa  SYD_CHRSD RecName: Full=Aspartyl-tRNA synthetase;       
  441::560     8e-06  34%  590 aa  SYD_HAHCH RecName: Full=Aspartyl-tRNA synthetase;       
  467::562     1e-05  39%  591 aa  SYD_PSEMY RecName: Full=Aspartyl-tRNA synthetase;       
  190::233     2e-05  37%  577 aa  SYD_DEIGD RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-05  31%  594 aa  SYD_SACD2 RecName: Full=Aspartyl-tRNA synthetase;       
  443::561     4e-05  31%  591 aa  SYD_PSEAE RecName: Full=Aspartyl-tRNA synthetase;       
  443::561     4e-05  31%  591 aa  SYD_PSEAB RecName: Full=Aspartyl-tRNA synthetase;       
  443::561     4e-05  31%  591 aa  SYD_PSEA8 RecName: Full=Aspartyl-tRNA synthetase;       
  457::578     5e-05  34%  610 aa  SYD_DESVH RecName: Full=Aspartyl-tRNA synthetase;       
  469::555     5e-05  31%  583 aa  SYD_CAMJR RecName: Full=Aspartyl-tRNA synthetase;       
  152::264     5e-05  32%  658 aa  SYDM_YEAST RecName: Full=Aspartyl-tRNA synthetase, mitochondrial;  
  469::555     7e-05  31%  583 aa  SYD_CAMJJ RecName: Full=Aspartyl-tRNA synthetase;       
  469::555     7e-05  31%  583 aa  SYD_CAMJE RecName: Full=Aspartyl-tRNA synthetase;       
  469::555     7e-05  31%  583 aa  SYD_CAMJD RecName: Full=Aspartyl-tRNA synthetase;       
  469::555     7e-05  31%  583 aa  SYD_CAMJ8 RecName: Full=Aspartyl-tRNA synthetase;       
  465::563     9e-05  34%  592 aa  SYD_MACCJ RecName: Full=Aspartyl-tRNA synthetase;       
  485::584     9e-05  37%  610 aa  SYD_ACIC5 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     1e-04  31%  599 aa  SYD_MARAV RecName: Full=Aspartyl-tRNA synthetase;       
  488::576     1e-04  34%  603 aa  SYD_ANASK RecName: Full=Aspartyl-tRNA synthetase;       
  488::576     1e-04  34%  603 aa  SYD_ANADE RecName: Full=Aspartyl-tRNA synthetase;       
  453::562     1e-04  32%  596 aa  SYD_ACIF5 RecName: Full=Aspartyl-tRNA synthetase;       
  453::562     1e-04  32%  596 aa  SYD_ACIF2 RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     2e-04  31%  591 aa  SYD_PSE14 RecName: Full=Aspartyl-tRNA synthetase;       
  463::568     2e-04  32%  603 aa  SYD_PELTS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     2e-04  31%  598 aa  SYD_PECCP RecName: Full=Aspartyl-tRNA synthetase;       
  439::562     2e-04  30%  589 aa  SYD_HAEDU RecName: Full=Aspartyl-tRNA synthetase;       
  478::564     2e-04  34%  595 aa  SYD_GLOVI RecName: Full=Aspartyl-tRNA synthetase;       
  457::578     2e-04  32%  606 aa  SYD_DESDG RecName: Full=Aspartyl-tRNA synthetase;       
  140::235     2e-04  35%  601 aa  SYD_CELJU RecName: Full=Aspartyl-tRNA synthetase;       
  488::576     2e-04  34%  603 aa  SYD_ANAD2 RecName: Full=Aspartyl-tRNA synthetase;       
  128::236     2e-04  34%  591 aa  SYD_LEUMM RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  594 aa  SYD_GEOSW RecName: Full=Aspartyl-tRNA synthetase;       
  441::562     2e-04  31%  599 aa  SYD_ERWCT RecName: Full=Aspartyl-tRNA synthetase;       
  452::561     2e-04  37%  589 aa  SYD_ENTFA RecName: Full=Aspartyl-tRNA synthetase;       
  190::233     2e-04  35%  577 aa  SYD_DEIDV RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACHK RecName: Full=Aspartyl-tRNA synthetase;       
  130::238     2e-04  36%  591 aa  SYD_BACCZ RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACCR RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACCQ RecName: Full=Aspartyl-tRNA synthetase;       
  130::238     2e-04  36%  589 aa  SYD_BACCN RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACC7 RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACC4 RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACC3 RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACC2 RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACC1 RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACC0 RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACAN RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACAH RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACAC RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     2e-04  35%  591 aa  SYD_BACAA RecName: Full=Aspartyl-tRNA synthetase;       
  444::565     2e-04  34%  592 aa  SYD_ALHEH RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALSV RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALPK RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALPC RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALPB RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALPA RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALNS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALHS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALG2 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALEP RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALDC RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALCH RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALA4 RecName: Full=Aspartyl-tRNA synthetase;       
  452::561     3e-04  29%  590 aa  SYD_MARMS RecName: Full=Aspartyl-tRNA synthetase;       
  470::561     3e-04  33%  589 aa  SYD_IDILO RecName: Full=Aspartyl-tRNA synthetase;       
  448::546     3e-04  32%  577 aa  SYD_DEIRA RecName: Full=Aspartyl-tRNA synthetase;       
  130::563     3e-04  35%  591 aa  SYD_BACWK RecName: Full=Aspartyl-tRNA synthetase;       
  355::464     3e-04  33%  466 aa  SYN_SHEDO RecName: Full=Asparaginyl-tRNA synthetase;       
  351::464     3e-04  31%  466 aa  SYN_IDILO RecName: Full=Asparaginyl-tRNA synthetase;       
  468::572     3e-04  34%  602 aa  SYD_TREPS RecName: Full=Aspartyl-tRNA synthetase;       
  468::572     3e-04  34%  602 aa  SYD_TREPA RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALTY RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     3e-04  31%  590 aa  SYD_SALAR RecName: Full=Aspartyl-tRNA synthetase;       
  189::237     3e-04  42%  438 aa  SYD_METJA RecName: Full=Aspartyl-tRNA synthetase;       
  456::569     3e-04  34%  603 aa  SYD_LARHH RecName: Full=Aspartyl-tRNA synthetase;       
  461::563     3e-04  31%  595 aa  SYD_BACHD RecName: Full=Aspartyl-tRNA synthetase;       
  130::238     3e-04  36%  592 aa  SYD_ANOFW RecName: Full=Aspartyl-tRNA synthetase;       
  355::464     4e-04  32%  466 aa  SYN_SHEPA RecName: Full=Asparaginyl-tRNA synthetase;       
  355::464     4e-04  32%  466 aa  SYN_SHEHH RecName: Full=Asparaginyl-tRNA synthetase;       
  355::464     4e-04  33%  466 aa  SYN_SHEFN RecName: Full=Asparaginyl-tRNA synthetase;       
  455::565     4e-04  32%  597 aa  SYD_THIDA RecName: Full=Aspartyl-tRNA synthetase;       
  480::569     4e-04  36%  594 aa  SYD_THEYD RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_SHISS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_SHIFL RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_SHIF8 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_SHIDS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_SHIBS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_SHIB3 RecName: Full=Aspartyl-tRNA synthetase;       
  451::561     4e-04  31%  591 aa  SYD_SHEAM RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     4e-04  30%  591 aa  SYD_PSEU2 RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     4e-04  30%  591 aa  SYD_PSEPK RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     4e-04  30%  591 aa  SYD_PSEPG RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     4e-04  30%  591 aa  SYD_PSEP1 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  31%  590 aa  SYD_PHOLL RecName: Full=Aspartyl-tRNA synthetase;       
  128::236     4e-04  34%  589 aa  SYD_LEUCK RecName: Full=Aspartyl-tRNA synthetase;       
  472::562     4e-04  35%  590 aa  SYD_GEOKA RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ESCF3 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOUT RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOSM RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOSE RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOLU RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOLI RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOLC RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOL6 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOL5 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOK1 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOHS RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECODH RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECOBW RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO8A RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO81 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO7I RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO5E RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO57 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO55 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO45 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO27 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     4e-04  30%  590 aa  SYD_ECO24 RecName: Full=Aspartyl-tRNA synthetase;       
  469::566     4e-04  34%  595 aa  SYD_CLOAB RecName: Full=Aspartyl-tRNA synthetase;       
  131::239     4e-04  35%  592 aa  SYD_BACA2 RecName: Full=Aspartyl-tRNA synthetase;       
  451::560     4e-04  31%  587 aa  SYD_ALCBS RecName: Full=Aspartyl-tRNA synthetase;       
  476::571     6e-04  31%  601 aa  SYD_VARPS RecName: Full=Aspartyl-tRNA synthetase;       
  450::558     6e-04  33%  584 aa  SYD_UNCTG RecName: Full=Aspartyl-tRNA synthetase;       
  442::561     6e-04  31%  600 aa  SYD_TERTT RecName: Full=Aspartyl-tRNA synthetase;       
  484::573     6e-04  30%  604 aa  SYD_SYNR3 RecName: Full=Aspartyl-tRNA synthetase;       
  449::556     6e-04  34%  582 aa  SYD_STRPZ RecName: Full=Aspartyl-tRNA synthetase;       
  449::556     6e-04  34%  582 aa  SYD_STRPM RecName: Full=Aspartyl-tRNA synthetase;       
  449::556     6e-04  34%  582 aa  SYD_STRP8 RecName: Full=Aspartyl-tRNA synthetase;       
  449::556     6e-04  34%  582 aa  SYD_STRP3 RecName: Full=Aspartyl-tRNA synthetase;       
  449::556     6e-04  34%  582 aa  SYD_STRP1 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     6e-04  31%  596 aa  SYD_SODGM RecName: Full=Aspartyl-tRNA synthetase;       
  451::561     6e-04  30%  593 aa  SYD_SHEDO RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     6e-04  31%  590 aa  SYD_SALTI RecName: Full=Aspartyl-tRNA synthetase;       
  475::565     6e-04  33%  592 aa  SYD_RHOBA RecName: Full=Aspartyl-tRNA synthetase;       
  453::562     6e-04  30%  591 aa  SYD_PSESM RecName: Full=Aspartyl-tRNA synthetase;       
  453::562     6e-04  31%  591 aa  SYD_PSEFS RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     6e-04  31%  591 aa  SYD_PSEF5 RecName: Full=Aspartyl-tRNA synthetase;       
  449::559     6e-04  33%  592 aa  SYD_PSEA6 RecName: Full=Aspartyl-tRNA synthetase;       
  475::571     6e-04  32%  598 aa  SYD_PROM9 RecName: Full=Aspartyl-tRNA synthetase;       
  176::224     6e-04  40%  423 aa  SYD_PICTO RecName: Full=Aspartyl-tRNA synthetase;       
  451::556     6e-04  32%  589 aa  SYD2_STRMU RecName: Full=Aspartyl-tRNA synthetase 2;       
  355::464     8e-04  32%  466 aa  SYN_SHESH RecName: Full=Asparaginyl-tRNA synthetase;       
  350::457     8e-04  32%  465 aa  SYN_PSEA6 RecName: Full=Asparaginyl-tRNA synthetase;       
  194::237     8e-04  41%  586 aa  SYD_SYNWW RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     8e-04  33%  591 aa  SYD_PSEPW RecName: Full=Aspartyl-tRNA synthetase;       
  443::562     8e-04  33%  591 aa  SYD_PSEE4 RecName: Full=Aspartyl-tRNA synthetase;       
  143::237     8e-04  34%  589 aa  SYD_LYSSC RecName: Full=Aspartyl-tRNA synthetase;       
  127::235     8e-04  32%  591 aa  SYD_LACF3 RecName: Full=Aspartyl-tRNA synthetase;       
  458::563     8e-04  32%  594 aa  SYD_HERA2 RecName: Full=Aspartyl-tRNA synthetase;       
  471::562     8e-04  31%  588 aa  SYD_HAEIN RecName: Full=Aspartyl-tRNA synthetase;       
  471::562     8e-04  31%  588 aa  SYD_HAEIG RecName: Full=Aspartyl-tRNA synthetase;       
  471::562     8e-04  31%  588 aa  SYD_HAEIE RecName: Full=Aspartyl-tRNA synthetase;       
  471::562     8e-04  31%  588 aa  SYD_HAEI8 RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     8e-04  30%  590 aa  SYD_CITK8 RecName: Full=Aspartyl-tRNA synthetase;       
  469::556     8e-04  32%  584 aa  SYD_CAMFF RecName: Full=Aspartyl-tRNA synthetase;       
  346::453     0.001  33%  461 aa  SYN_DESVV RecName: Full=Asparaginyl-tRNA synthetase;       
  346::453     0.001  33%  461 aa  SYN_DESVH RecName: Full=Asparaginyl-tRNA synthetase;       
  468::561     0.001  32%  592 aa  SYD_VIBVY RecName: Full=Aspartyl-tRNA synthetase;       
  197::251     0.001  33%  599 aa  SYD_SYNY3 RecName: Full=Aspartyl-tRNA synthetase;       
  488::577     0.001  31%  610 aa  SYD_SYNPX RecName: Full=Aspartyl-tRNA synthetase;       
  488::577     0.001  31%  611 aa  SYD_SYNPW RecName: Full=Aspartyl-tRNA synthetase;       
  451::561     0.001  31%  592 aa  SYD_SHESW RecName: Full=Aspartyl-tRNA synthetase;       
  451::561     0.001  31%  592 aa  SYD_SHEPC RecName: Full=Aspartyl-tRNA synthetase;       
  440::561     0.001  30%  593 aa  SYD_SERP5 RecName: Full=Aspartyl-tRNA synthetase;       
  455::562     0.001  30%  591 aa  SYD_OCEIH RecName: Full=Aspartyl-tRNA synthetase;       
  202::245     0.001  41%  600 aa  SYD_MOOTA RecName: Full=Aspartyl-tRNA synthetase;       
  119::227     0.001  35%  429 aa  SYD_METMJ RecName: Full=Aspartyl-tRNA synthetase;       
  471::562     0.001  31%  590 aa  SYD_MANSM RecName: Full=Aspartyl-tRNA synthetase;       
  202::245     0.001  41%  605 aa  SYD_HELMI RecName: Full=Aspartyl-tRNA synthetase;       
  201::244     0.001  39%  590 aa  SYD_HALOH RecName: Full=Aspartyl-tRNA synthetase;       
  193::284     0.001  34%  590 aa  SYD_EXISA RecName: Full=Aspartyl-tRNA synthetase;       
  470::561     0.001  31%  591 aa  SYD_EDWI9 RecName: Full=Aspartyl-tRNA synthetase;       
  194::237     0.001  41%  592 aa  SYD_DICTD RecName: Full=Aspartyl-tRNA synthetase;       
  480::570     0.001  34%  600 aa  SYD_DESRM RecName: Full=Aspartyl-tRNA synthetase;       
  461::565     0.001  37%  598 aa  SYD_DEHE1 RecName: Full=Aspartyl-tRNA synthetase;       
  477::567     0.001  35%  598 aa  SYD_CYAP8 RecName: Full=Aspartyl-tRNA synthetase;       
  131::239     0.001  33%  592 aa  SYD_BACLD RecName: Full=Aspartyl-tRNA synthetase;       
  464::562     0.001  33%  591 aa  SYD_AZOVD RecName: Full=Aspartyl-tRNA synthetase;       
  468::559     0.001  31%  586 aa  SYD_ALTMD RecName: Full=Aspartyl-tRNA synthetase;       
  471::562     0.001  31%  589 aa  SYD_ACTSZ RecName: Full=Aspartyl-tRNA synthetase;       
  191::234     0.001  41%  592 aa  SYD_ACIC1 RecName: Full=Aspartyl-tRNA synthetase;       
  303::348     0.001  42%  580 aa  SYDC_SCHPO RecName: Full=Aspartyl-tRNA synthetase, cytoplasmic;    
  225::268     0.001  41%  723 aa  SYD1_SYNAS RecName: Full=Aspartyl-tRNA synthetase 1;       
    1::351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxFASPWWDPARYLDRKPFLRARSAVTXXXXXXXXXXXXXXVETAILQLSPGNETHLHAPRTEFKGP
SYK3_PROMH      --------------------------------------------VETPMMSQATVTDIHLCPFETQFVGP
SYK3_KLEP7      ----------WQPSAPI---PNLLKRAAVMAEIRRFFTDRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_KLEP3      ----------WQPSAPI---PNLLKRAAVMAEIRRFFTDRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_MANSM      --------------------------------------------VETPVLSEFGVTDVHLSTFNTEFIAP
SYK3_ERWCT      --------------------------------------------VETPAMSQATVTDVFLYPFQTRFVGP
SYK3_PECCP      --------------------------------------------VETPAMSQATVTDIFLYPFQTRFVGP
SYK3_VIBCH      --------------------------------------------VETPAMSHATVTDIHLHTFKTEFVGP
SYK3_ESCF3      ----------WQPSASI---PNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SALAR      ----------WQPSASV---PNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_EDWI9      --------------------------------------------VDTPSMSQATVTDVHLVPFQTHFVGP
SYK3_HAES2      ----------WQPSASIQN---LLARAKIIADIRRFFTERGLLEVETPVLSEFGVTDVHLSTFSTAFTSP
SYK3_HAES1      ----------WQPSASIQN---LLARAKIIADIRRFFTERGLLEVETPVLSEFGVTDVHLSTFSTAFTSP
SYK3_SHIFL      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SHIF8      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SHIB3      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SERP5      --------------------------------------------VETPTMSQATVTDIHLFPFQTRFVGP
SYK3_SALSV      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALPK      ----------WQPSASI---PNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALPC      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALPB      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALPA      ----------WQPSASI---PNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALNS      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALCH      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_ECOUT      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOSM      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOSE      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOLU      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOLI      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOL6      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOL5      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOHS      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECODH      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECOBW      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO8A      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO81      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO7I      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO5E      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO57      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO55      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO45      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO27      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_ECO24      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SALDC      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_ECOLC      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SALTY      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALTI      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALHS      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALEP      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_SALA4      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_HAEDU      --------------------------------------------VETPALSEYSVTDVHLSTFSTEFLSP
SYK3_ENT38      ----------WQPSASI---PNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLVPFETRFVGP
SYK3_SODGM      ----------WQPSAPIAN---LLKRAAIVGQIRRFFSDRGLLEVETPAMSQATVTDIHLVPFQTCFIGP
SYK3_HAEGA      --------------------------------------------VETPILSEFGVTDVHLSTFSTKLISP
SYK3_YERE8      --------------------------------------------VETPTMSQATVTDIHLVPFQTRFVGP
SYK3_ERWT9      ----------WQPSASIAN---LLKRAAIMAEIRRFFADRGVLEVETPAMSQATVTDVHLFPFQTRFVGP
SYK3_YERPY      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPS      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPP      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPN      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPG      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPE      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPB      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERPA      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_YERP3      --------------------------------------------VETPTMSQATVTDIHLVPFETRFVGP
SYK3_PHOLL      --------------------------------------------VETPAMGQFTVTDIQLFSFQTEFVGP
SYK3_ACTSZ      -----FEQEQWQPTANVET---LFARAKIINNIRRFFTDRGVLEVETPILSEFGVTDVHLSTFSTEFVAP
SYK3_VIBPA      ----------WQPTASIEQ---LRQRATLIAAIRQFFAERQVMEVDTPAMSHATVTDIHLHTFQTEFVGP
SYK3_VIBHB      ----------WQPTASMEQ---LRQRAALITAIRQFFAERQVMEVDTPAMSHATVTDIHLHTFQTEFVGP
SYK3_HAMD5      --------------------------------------------VDTPCMSQATVTDVHLSTFETRFLAP
SYK3_VIBVY      ----------WKPTASIEQ---LRQRAVLIANIRQFFAQRGVLEVDTPAMSHATVTDIHLHTFQTEFVGP
SYK3_VIBVU      ----------WKPTASIEQ---LRQRAVLIANIRQFFAQRGVLEVDTPAMSHATVTDIHLHTFQTEFVGP
SYK3_PASMU      ----------WQPSASIEN---LLARAKIIAEIRRFFTDRGLLEVETPVLSEFGVTDVHLSTFNTTFISP
SYK3_PSEHT      --------------------------------------------VETPSLSGASVTDIHLVSFNTRFVGP
SYK3_PHOPR      ----------WQPTASIKQ---LKQRAAVLSSIRDFFAGKEVIEVDTPAMSQATVTDVHLHTFQTEFVGP
SYK3_BAUCH      ----------------------------------------------------------------------
SYK3_BUCAP      --------------------------------------------VETPILSQSGVTDVNLMPFITNYFSF
SYK_DEHSC       --------------RYLDRQTFL-TRSRVISVIRAFMNAKGFLEVETPVLQPEAGGATHHQALNCDF---
SYK_DEHSB       --------------RYLDRQTFL-TRSRVISVIRAFMNAKGFLEVETPVLQPEAGGATHHQALNCDF---
SYK3_BUCAI      --------------------------------------------VETPILSRSTVTDVHLTSFETNYISS
SYK_DEHE1       --------------RYLDRQTFL-TRSQVISAIRSFMSSKGFLEVETPVLQPEAGGATHHQALDCDF---
SYK_PELTS       --------------------------------------------VETPMMQVIPGGAA-ARPFITHHNAL
SYK_IDILO       --------------RYLDRSTFM-ARSKIIDYIRRFLSDRQFLEVETPMMQAIPGGAA-ARPFSTHHNAL
SYK_CAMJR       ----------------------------------------------------------------------
SYK_CAMJ8       ----------------------------------------------------------------------
SYK_MAGSM       --------------------------------------------VETPMMHPIPGGAT-ARPFVTHHNAL
SYK_CAMJJ       ----------------------------------------------------------------------
SYK_CAMJE       ----------------------------------------------------------------------
SYK_VARPS       --------------------------------------------VETPMLHPIPGG-ANAKPFKTHHNAL
SYK_CAMJD       ----------------------------------------------------------------------
SYK3_BUCAT      --------------------------------------------VETPILSRSTVTDVHLTSFETNYISS
SYK3_BUCA5      --------------------------------------------VETPILSRSTVTDVHLTSFETNYISS
SYK3_AQUAE      --------------------------------------------VSTPLLLDFPNLDSNVEPVKVEVL-E
SYK_DEIRA       --------------------------------------------VEGPTLQVTAGGATHHNALSYDFK--
SYK_DECAR       -----------------------RARSAIVASIRNYMTGHGFMEVETPMMHPIPGGATHHNALDMQ----
SYK_CARHZ       ----------------------------------------------------------------------
SYK_RUTMC       --------------------------------------------VETPMLQTIPGGETHHNALDMPM---
SYK_ACIBY       --------------RYLDRKTF-EIRAKVVAGIRAFLTNERFMEVETPMMHVIPGGAS-ARPFETHHNAL
SYK_ACIBT       --------------RYLDRKTF-EIRAKVVAGIRAFLTNERFMEVETPMMHVIPGGAS-ARPFETHHNAL
SYK_ACIBS       --------------RYLDRKTF-EIRAKVVAGIRAFLTNERFMEVETPMMHVIPGGAS-ARPFETHHNAL
SYK_ACIB3       --------------RYLDRKTF-EIRAKVVAGIRAFLTNERFMEVETPMMHVIPGGAS-ARPFETHHNAL
SYK_MYCPN       --------------------------------------------VETPILQAVLGGKTHYNALKGDF---
SYK_PELLD       --------------RYVDRSTFIK-RSAIVSHIRSFFTSQGWLEVETPILQPIYGGAA-ARPFTTHHNAL
SYK_VESOH       --------------------------------------------VETPMLQTIPGGAT-----AKPFETY
SYK_STAS1       ----------------------------------------------------------------------
SYK_THISH       --------------------------------------------VETPMMQAIPGGAT-ARPFATHHHAL
SYK_THEP3       ----------------------------------------------------------------------
SYK_HAHCH       --------------RYLDRETF-RIRSKVIESIRYFLTKRDFIEAETPMLQVIPGGAT-ARPFVTYHNAL
SYK_PSYWF       ----------------------------------------------------------------------
SYK_BACST       ----------------------------------------------------------------------
SYK_ACIAD       --------------RYLDRKTF-EIRAQVVAGIRAFLTNQRFMEVETPMMHVIPGGAS-AQPFVTHHNAL
SYK_THEPX       ----------------------------------------------------------------------
SYK_PEDPA       ----------------------------------------------------------------------
SYK_LEGPL       ----------------------------------------------------------------------
SYK_LEGPH       ----------------------------------------------------------------------
SYK_LEGPC       ----------------------------------------------------------------------
SYK_HERA2       ----------------------------------------------------------------------
SYK_HELPY       ----------------------------------------------------------------------
SYK_HELPJ       ----------------------------------------------------------------------
SYK_HELPG       ----------------------------------------------------------------------
SYK_HELP2       ----------------------------------------------------------------------
SYK_LEGPA       ----------------------------------------------------------------------
SYK_HELPS       ----------------------------------------------------------------------
SYK_HELPH       ----------------------------------------------------------------------
SYK_HELAH       ----------------------------------------------------------------------
SYK_SINMW       --------------------------------------------VETPMLQPIYGGAT-----AEPFKTH
SYK_NEIMF       ----------------------------------------------------------------------
SYK_RHIME       --------------------------------------------VETPMLQPIYGGAT-----AEPFKTH
SYK_PSYA2       ----------------------------------------------------------------------
SYK_NEIMB       ----------------------------------------------------------------------
SYK_METPP       -----------------------RARSKAVSSIRQFMVEHGFLEVETPMLHPIPGG-ANAKPFVTHHNAL
SYK_ENTS8       --------------RYLDRKTF-KVRSQILAGIRQFMVGRGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_CHRSD       --------------------------------------------VETPMLQQIPGGAT-ARPFVTHHNAL
SYK_AZOSB       ----------------------------------------------------------------------
SYK_MYCGA       ----------------------------------------------------------------------
SYK_STAAW       ----------------------------------------------------------------------
SYK_STAAS       ----------------------------------------------------------------------
SYK_STAAR       ----------------------------------------------------------------------
SYK_RALEJ       ----------------------------------------------------------------------
SYK_LACSS       ----------------------------------------------------------------------
SYK_STAAN       ----------------------------------------------------------------------
SYK_STAAM       ----------------------------------------------------------------------
SYK_STAAC       ----------------------------------------------------------------------
SYK_STAAB       ----------------------------------------------------------------------
SYK_STAA8       ----------------------------------------------------------------------
SYK_STAA3       ----------------------------------------------------------------------
SYK_STAA1       ----------------------------------------------------------------------
SYK_BACSK       --------------RYLDEKGFLE--------------------VETPMMHSIPGGAS-ARPFVTHHNTL
SYK2_METMA      ---------------------------------------------ETPILQTVYGGANA--RPFTTFHNC
SYK_TERTT       --------------RYVDRKTFL-LRSRIVQFIRDYLNGREFLEVETPMLQAIPGGAT-ARPFETHHNAL
SYK_POLSQ       --------------------------------------------VETPMLHPIPGGAT-AKPFITHHNAL
SYK_NEIMA       ----------------------------------------------------------------------
SYK_NEIG2       ----------------------------------------------------------------------
SYK_NEIG1       ----------------------------------------------------------------------
SYK_SERP5       --------------RYLDRKTF-QVRSQIMAAMRNFMVERGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_PASMU       --------------RYLDRRTFI-IRSKVIAGIREYFLSKGFMEVETPMLQIIPGGAS-ARPFVTHHNAL
SYK_THETN       ----------------------------------------------------------------------
SYK_POLNS       ----------------------------------------------------------------------
SYK_METHJ       ----------------------------------------------------------------------
SYK_LISW6       ----------------------------------------------------------------------
SYK_CUPTR       ----------------------------------------------------------------------
SYK_CAMHC       ----------------------------------------------------------------------
SYK_ANASK       ----------------------------------------------------------------------
SYK_ANAD2       ----------------------------------------------------------------------
SYK3_SALG2      ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK3_CITK8      ----------WQPSASI---PNLLKRAAIMTEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
SYK_THIDA       --------------RYLDRSTFVR-RSKIIQAIREFMTGHGFLEVETPMMHPIPGGAAAKPFV-THHNAL
SYK_STAAU       ----------------------------------------------------------------------
SYK_AZOSE       --------------------------------------------VETPMMHPIPGGAA-AKPFTTHHNAL
SYK_MYCGE       --------------------------------------------VETPTLQAVLGGKTHYNALKADF---
SYK_TOLAT       --------------------------------------------VETPMMQVIPGGAS-ARPFVTHHNAL
SYK_ROSCS       ----------------------------------------------------------------------
SYK_METMJ       ----------------------------------------------------------------------
SYK_HAEIG       --------------RYLDRRTFI-IRSKVVAGIREYFISKGFMEVETPMLQVIPGGAS-ARPFVTHHNAL
SYK_HAEI8       --------------RYLDRRTFI-IRSKVVAGIREYFISKGFMEVETPMLQVIPGGAS-ARPFVTHHNAL
SYK_HAEDU       --------------RYLDRRTFV-IRSQVVSGIRQFFLERGFMEVETPMLQVIPGGATHHNALDVDM---
SYK3_BUCBP      ----------------------------------------------------------------------
SYK_VIBF1       --------------------------------------------VETPMMHVIPGGAS-ARPFVTHHNAL
SYK_SYNP6       ----------------------------------------------------------------------
SYK_SYNE7       ----------------------------------------------------------------------
SYK_STAES       ----------------------------------------------------------------------
SYK_STAEQ       ----------------------------------------------------------------------
SYK_PSYIN       --------------RYLDRKTFL-LRNKIVNAIRQYLNDRDFMEVETPMLQSIPGG-----AAAKPFETY
SYK_PSYCK       ----------------------------------------------------------------------
SYK_PELPB       --------------RYVDKETFIK-RSAIVSFMRNAFTGKGWLEVETPILQPIYGGAA-ARPFTTHHNAL
SYK_PECCP       --------------RYLDRNTF-RIRSKVMAAIRSFMVDHGFMEVETPMMQVIPGGAS-ARPFITHHNAL
SYK_METFK       --------------RYVDRKTFV-ARSKIVAAIRAFMLSHEFLEVETPMLHPIPGGATHHNALDLQM---
SYK2_METAC      ----------------------------------------------------------------------
SYK_YERPY       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPS       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPP       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPN       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPG       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPE       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPB       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERPA       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERP3       --------------RYLDSRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_YERE8       --------------RYLDRNTF-KVRSQVMSGIRRFMVEKGFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_RALSO       ----------------------------------------------------------------------
SYK_RALME       ----------------------------------------------------------------------
SYK_LARHH       ----------------------------------------------------------------------
SYK_HELHP       ----------------------------------------------------------------------
SYK_BURP8       ----------------------------------------------------------------------
SYK_BACSU       ----------------------------------------------------------------------
SYK3_HAEIN      --------------------------------------------VETPVLSEFGVTDLHLSTFSTEFLAP
SYK3_HAEIG      --------------------------------------------VETPVLSEFGVTDLHLSTFSTEFLAP
SYK3_HAEIE      --------------------------------------------VETPVLSEFGVTDLHLSTFSTEFLAP
SYK_RHILW       -----------------DSKLRFQQRSKIVSGIRRFMENDGFMEVETPMLQSIYGGAT-----AEPFKTH
SYK_VIBFM       --------------------------------------------VETPMMHVIPGGAS-ARPFVTHHNAL
SYK_STAHJ       ----------------------------------------------------------------------
SYK_PORGI       --------------------------------------------VDTPVLQSIPGGA----AARPFITHH
SYK_GRAFK       --------------------------------------------VETPILQSIPGGAA-ARPFVTHHNAL
SYK_SHIDS       --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK_RHIEC       -----------------DSKLRFQQRSKIVSGIRRFMENDGFMEVETPMLQSIYGGAT-----AEPFKTH
SYK_CITK8       --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK_BORPD       --------------------------------------------VETPMLHPIPGGATHHNALDMEM---
SYK_AERHH       --------------RYLDRKTFV-TRTKVVAGIRKFLNDKRFMEVETPMMQVIPGGAS-ARPFITHHNAL
SYK_SHIF8       --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK_SHIBS       --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK_SHIB3       --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK_SALSV       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALPK       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALPB       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALPA       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALNS       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALHS       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALG2       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALEP       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALDC       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALCH       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SALA4       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_ROSS1       ----------------------------------------------------------------------
SYK_RALEH       ----------------------------------------------------------------------
SYK_ANASP       -----------------------RRRAQITAGIRRYLEQRDFLEIETPVLQSEAGG-----ADARPFVTY
SYK1_SHIFL      --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK1_SALTY      --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK1_ECOLI      --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK1_ECOL6      --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK1_ECO57      --------------------------------------------VETPMMQVIPGGA----AARPFITHH
SYK_XANOM       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_SALPC       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_RALPJ       ----------------------------------------------------------------------
SYK_BACCR       ----------------------------------------------------------------------
SYK_BACC4       ----------------------------------------------------------------------
SYK_ANAVT       -----------------------RRRAQITAGIRRYLEQRDFLEIETPVLQSETGG-----ADARPFITY
SYK1_SALTI      --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_THEEB       -----------------------RKRALITAAIRRYLNEQGFIEIETPVLQVEAGG-----AEARPFITY
SYK_SALAR       --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_MANSM       --------------RYLDRRTFV-IRSKVIAGIREYFIGKGFIEVETPMLQVIPGGATHHNALDIDM---
SYK_CHLCH       --------------RYVDRETFIK-RTAIVAAMRNFFARHGWLEVETPILQPIYGGAA-ARPFTTHHNAL
SYK_BURCJ       ----------------------------------------------------------------------
SYK_BURCH       ----------------------------------------------------------------------
SYK_BURCC       ----------------------------------------------------------------------
SYK_BURCA       ----------------------------------------------------------------------
SYK_BORPA       ----------------------------------------------------------------------
SYK_ACTSZ       --------------RYLDRRTFV-IRSKVIAGIREYFIGKGFIEVETPMLQVIPGGATHHNALDIDM---
SYK_ACTPJ       --------------RYLDRRTFM-IRSKVVSGIRQFFLEKDFIEVETPMLQVIPGGATHHNALDVDM---
SYK_ACTP2       --------------RYLDRRTFM-IRSKVVSGIRQFFLEKDFIEVETPMLQVIPGGATHHNALDVDM---
SYK_PROMH       --------------------------------------------VETPMMQTIPGGAS-ARPFITHHNAL
SYK_CHLAA       ----------------------------------------------------------------------
SYK_AGRT5       --------------------------------------------VETPMLQTVYGGAT-----ADPFKTF
SYK_XANC5       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_RHIL3       --------------------------------------------VETPMLQSVYGGAT-----AEPFKTH
SYK_RHIE6       -----------------DSKLRFQQRSKIVSGIRRFMENDGFMEVETPMLQSIYGGAT-----AEPFKTH
SYK_BURCM       ----------------------------------------------------------------------
SYK_BURA4       ----------------------------------------------------------------------
SYK_BORPE       ----------------------------------------------------------------------
SYK_BORBR       ----------------------------------------------------------------------
SYK_PHOLL       --------------RYLDRKTF-QIRSQVLLALRSFMVSKGFMEVETPMMQVIPGGA----AARPFITHH
SYK_NOSP7       -----------------------RRRAQITAGIRRYLEQRDFLEIETPVLQSEAGGATHHNTLEMEL---
SYK_LEPIN       ----------------------------------------------------------------------
SYK_LEPIC       ----------------------------------------------------------------------
SYK_LACPL       ----------------------------------------------------------------------
SYK_ALISL       --------------------------------------------VETPMMHVIPGGAS-ARPFVTHHNAL
SYK_ACTP7       --------------------------------------------VETPMLQVIPGGATHHNALDVDM---
SYK_MOOTA       ----------------------------------------------------------------------
SYK_ERWT9       --------------------------------------------VETPMMQAIPGGAS-ARPFITHHNAL
SYK_CLOTE       ----------------------------------------------------------------------
SYK_CLOBH       ----------------------------------------------------------------------
SYK_CLOB1       ----------------------------------------------------------------------
SYK_BURVG       ----------------------------------------------------------------------
SYK_BURM1       ----------------------------------------------------------------------
SYK_BACWK       ----------------------------------------------------------------------
SYK_BACHK       ----------------------------------------------------------------------
SYK_BACCZ       ----------------------------------------------------------------------
SYK_BACC7       ----------------------------------------------------------------------
SYK_BACC2       ----------------------------------------------------------------------
SYK_BACC1       ----------------------------------------------------------------------
SYK_BACAN       ----------------------------------------------------------------------
SYK_BACAH       ----------------------------------------------------------------------
SYK_AERS4       --------------RYLDRKTFM-IRTKVVAGIRKFFNDKRFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK2_ECOLI      --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK2_ECOL6      --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK2_ECO57      --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
SYK_SHELP       ----------------------------------------------------------------------
SYK_LACF3       ----------------------------------------------------------------------
SYK_BURXL       ----------------------------------------------------------------------
SYK_BURPP       ----------------------------------------------------------------------
SYK_XANOP       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_PORG3       --------------------------------------------VDTPVLQSIPGGA----AARPFITHH
SYK_ERWCT       -----------------DSRNTFRIRSNVMAAIRRFMVDNGFMEVETPMMQVIPGGAS-ARPFITHHNAL
SYK_XANAC       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_OCEIH       --------------------------------------------VETPMMHSIPGGAS-ARPFITHHNAL
SYK_HERAR       -----------------DTRRTFKARTAAISSIRRFMERNDFMEVETPMLHTIPGGAA-AKPFTTHHNAL
SYK_PHOPR       --------------------------------------------VETPMMHVIPGGAT-ARPFITHHNAL
SYK_LEPBL       ----------------------------------------------------------------------
SYK_LEPBJ       ----------------------------------------------------------------------
SYK_DICNV       ----------------------------------------------------------------------
SYK_BACC0       ----------------------------------------------------------------------
SYK_XANCP       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_XANC8       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_SYNY3       ----------------------------------------------------------------------
SYK_SODGM       --------------RYLDRQTF-KVRSRIMAEIRRFMMDNDFMEVETPMMQTIPGGA----AARPFITHH
SYK_SHEDO       ----------------------------------------------------------------------
SYK_CLONN       ----------------------------------------------------------------------
SYK_BACCN       ----------------------------------------------------------------------
SYK_PROMA       ----------------------------------------------------------------------
SYK_XANCB       --------------------------------------------VETPMMHYIPGGAT-AKPFTTHHNAL
SYK_SHEAM       -----------------DSREAFKMRSKVVAAIRNFMIKKEFMEVETPMMHVIPGGAS-ARPFVTHHNAL
SYK_PARD8       --------------------------------------------VETPILQSIAGGAS-ARPFITHHNSL
SYK_JANMA       -----------------DTRRTFKARTAAISSIRRFMAENDFMEVETPMLHTIPGGATHHNALDMEM---
SYK_WOLSU       --------------RYLDLKETFKLRSQVVSSVRRFFEERGFLEVETPMMHPIPGGATHHNALGVD----
SYK_PROM9       ----------------------------------------------------------------------
SYK_CHLMU       ------------------RKTFL-ARSRILKLIREYMDQQDFLEVETPVLQTIYGG-----AEATPFVTT
SYK_BURPS       ----------------------------------------------------------------------
SYK_BURP6       ----------------------------------------------------------------------
SYK_BURP1       ----------------------------------------------------------------------
SYK_BURP0       ----------------------------------------------------------------------
SYK_BURMS       ----------------------------------------------------------------------
SYK_BURMA       ----------------------------------------------------------------------
SYK_BURM9       ----------------------------------------------------------------------
SYK_BURM7       ----------------------------------------------------------------------
SYK_VIBPA       ----------------------------------------------------------------------
SYK_SYNSC       --------------------------------------------IETPVLQSEPGGETHHNAPLT-----
SYK_SHEPW       ----------------------------------------------------------------------
SYK_NITEU       --------------------------------------------VETPMMHSIPGGAT-ARPFVTHHNAL
SYK_MYCHJ       ----------------------------------------------------------------------
SYK_MYCH7       ----------------------------------------------------------------------
SYK_THEMA       ----------------------------------------------------------------------
SYK_SHEB9       ----------------------------------------------------------------------
SYK_SHEB8       ----------------------------------------------------------------------
SYK_SHEB5       ----------------------------------------------------------------------
SYK_LISMF       ----------------------------------------------------------------------
SYK_BURTA       --------------------------------------------VETPMLHPIPGGATHHNALDMEM---
SYK_BUCAP       ----------------------------------------------------------------------
SYK_THESQ       ----------------------------------------------------------------------
SYK_THEP1       ----------------------------------------------------------------------
SYK_SYNPX       --------------------------------------------IETPVLQSEPGGETHHNAPLT-----
SYK_SHEFN       ----------------------------------------------------------------------
SYK_LISMO       ----------------------------------------------------------------------
SYK_CLOBL       ----------------------------------------------------------------------
SYK_CLOBK       ----------------------------------------------------------------------
SYK_PSEU2       -----------------------RVRSQVIAHIRSFLMKRDFLEVETPMLQTIPGGETHHNALDMEM---
SYK_PROM0       ----------------------------------------------------------------------
SYK_LISIN       ----------------------------------------------------------------------
SYK_LACLS       ----------------------------------------------------------------------
SYK_LACLM       ----------------------------------------------------------------------
SYK_LACLA       ----------------------------------------------------------------------
SYK_CLOBM       ----------------------------------------------------------------------
SYK_CHLTR       ------------------RKTFL-TRSRILKLIREYMDQQSFLEVETPILQTIYGG-----AEATPFVTT
SYK_CHLTB       ------------------RKTFL-TRSRILKLIREYMDQQSFLEVETPILQTVYGG-----AEATPFVTT
SYK_CHLTA       ------------------RKTFL-TRSRILKLIREYMDQQSFLEVETPILQTIYGG-----AEATPFVTT
SYK_CHLT2       ------------------RKTFL-TRSRILKLIREYMDQQSFLEVETPILQTVYGG-----AEATPFVTT
SYK_BACTN       --------------------------------------------VETPILQSIAGGAS-ARPFITHHNSL
SYK_FERNB       --------------------------------------------VETPILQYLTGGATHLNALDIDM---
SYK_STRSV       --------------RYLDRESFERTRSKIISEIRRYLDGQGFLEVETPVLH----NEAGGAAARPFITHH
SYK_SHEPA       ----------------------------------------------------------------------
SYK_SHEHH       ----------------------------------------------------------------------
SYK_PROM2       ----------------------------------------------------------------------
SYK_PHYAS       --------------RYLDRQVFL-TRSLIIKSIRNFFDNEGFLEVETPILQPSLGG-----ASAKPFITS
SYK_LEUCK       --------------------------------------------VETPILQTEAGGATHHNALNIDM---
SYK_BUCAI       --------------------------------------------VETPMLQNIPGG-----ANARPFITY
SYK_SHEWM       ----------------------------------------------------------------------
SYK_GLOVI       --------------RYLDRETF-RKRALIVREIRRFLDERGFLEIETPVLQTEAGGAAA--RPFTTHHNA
SYK_SYNWW       --------------------------------------------VETPMMQPIPGGAT-ARPFITHHNAL
SYK_PROM4       ----------------------------------------------------------------------
SYK_COXBU       --------------RYLDSRHLFQTRSQVIAQIRRFLDDRGYIEVETPMMHPLPGGETHHNAMNMDL---
SYK_COXBR       --------------RYLDSRHLFQTRSQVIAQIRRFLDDRGYIEVETPMMHPLPGGETHHNAMNMDL---
SYK_COXBN       --------------RYLDSRHLFQTRSQVIAQIRRFLDDRGYIEVETPMMHPLPGGETHHNAMNMDL---
SYK_COXB2       --------------RYLDSRHLFQTRSQVIAQIRRFLDDRGYIEVETPMMHPLPGGETHHNAMNMDL---
SYK_COXB1       --------------RYLDSRHLFQTRSQVIAQIRRFLDDRGYIEVETPMMHPLPGGETHHNAMNMDL---
SYK_SYNS3       ----------------------------------------------------------------------
SYK_STRA1       ----------------------------------------------------------------------
SYK_SYNS9       ----------------------------------------------------------------------
SYK_STRA5       ----------------------------------------------------------------------
SYK_STRA3       ----------------------------------------------------------------------
SYK_CHLTE       ----------------------------------------------------------------------
SYK_STRGC       --------------RYLDRESFNRTRSKIISEIRRYLDGQGFLEVETPVLH----NEAGGAAARPFITHH
SYK_CHLPN       ----------------------------------------------------------------------
SYK_BACFR       ----------------------------------------------------------------------
SYK_BACFN       ----------------------------------------------------------------------
SYK_THEM4       --------------------------------------------VETPILEYVTGGATHLNVFDIEM---
SYK_PROMP       ----------------------------------------------------------------------
SYK_PSEAE       -----------------------RVRSQVIAHIRRFLSERGFLEVETPMLQTIPGG-----AAAKPFETH
SYK_MYCCT       --------------RYVDRKTF-QARTKIIRTMQNFLDNRGYMEVETPILHSLKGGATHYNVLNTDV---
SYK_LYSSC       ----------------------------------------------------------------------
SYK_FUSNN       ----------------------------------------------------------------------
SYK_ANADE       ----------------------------------------------------------------------
SYK_MYCMS       --------------RYVDRKTF-QARTKIIRTLQNFLDNKGYMEVETPILHSLKGGATHYNVLNTDV---
SYK_AYWBP       --------------------------------------------VETPILQPTLGGATHHNALNCDF---
SYK_SULAC       ----------------------------------------------------------------------
SYK_BACV8       ----------------------------------------------------------------------
SYK_STRSY       --------------RYLDRESFDRTRSKIISEIRRYLDGLGFLEVETPVLH----NEAGGAAARPFITHH
SYK_STRS2       --------------RYLDRESFDRTRSKIISEIRRYLDGLGFLEVETPVLH----NEAGGAAARPFITHH
SYK_SYNPW       ----------------------------------------------------------------------
SYK_STRMU       ----------------------------------------------------------------------
SYK_BAUCH       --------------------------------------------VETPILQSLPGGAT-ARPFITYHNAL
SYK_CHLP8       ----------------------------------------------------------------------
SYK_CHLFF       ------------------RQTFLK-RSRIIKLIRQYMDAQDFIEVETPILQNIYGG-----AEATPFVTT
SYK_UREPA       ----------------------------------------------------------------------
SYK_UREP2       ----------------------------------------------------------------------
SYK_UREU1       ----------------------------------------------------------------------
SYK_ENT38       --------------RYLDRKTF-KIRSQIMAGIRQFMVGRDFMEVETPMMQVIPGGAS-ARPFVTHHNAL
SYK_STRTD       ----------------------------------------------------------------------
SYK_STRPZ       ----------------------------------------------------------------------
SYK_STRPG       ----------------------------------------------------------------------
SYK_STRP8       ----------------------------------------------------------------------
SYK_STRP6       ----------------------------------------------------------------------
SYK_STRP3       ----------------------------------------------------------------------
SYK_CLOAB       ----------------------------------------------------------------------
SYK_THEAB       ----------------------------------------------------------------------
SYK_STRR6       --------------RYLDQKGFLE--------------------VETPVLH----NEAGGAAARPFITHH
SYK_STRPS       --------------RYLDQKGFLE--------------------VETPVLH----NEAGGAAARPFITHH
SYK_STRPN       --------------RYLDQKGFLE--------------------VETPVLH----NEAGGAAARPFITHH
SYK_STRPI       --------------RYLDQKGFLE--------------------VETPVLH----NEAGGAAARPFITHH
SYK_STRP4       --------------RYLDQKGFLE--------------------VETPVLH----NEAGGAAARPFITHH
SYK_STRP2       --------------RYLDQKGFLE--------------------VETPVLH----NEAGGAAARPFITHH
SYK3_VIBSL      ----------WQPAATIKQ---LKQRADILNQIRQFFVERNVMEVDTPAMSHATVTDVHLHTFKTEFVGP
SYK_SULSO       ----------------------------------------------------------------------
SYK_STRP1       ----------------------------------------------------------------------
SYK_MYCA5       ----------------------------------------------------------------------
SYK_CLOK5       ----------------------------------------------------------------------
SYK_AZOPC       ----------------------------------------------------------------------
SYK_SOLLC       --------------RYLDLRALFRTRARIISYIRSFLDNLEFLEVETPSMNLTAGG-----ASARPFITH
SYK_MYCFE       ----------------------------------------------------------------------
SYK_AQUAE       ----------------------------------------------------------------------
SYK_THETH       --------------------------------------------VETPILQPTTGG-----AEARPFKTY
SYK_THET8       --------------------------------------------VETPILQPTTGG-----AEARPFKTY
SYK_THET2       --------------------------------------------VETPILQPTTGG-----AEARPFKTY
SYKC_YEAST      ----------------------------------------------------------------------
SYK_SYNR3       --------------------------------------------IETPVLQSEPGGETHHNAPLT-----
SYK_CLOPS       ----------------------------------------------------------------------
SYK_CLOPE       ----------------------------------------------------------------------
SYK_CLOP1       ----------------------------------------------------------------------
SYK_MYCMO       ----------------------------------------------------------------------
SYK_BUCBP       ----------------------------------------------------------------------
SYK_PROMM       ----------------------------------------------------------------------
SYK_PROM3       ----------------------------------------------------------------------
SYK_PROM5       ----------------------------------------------------------------------
SYK_MYCS5       ----------------------------------------------------------------------
SYK1_MYCPU      ------------------------------------------------------------------FKTY
SYK2_MYCPU      --------------------------------------------VETPMLHSILGG-----ASARPFKTY
SYK_LEUMM       --------------------------------------------VETPILQTEAGGATHHNALNIDM---
SYK_HAEIE       --------------RYLDRRTFI-IRSKVVAGIREYFISKGFMEVETPMLQVIPGGAS-ARPFVTHHNAL
SYK_ONYPE       --------------------------------------------VETPILQPTLGGATHHNALNCDF---
SYK_CAEEL       ----------------------------------------------------------------------
SYK_HAES2       --------------RYLDRRTFI-IRSKVIAGIREYFISKGFMEVETPMLQIIPGGAS-ARPFITHHNAL
SYK_ENTFA       ----------------------------------------------------------------------
SYK_VIBVY       ----------------------------------------------------------------------
SYK_VIBVU       ----------------------------------------------------------------------
SYK_VIBHB       ----------------------------------------------------------------------
SYK_VIBCH       ----------------------------------------------------------------------
SYK_HAEIN       --------------RYLDRRTFI-IRSKVVAGIREYFISKGFMEVETPMLQVIPGGAS-ARPFVTHHNAL
SYK_BACHD       ----------------------------------------------------------------------
SYK_THELT       --------------------------------------------VETPVLNFIPGGGA-AKPFITRLEAL
SYK_PSEPW       -----------------------RVRSQVISHIRKFLIDRDFLEVETPMLQTIPGG-----AAAKPFETH
SYK_PSEPK       -----------------------RVRSQVISHIRKFLIERDFLEVETPMLQTIPGG-----AAAKPFETH
SYK_PSEPG       -----------------------RVRSQVISHIRKFLIERDFLEVETPMLQTIPGG-----AAAKPFETH
SYK_PSEP1       -----------------------RVRSQVISHIRKFLIERDFLEVETPMLQTIPGG-----AAAKPFETH
SYK_PSEE4       -----------------------RVRSQVISHIRKFLIERDFLEVETPMLQTIPGG-----AAAKPFETH
SYK_ORYSJ       --------------RYLDLRHIFKTRSKVVSFIRKFLDGLDFLEVETPMMNMIAGG-----AAARPFVTH
SYK_EDWI9       --------------RYLDRETF-RTRSKILAAIRNFMVNKGFMEVETPMMQVIPGGAS-ARPFITHHNAL
SYK_ARATH       ----------------------------------------------------------------------
SYKC_SCHPO      ----------------------------------------------------------------------
SYK_PSEPF       -----------------DVRQTFRVRSQVIAHIRSFLMKRDFLEVETPMLQTIPGGETHHNALDMEM---
SYK_PSEF5       -----------------------RVRSQVIAHIRSFLMKRDFLEVETPMLQTIPGGETHHNALDMEM---
SYK_PSESM       -----------------DVRETFRVRSQVIAHIRSFLMQRDFLEVETPMLQTIPGGETHHNALDLEM---
SYK_PSEMY       -----------------------RVRSQVIAHIRRFLNERGFLEVETPMLQTIPGGETHHNALDMQM---
SYK_SHESW       ----------------------------------------------------------------------
SYK_SHESR       ----------------------------------------------------------------------
SYK_SHESM       ----------------------------------------------------------------------
SYK_SHESA       ----------------------------------------------------------------------
SYK_SHEPC       ----------------------------------------------------------------------
SYK_SHEON       ----------------------------------------------------------------------
SYK_PSEAB       -----------------------RVRSQVIAHIRRFLSERGFLEVETPMLQTIPGG-----AAAKPFETH
SYK_PSEA8       -----------------------RVRSQVIAHIRRFLSERGFLEVETPMLQTIPGG-----AAAKPFETH
SYK_PSEA7       -----------------------RVRSQVIAHIRRFLSERGFLEVETPMLQTIPGG-----AAAKPFETH
SYK_MYCHO       ----------------------------------------------------------------------
SYK_ARCB4       ----------------------------------------------------------------------
SYK_SHESH       --------------------------------------------VETPMMHTIPGGETHHNALDIAM---
SYK_MOUSE       --------------RYLDRQKFI-VRSKIITYIRSFLDELGFLEIETPMMNIIPGG-----AVAKPFITY
SYK_CRIGR       --------------------------------------------IETPMMNIIPGG-----AVAKPFITY
SYK_PSE14       -----------------DVRETFRVRSQVIAHIRSFLMKRDFLEVETPMLQTIPGGETHHNALDMEM---
SYK_BLOFL       ----------------------------------------------------------------------
SYK_CHRVO       ----------------------------------------------------------------------
SYK_XYLFA       ----------------------------------------------------------------------
SYK_WIGBR       ----------------------------------------------------------------------
SYK_KINRD       ----------------------VRARSNVVRALRRTLEDRGFLEVETPMLQTLHGGAS-ARPFVTRSNAF
SYK_COLP3       -----------------DTRNTFKMRSKIVAGIRNFLTQRDFMEVETPMLQIIPGGAT-AKPFMTHHNTF
SYK_BUCCC       ----------------------------------------------------------------------
SYK_XYLFT       ----------------------------------------------------------------------
SYK_XYLFM       ----------------------------------------------------------------------
SYK_XYLF2       ----------------------------------------------------------------------
SYK_HUMAN       --------------------------------------------IETPMMNIIPGG-----AVAKPFITY
SYKM_SCHPO      ----------------------------------------------------------------------
SYK_CHLCV       --------------------------------------------VETPILQNIYGG-----AEATPFVTT
SYK_MYCLE       ----------------------------------------------------------------------
SYK_BLOPB       ----------------------------------------------------------------------
SYK2_MYCTU      --------------RYLDSRALITARSSVLRAVRETLFAKGFVEVETPILQQLHGGATHINTYSMDL---
SYK2_MYCBO      --------------RYLDSRALITARSSVLRAVRETLFAKGFVEVETPILQQLHGGATHINTYSMDL---
SYK_CHLAB       ------------------RQTFLK-RSRIIKLIRHYMDAQGFIEVETPILQNVYGG-----AEATPFITM
SYK_MYCPE       ----------------------------------------------------------------------
SYK_MYCTA       --------------------------------------------VETPVLQTLAGGAA-ARPFATHSNAL
SYK_MYCBT       --------------------------------------------VETPVLQTLAGGAA-ARPFATHSNAL
SYK_MYCBP       --------------------------------------------VETPVLQTLAGGAA-ARPFATHSNAL
SYK1_MYCTU      --------------------------------------------VETPVLQTLAGGAA-ARPFATHSNAL
SYK1_MYCBO      --------------------------------------------VETPVLQTLAGGAA-ARPFATHSNAL
SYKM_YEAST      ----------------------------------------------------------------------
SYK_MYCGI       --------------------------------------------VETPMLQTLAGGAA-ARPFVTHSNAL
GPA_LEIDO       ----------------------------------------------------------------------
SYD_THEFY       ----------------------------------------------------------------------
SYD_CHRSD       --------------RYIDRRPELRLRSRITHSVRAYLEGQGFLDIETPILTRATGARDYLVPSRTHA---
SYD_HAHCH       ----------------------------------------------------------------------
SYD_PSEMY       ----------------------------------------------------------------------
SYD_DEIGD       ----------------------------------------------------------------------
SYD_SACD2       ----------------------------------------------------------------------
SYD_PSEAE       ----------------------------------------------------------------------
SYD_PSEAB       ----------------------------------------------------------------------
SYD_PSEA8       ----------------------------------------------------------------------
SYD_DESVH       ----------------------------------------------------------------------
SYD_CAMJR       ----------------------------------------------------------------------
SYDM_YEAST      --------------RYLQRNPFLKKRSSISKEIRNSFNNFDFTEVETPMLKATPEGAREFLVP-TRTKRS
SYD_CAMJJ       ----------------------------------------------------------------------
SYD_CAMJE       ----------------------------------------------------------------------
SYD_CAMJD       ----------------------------------------------------------------------
SYD_CAMJ8       ----------------------------------------------------------------------
SYD_MACCJ       ----------------------------------------------------------------------
SYD_ACIC5       ----------------------------------------------------------------------
SYD_MARAV       ----------------------------------------------------------------------
SYD_ANASK       ----------------------------------------------------------------------
SYD_ANADE       ----------------------------------------------------------------------
SYD_ACIF5       ----------------------------------------------------------------------
SYD_ACIF2       ----------------------------------------------------------------------
SYD_PSE14       ----------------------------------------------------------------------
SYD_PELTS       ----------------------------------------------------------------------
SYD_PECCP       ----------------------------------------------------------------------
SYD_HAEDU       ----------------------------------------------------------------------
SYD_GLOVI       ----------------------------------------------------------------------
SYD_DESDG       ----------------------------------------------------------------------
SYD_CELJU       ----------------------LRFRGKVTSAIRNYLDRHGFLDVETPILTRATGARDYLVPSRTH----
SYD_ANAD2       ----------------------------------------------------------------------
SYD_LEUMM       --------------RYLDRRPELRIRSKIMSSAMHFMDTHDFINIETPVLAKSPEGARDYLVPSRVFPGS
SYD_GEOSW       --------------RYLDRRPVLQLRHRVTKAIRDFLDGEGFLEVETPILTKSTGARDYLVPSRVH----
SYD_ERWCT       ----------------------------------------------------------------------
SYD_ENTFA       ----------------------------------------------------------------------
SYD_DEIDV       ----------------------------------------------------------------------
SYD_BACHK       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACCZ       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACCR       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACCQ       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACCN       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACC7       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACC4       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACC3       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACC2       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACC1       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACC0       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACAN       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACAH       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACAC       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_BACAA       --------------RYLDRRPVMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYD_ALHEH       ----------------------------------------------------------------------
SYD_SALSV       ----------------------------------------------------------------------
SYD_SALPK       ----------------------------------------------------------------------
SYD_SALPC       ----------------------------------------------------------------------
SYD_SALPB       ----------------------------------------------------------------------
SYD_SALPA       ----------------------------------------------------------------------
SYD_SALNS       ----------------------------------------------------------------------
SYD_SALHS       ----------------------------------------------------------------------
SYD_SALG2       ----------------------------------------------------------------------
SYD_SALEP       ----------------------------------------------------------------------
SYD_SALDC       ----------------------------------------------------------------------
SYD_SALCH       ----------------------------------------------------------------------
SYD_SALA4       ----------------------------------------------------------------------
SYD_MARMS       ----------------------------------------------------------------------
SYD_IDILO       ----------------------------------------------------------------------
SYD_DEIRA       ----------------------------------------------------------------------
SYD_BACWK       --------------RYLDRRPAMKMRHDVTKTIRNFLDTEEFLEVETPILTKSTGARDYLVPSRVH----
SYN_SHEDO       ----------------------------------------------------------------------
SYN_IDILO       ----------------------------------------------------------------------
SYD_TREPS       ----------------------------------------------------------------------
SYD_TREPA       ----------------------------------------------------------------------
SYD_SALTY       ----------------------------------------------------------------------
SYD_SALAR       ----------------------------------------------------------------------
SYD_METJA       ----------------------------------------------------------------------
SYD_LARHH       ----------------------------------------------------------------------
SYD_BACHD       ----------------------------------------------------------------------
SYD_ANOFW       --------------RYLDRRPVMKMRHQVTKAIRDFLDEEGFLEVETPILTKSTGARDYLVPSRVH----
SYN_SHEPA       ----------------------------------------------------------------------
SYN_SHEHH       ----------------------------------------------------------------------
SYN_SHEFN       ----------------------------------------------------------------------
SYD_THIDA       ----------------------------------------------------------------------
SYD_THEYD       ----------------------------------------------------------------------
SYD_SHISS       ----------------------------------------------------------------------
SYD_SHIFL       ----------------------------------------------------------------------
SYD_SHIF8       ----------------------------------------------------------------------
SYD_SHIDS       ----------------------------------------------------------------------
SYD_SHIBS       ----------------------------------------------------------------------
SYD_SHIB3       ----------------------------------------------------------------------
SYD_SHEAM       ----------------------------------------------------------------------
SYD_PSEU2       ----------------------------------------------------------------------
SYD_PSEPK       ----------------------------------------------------------------------
SYD_PSEPG       ----------------------------------------------------------------------
SYD_PSEP1       ----------------------------------------------------------------------
SYD_PHOLL       ----------------------------------------------------------------------
SYD_LEUCK       --------------RYLDRRPELRIRSKIMSSAMHFMDQNDFINIETPILAKSPEGARDYLVPSRIFPGS
SYD_GEOKA       ----------------------------------------------------------------------
SYD_ESCF3       ----------------------------------------------------------------------
SYD_ECOUT       ----------------------------------------------------------------------
SYD_ECOSM       ----------------------------------------------------------------------
SYD_ECOSE       ----------------------------------------------------------------------
SYD_ECOLU       ----------------------------------------------------------------------
SYD_ECOLI       ----------------------------------------------------------------------
SYD_ECOLC       ----------------------------------------------------------------------
SYD_ECOL6       ----------------------------------------------------------------------
SYD_ECOL5       ----------------------------------------------------------------------
SYD_ECOK1       ----------------------------------------------------------------------
SYD_ECOHS       ----------------------------------------------------------------------
SYD_ECODH       ----------------------------------------------------------------------
SYD_ECOBW       ----------------------------------------------------------------------
SYD_ECO8A       ----------------------------------------------------------------------
SYD_ECO81       ----------------------------------------------------------------------
SYD_ECO7I       ----------------------------------------------------------------------
SYD_ECO5E       ----------------------------------------------------------------------
SYD_ECO57       ----------------------------------------------------------------------
SYD_ECO55       ----------------------------------------------------------------------
SYD_ECO45       ----------------------------------------------------------------------
SYD_ECO27       ----------------------------------------------------------------------
SYD_ECO24       ----------------------------------------------------------------------
SYD_CLOAB       ----------------------------------------------------------------------
SYD_BACA2       --------------RYLDRRPALQMRHQVTKSIRHFLDENGFLDIETPILTKSSGARDYLVPSRVH----
SYD_ALCBS       ----------------------------------------------------------------------
SYD_VARPS       ----------------------------------------------------------------------
SYD_UNCTG       ----------------------------------------------------------------------
SYD_TERTT       ----------------------------------------------------------------------
SYD_SYNR3       ----------------------------------------------------------------------
SYD_STRPZ       ----------------------------------------------------------------------
SYD_STRPM       ----------------------------------------------------------------------
SYD_STRP8       ----------------------------------------------------------------------
SYD_STRP3       ----------------------------------------------------------------------
SYD_STRP1       ----------------------------------------------------------------------
SYD_SODGM       ----------------------------------------------------------------------
SYD_SHEDO       ----------------------------------------------------------------------
SYD_SALTI       ----------------------------------------------------------------------
SYD_RHOBA       ----------------------------------------------------------------------
SYD_PSESM       ----------------------------------------------------------------------
SYD_PSEFS       ----------------------------------------------------------------------
SYD_PSEF5       ----------------------------------------------------------------------
SYD_PSEA6       ----------------------------------------------------------------------
SYD_PROM9       ----------------------------------------------------------------------
SYD_PICTO       ----------------------------------------------------------------------
SYD2_STRMU      ----------------------------------------------------------------------
SYN_SHESH       ----------------------------------------------------------------------
SYN_PSEA6       ----------------------------------------------------------------------
SYD_SYNWW       ----------------------------------------------------------------------
SYD_PSEPW       ----------------------------------------------------------------------
SYD_PSEE4       ----------------------------------------------------------------------
SYD_LYSSC       -----------------------KMRSDVTRTIRNFLQNEGFLEVETPILTKSTGARDYLVPSRVH----
SYD_LACF3       --------------RYVDRRPYLKLRSKVTSIVHNYFDNNDFLDVETPELTRSPEGARDYIVPSRVYPG-
SYD_HERA2       ----------------------------------------------------------------------
SYD_HAEIN       ----------------------------------------------------------------------
SYD_HAEIG       ----------------------------------------------------------------------
SYD_HAEIE       ----------------------------------------------------------------------
SYD_HAEI8       ----------------------------------------------------------------------
SYD_CITK8       ----------------------------------------------------------------------
SYD_CAMFF       ----------------------------------------------------------------------
SYN_DESVV       ----------------------------------------------------------------------
SYN_DESVH       ----------------------------------------------------------------------
SYD_VIBVY       ----------------------------------------------------------------------
SYD_SYNY3       ----------------------------------------------------------------------
SYD_SYNPX       ----------------------------------------------------------------------
SYD_SYNPW       ----------------------------------------------------------------------
SYD_SHESW       ----------------------------------------------------------------------
SYD_SHEPC       ----------------------------------------------------------------------
SYD_SERP5       ----------------------------------------------------------------------
SYD_OCEIH       ----------------------------------------------------------------------
SYD_MOOTA       ----------------------------------------------------------------------
SYD_METMJ       -------------SRFLDRKPRVRARSAVTCAATAFLASRGCINIATPIVAAATEGGTELF-PIAYFE--
SYD_MANSM       ----------------------------------------------------------------------
SYD_HELMI       ----------------------------------------------------------------------
SYD_HALOH       ----------------------------------------------------------------------
SYD_EXISA       ----------------------------------------------------------------------
SYD_EDWI9       ----------------------------------------------------------------------
SYD_DICTD       ----------------------------------------------------------------------
SYD_DESRM       ----------------------------------------------------------------------
SYD_DEHE1       ----------------------------------------------------------------------
SYD_CYAP8       ----------------------------------------------------------------------
SYD_BACLD       --------------RYLDRRPSLKMRHNVTKAVRRFLDDNGFLDIETPVLTKSTGARDYLVPSRVH----
SYD_AZOVD       ----------------------------------------------------------------------
SYD_ALTMD       ----------------------------------------------------------------------
SYD_ACTSZ       ----------------------------------------------------------------------
SYD_ACIC1       ----------------------------------------------------------------------
SYDC_SCHPO      ----------------------------------------------------------------------
SYD1_SYNAS      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVXXXXXXX
SYK3_PROMH      GASQGLKYLMTSPEYHMKRLLAANSGPIYQMGRCFRNEEAGRYHNPEFTMLEWYRCFDMYRLMNEVDDLL
SYK3_KLEP7      GSQGLNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRCYDMYRLINEVDDLL
SYK3_KLEP3      GSQGLNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRCYDMYRLINEVDDLL
SYK3_MANSM      IGESKTLWLMTSPEYHMKRLLAAGSGAIFQICRVFRNEEAGSRHNPEFTMLEWYRPHFDMYRLINEVDDL
SYK3_ERWCT      GADGMTLYLMTSPEYHMKRLLAAGSGPIFQLCRSFRNEESGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_PECCP      GADGMTMYLMTSPEYHMKRLLAAGSGPIFQLCRSFRNEESGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_VIBCH      GAKGSALHLMTSPEFHMKRLLAAGSGCIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHALMDEMDAL
SYK3_ESCF3      GSQGMNLWLMTSPEYHMKRLLVAGCGPIFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALAR      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_EDWI9      GAQGMMLYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEESGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_HAES2      FMEKKTLWLTTSPEYHMKRLLAAGSGAIFQLCKVFRNEESGKKHNPEFTMLEWYRPHFDMHRLINEVDDL
SYK3_HAES1      FMEKKTLWLTTSPEYHMKRLLAAGSGAIFQLCKVFRNEESGKKHNPEFTMLEWYRPHFDMHRLINEVDDL
SYK3_SHIFL      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SHIF8      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SHIB3      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SERP5      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQMGRSFRNEEAGRHHNPEFTMLEWYRPHYDMYRL-------
SYK3_SALSV      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALPK      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALPC      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALPB      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALPA      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALNS      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALCH      GSQGMNLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOUT      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOSM      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOSE      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOLU      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOLI      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOL6      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOL5      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOHS      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECODH      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOBW      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO8A      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO81      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO7I      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO5E      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO57      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO55      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO45      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO27      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECO24      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALDC      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ECOLC      GSQGMNLWLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALTY      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALTI      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALHS      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALEP      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SALA4      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_HAEDU      FAQAKTLHLITSPEYHMKRLLAAGSSSIFQLCRVFRNEESGKRHNPEFTMLEWYRPHFDMYRLINEVDDL
SYK3_ENT38      GSQGMNLYMMTSPEYHMKRLLAAGCGPVYQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_SODGM      GAAGMPLYLMTSPEYHMKRLLAAGSGPLFQLCRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_HAEGA      QKKEKTLWLSTSPEYPMKRLLSAGSGAIFQLCKVFRNEEAGKKHSPEFTMLEWYRPYDMYRLIN------
SYK3_YERE8      GADGLTLYMMTSPEYHMKRLLAAGSGSIYQLGRSFRNEEAGRHHNPEFTMLEWYRPHDMYRLMDEVEDLL
SYK3_ERWT9      GAAAGIDYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRL-------
SYK3_YERPY      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPS      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPP      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPN      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPG      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPE      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPB      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERPA      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_YERP3      GADGLTLYMMTSPEYHMKRLLAAGSGPIYQLGRSFRNEEAGRYHNPEFTMLEWYRPHDMYRLMNEVDDLL
SYK3_PHOLL      GADGMTLYLMTSPEYHMKRLLAAGSGPIYQLGRCFRNEEAGRYHNPEFTMLEWYRPHYDMYRLMNEVDDL
SYK3_ACTSZ      QAERKTLWLNTSPEYHMKRLLAAGTGAIFQLCHVFRNEEAGSRHNPEFTMLEWYRPHDMYRLINEVDDLL
SYK3_VIBPA      DGS--KLFFMTSPEFHMKRLLAAGSGCIYQINKAFRNEENGRYHNPEFTMLEWYRVGFDHHKLMDEMDDL
SYK3_VIBHB      DGS--KLFFMTSPEFHMKRLLAAGSGCIYQINKAFRNEENGRHHNPEFTMLEWYRIGFDHHKLMDEMDDL
SYK3_HAMD5      TAKSLSLYMTTSPEYHMKRLLAAGSGPIYQMGRCFRNEEMGRYHNPEFTLLEWYRPHYDMYRLMD-----
SYK3_VIBVY      GAQGRHLHLMTSPEFHMKRLLAAGSGCIYQMAKAFRNEENGRHHNPEFTMLEW------YRVGFXXXXXX
SYK3_VIBVU      GAQGRHLHLMTSPEFHMKRLLAAGSGCIYQMAKAFRNEENGRHHNPEFTMLEW------YRVGFXXXXXX
SYK3_PASMU      TAEKKALWLSTSPEYHMKRLLAAGSGPIFQLCHVFRNEEAGQRHNPEFTMLEWYRPHDMYRLINEVDDLL
SYK3_PSEHT      GHASGLEYLQTSPEFAMKRLLAAGSGPIFQLCKAFRNEEAGSHHNPEFTMLEWYRPG-------------
SYK3_PHOPR      GAGGQTLYMMTSPEFHMKRLLSAGSGPIYQICKSFRNEESGRYHNPEFTMLEWYRPDFDHHDLMNEMDEL
SYK3_BAUCH      -------YLITSPEYHMKRLLAAGSGPIFQICHSFRNQEYGNYHNPEFTLLEWYRPYYNMVDI-------
SYK3_BUCAP      NDNIKKKWLITSPEYHMKRLLSAGSGSIYQICRSFRNQEFGQYHNPEFTMLEWYQLSCSMEKM-------
SYK_DEHSC       -------YMRIALELHLKRLIVGGFDRVYEIGRIFRNEGISTRHNPEFTMMESYQAYANYKDVMDFLEEM
SYK_DEHSB       -------YMRIALELHLKRLIVGGFDRVYEIGRIFRNEGISTRHNPEFTMMESYQAYANYKDVMDFLEEM
SYK3_BUCAI      DNELKL-WLTTSPEYHMKRLLASESGSIYQICHSFRNKEIGRYHNPEFTMLEWYQPFCSMKKFIKEIDIF
SYK_DEHE1       -------YMRIALELHLKRLIVGGFDRVYEIGRIFRNEGVSTRHNPEFTMMESYQAYADYKDVMDFLEEM
SYK_PELTS       DMDL---YLRIAPELYLKRLLVGGFEKVYEINRNFRNEGISTKHNPEFTMLELYQAYADYDMMNLTEELI
SYK_IDILO       DMEL---FLRIAPELYLKRLVVGGFEKVFEINRNFRNEGLSTRHNPEFTMLEFYWAYADYHDLMDLTEQM
SYK_CAMJR       ------RFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEEL
SYK_CAMJ8       ------RFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEEL
SYK_MAGSM       DTDL---YLRIAPELYLKRLIVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYQAYTDYRELMDFTEAL
SYK_CAMJJ       ------RFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEEL
SYK_CAMJE       ------RFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEEL
SYK_VARPS       DQEM---FLRIAPELYLKRLIVGGFERVFEINRSYRNEGISVRHNPEFTMMEFYAAYWNYRDLMDFTETL
SYK_CAMJD       ------RFLRIAPELYLKRLVVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLMDLTEEL
SYK3_BUCAT      DNELKL-WLTTSPEYHMKRLLASESGSIYQICHSFRNKELGRYHNPEFTML------EWYQPFCSMKKFI
SYK3_BUCA5      DNELKL-WLTTSPEYHMKRLLASESGSIYQICHSFRNKELGRYHNPEFTML------EWYQPFCSMKKFI
SYK3_AQUAE      RGENKVKWLHTSPEYSMKKLLSRYKRDIFQITKVFRNNEWGRLHRIEFHMLEWYAVGCDYLYLIEELKQL
SYK_DEIRA       --------LRISLELYLKRLLVGGFERVYEIGRVYRNEGIDRTHNPEFTMLELYWAYADYSDIAKLVEDL
SYK_DECAR       ------QFLRIAPELYLKRLVVGGFEKVFEINRNFRNEGLSPRHNPEFTMMEFYEAYANYHTLMDFTEGL
SYK_CARHZ       -------YLRIAPELYLKRLLVGGFEKVYEINRNFRNEGISTKHNPEFTMLELYQAYADYHDMMDITEEL
SYK_RUTMC       -------YLRIAPELYLKRLIVGGMDRVFEVSRNFRNEGLSTRHNPEFTMIEFYQAYATYHDLMNLTEKL
SYK_ACIBY       DMPL---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMIEFYQAYADYKDLMALTENM
SYK_ACIBT       DMPL---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMIEFYQAYADYKDLMALTENM
SYK_ACIBS       DMPL---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMIEFYQAYADYKDLMALTENM
SYK_ACIB3       DMPL---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMIEFYQAYADYKDLMALTENM
SYK_MYCPN       -------YLRIANEIALKKLIVGGLPKVYEMGRMFRNEGVDTTHNPEFTSIEMYQANADYAVMMDLTENL
SYK_PELLD       DMQL---YLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYDMMRLVEELF
SYK_VESOH       HNALMPMYFRISPELYLKRLIIGGMNKVFEINRNFRNEGLSTRHNPEFTMIEFYQAGTYHDLMNLTEKLF
SYK_STAS1       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDITENM
SYK_THISH       DMQL---FLRIAPELYLKRLVVGGFERVYEINRNFRNEGLSTRHNPEFTMVEFYEAYANYHXXXXXXXXX
SYK_THEP3       -------YLRIALELHLKRLIVGGLEKVYEMGRVFRNEGMDIRHNPEFTLLELYEATDYYGMMELTEQLF
SYK_HAHCH       DIEM---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSTRHNPEFTMIEFYQAFADYKDLMNLTEEM
SYK_PSYWF       -------YLRIAPELYLKRLVVGGFERVFEINRSFRNEGVSTRHNPEFTMIEFYQAYADYKDLMDLTERL
SYK_BACST       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENL
SYK_ACIAD       DMEL---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSTRHNPEFTMIEFYQAYADYQLTENMLEKL
SYK_THEPX       -------YLRIALELHLKRLIVGGLEKVYEMGRVFRNEGMDIRHNPEFTLLELYEATDYYGMMELTEQLF
SYK_PEDPA       -------YLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTRHNPEFTMLETYAAYFDFHDVMDETEGI
SYK_LEGPL       -----TMYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISTRHNPEFTMLEFYQAYADYNDLMNFTEQL
SYK_LEGPH       -----TMYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISTRHNPEFTMLEFYQAYADYNDLMNFTEQL
SYK_LEGPC       -----TMYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISTRHNPEFTMLEFYQAYADYNDLMNFTEQL
SYK_HERA2       -------YLRIATELYLKRLIVGGFDGVYEIGKNFRNEGVDRTHNPEFTMIEVYQAYGDYESIMQLTEGM
SYK_HELPY       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_HELPJ       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_HELPG       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_HELP2       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_LEGPA       -----TMYLRIAPELYLKRLVVGGFERVYEINRNFRNEGISTRHNPEFTMLEFYQAYADYNDLMNFTEQL
SYK_HELPS       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_HELPH       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_HELAH       ------RYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTYEDLIELSKRL
SYK_SINMW       HNTLKLMYLRIAPELYLKRVLVSGTDKVFEINRNFRNEGVSTRHNPEFTMMECYWAYADYEDVMGLVERM
SYK_NEIMF       -------YLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDI
SYK_RHIME       HNTLKLMYLRIAPELYLKRILVSGTDKVFEINRNFRNEGVSTRHNPEFTMMECYWAYADYEDVMGLVERM
SYK_PSYA2       -------YLRIAPELYLKRLVVGGFEKVFEINRSFRNEGVSTRHNPEFTMIEFYQAYADYHDLMDLTERL
SYK_NEIMB       -------YLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDI
SYK_METPP       DQQM---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSVRHNPEFTMMEFYAAYWTHHDLMDFTEQI
SYK_ENTS8       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_CHRSD       DIDM---YLRVAPELYLKRLVVGGFERVFEINRNFRNEGLSTRHNPEFTMLEFYWAYADYRDLLDLTEAM
SYK_AZOSB       -------FLRIAPELYLKRLVVGGLEKVFEVNRNFRNEGLSPRHNPEFTMMEFYEAYADYRSLMNFTEGL
SYK_MYCGA       ----RDYYLRIAPELPLKKLIVGSFEKIYEIGKCFRNEGMDSTHNPEFTSVETYVAYVDYIYMMELTEXX
SYK_STAAW       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESM
SYK_STAAS       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESM
SYK_STAAR       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_RALEJ       -------FMRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTENLI
SYK_LACSS       -------YLRIALELHLKRLIVGGMERVYEIGRVFRNEGIDTKHNPEFTMLETYAAYFDYKDVMDETEGI
SYK_STAAN       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_STAAM       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_STAAC       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_STAAB       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_STAA8       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_STAA3       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_STAA1       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_BACSK       DMEL---YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYADYHDIMELTEGV
SYK2_METMA      LGQ--NLFLRIAPELYLKRLVVGGYEKVFEICKNFRNEDIDTTHNPEFTMIEVYEAYRDYNDMMDLTESL
SYK_TERTT       DIDM---YLRIAPELYLKRLVVGGFERVYEINRNFRNEGLSTRHNPEFTMLEFYQAYADYNDLMDLTEDM
SYK_POLSQ       DMQM---FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEGLI
SYK_NEIMA       -------YLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDI
SYK_NEIG2       -------YLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDI
SYK_NEIG1       -------YLRIAPELYLKRLVVGGLERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDI
SYK_SERP5       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIELTESL
SYK_PASMU       DVDM---YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMLEYYQAYADYHDLMDNTEEL
SYK_THETN       -------YLRIALELHLKRLIVGGFEKVYEIGRVFRNEGMDIRHNPEFTLLELYEAYTDYHMMELTEQLF
SYK_POLNS       -------FLRIAPELYLKRLVVGGFERVFEINHNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEGLI
SYK_METHJ       -------YLRIAPELYLKRLVVGGFEKVFEVAKNFRNEDIDTSHNPEFSMVEIYQAYADYDMMKLTEGII
SYK_LISW6       -------YLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGL
SYK_CUPTR       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEDLI
SYK_CAMHC       ------RYLKIAPELYLKRLVVGGMNSVFEMNRCFRNEGMDLTHNPEFTSIEFYWAWHNYFEAMDLTEEL
SYK_ANASK       --------LRIATELHLKRLVVGGLDRVYEIGRIWRNEGIDRRHNPEFTSIEFYQAYATHEDLMRLTEEL
SYK_ANAD2       --------LRIATELHLKRLVVGGLDRVYEIGRIWRNEGIDRRHNPEFTSIEFYQAYATHEDLMRLTEEL
SYK3_SALG2      GHSQGINYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYR---------------
SYK3_CITK8      GSQGMNLYLMTSPEYHMKRLLVAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYR---------------
SYK_THIDA       DMEL---FLRIAPELYLKRLVVGGFEKVFEINRNFRNEGLSTRHNPEFTMMEFYEAYREYRLMDFTEALI
SYK_STAAU       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIDLTESMV
SYK_AZOSE       DMEL---FLRIAPELYLKRLVVGGFEKVFEVNRNFRNEGLSPRHNPEFTMMEFYEAYANYKSLMNFTEGL
SYK_MYCGE       -------YLRIANEIALKKLIIGGFNKVYEMGKMFRNEGVDTTHNPEFTSIEIYQAYADFEVMLVLVEKL
SYK_TOLAT       DIDM---YLRIAPELYLKRLVVGGFERVYEVNRNFRNEGISVRHNPEFTMLEFYMAYADYNDLMDLTEEM
SYK_ROSCS       -------YLRIAVELYLKRLIVGGFERVYEISKVFRNEGVDRTHNPEFTMMECYQAYADYHDMMRLVEDL
SYK_METMJ       -------YLRIAPELYLKRLVVGGFDKVFEIAKNFRNEDIDTNHNPEFTMVEVYEAYRDYNDMMNLTEEI
SYK_HAEIG       DVDM---YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMLEYYQAYADYHDLMDNTEEL
SYK_HAEI8       DVDM---YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMLEYYQAYADYHDLMDNTEEL
SYK_HAEDU       -------YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEQL
SYK3_BUCBP      -------WLVPSPEYHMKRLLVQNIGAIYQISRSFRNNEGGPYHNPEFTMLEWYSPYCNMFDFMKKVEKF
SYK_VIBF1       DVDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEM
SYK_SYNP6       -------YLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTSIEVYQAYADYEDMMRLTETL
SYK_SYNE7       -------YLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTSIEVYQAYADYEDMMRLTETL
SYK_STAES       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTENM
SYK_STAEQ       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTENM
SYK_PSYIN       HNALSLMYLRIAPELNLKRLVVGGFERVFEINRSFRNEGVSTRHNPEFTMIEFYQAYADYDLMNLTEEML
SYK_PSYCK       -------YLRIAPELYLKRLVVGGFEKVFEINRSFRNEGVSTRHNPEFTMIEFYQAYADYHDLMDLTERL
SYK_PELPB       DMQL---YLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYNWMMEMVEEL
SYK_PECCP       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTENL
SYK_METFK       -------YMRIAPELYLKRLVVGGFERVFEINRNFRNEGLSVRHNPEFTMMEFYAAYTDYKWLMDFTEXX
SYK2_METAC      -------FLRIAPELYLKRLVVGGYEKVFEISKNFRNEDIDTTHNPEFTMIEVYEAYRDYNDMMDLTEAL
SYK_YERPY       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPS       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPP       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPN       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPG       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPE       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPB       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERPA       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERP3       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIVXXXXXX
SYK_YERE8       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDIAXXXXXX
SYK_RALSO       -------FLRIAPELYLKRLIVGGFERVYEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDYTENLI
SYK_RALME       -------FMRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTENLI
SYK_LARHH       -------YLRIAPELYLKRLVVGGLERVFEINRNFRNEGMSTRHNPEFTMIEFYEAYCGYERMMEMTEKI
SYK_HELHP       ------RYLRIAPELYLKRLIVGGFEAIFELNRNFRNEGMDHSHNPEFSMIEFYWAYKTYEDLITLTQEL
SYK_BURP8       -------FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYKLMDFTEQLI
SYK_BACSU       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMSLTENL
SYK3_HAEIN      FGEQKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAGNRHNPEFTMLEWYR---------------
SYK3_HAEIG      FGEQKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAGNRHNPEFTMLEWYR---------------
SYK3_HAEIE      FGEQKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEAGNRHNPEFTMLEWYR---------------
SYK_RHILW       HNTLKLMYLRIAPELFLKRTLVSGTDKVFEINRNFRNEGVSTRHNPEFTMMECYWAYADYEDMMDLVERL
SYK_VIBFM       DVDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEM
SYK_STAHJ       -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESM
SYK_PORGI       NALDIPLYLRIANELYLKRLIVGGFDGVYEFSRNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMNFTEQM
SYK_GRAFK       DIPL---YLRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMEFTEQL
SYK_SHIDS       NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_RHIEC       HNTLKLMYLRIAPELFLKRTLVSGTDKVFEINRNFRNEGVSTRHNPEFTMMECYWAYADYEDMMDLVERL
SYK_CITK8       NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_BORPD       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYADYRLMDFTEHVL
SYK_AERHH       DIDM---YLRIAPELYLKRLVVGGFERVYEINRNFRNEGISVRHNPEFTMLEFYMAYADYIDLMDLTEEM
SYK_SHIF8       NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SHIBS       NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SHIB3       NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALSV       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALPK       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALPB       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALPA       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALNS       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALHS       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALG2       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALEP       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALDC       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALCH       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_SALA4       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_ROSS1       -------YLRIAVELYLKRLIVGGFERVYEISKVFRNEGVDRTHNPEFTMMECYQAYADYNDMMRLVEDL
SYK_RALEH       -------FMRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEDLI
SYK_ANASP       HNTLEMEYLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTSIEVYQAYADYNDMMALTEGI
SYK1_SHIFL      NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK1_SALTY      DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK1_ECOLI      NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK1_ECOL6      NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK1_ECO57      NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_XANOM       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQV
SYK_SALPC       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_RALPJ       -------FLRIAPELYLKRLIVGGFERVYEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BACCR       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTEDM
SYK_BACC4       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTEDM
SYK_ANAVT       HNTLEMEYLRIATELHLKRLIVGGFEKVFELGRVFRNEGISTRHNPEFTSIEIYQAYADYNDMMALTEGI
SYK1_SALTI      DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_THEEB       HNTLEMQYLRIATELHLKRLIVGGFEKVYELGRIFRNEGISTKHNPEFTSIEVYQAYADYNDMMTLTEAI
SYK_SALAR       DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
SYK_MANSM       -------YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEEL
SYK_CHLCH       DMQL---YLRIANELYLKRLIVGGFDGVFEFAKDFRNEGIDRFHNPEFTQVELYVAYKDYNWMMNLVEEL
SYK_BURCJ       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BURCH       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BURCC       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BURCA       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BORPA       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYADYRLMDFTEDLI
SYK_ACTSZ       -------YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEEL
SYK_ACTPJ       -------YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEEL
SYK_ACTP2       -------YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEEL
SYK_PROMH       DIDM---YLRIAPELYLKRLVVGGFDRVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYRDLIELTEEL
SYK_CHLAA       -------YLRIATELYLKRLIVGGFPGVYEIGKNFRNEGVDRSHNPEFTMMECYQAYADYHAMMTLVEEM
SYK_AGRT5       HNTLKMMYLRIAPELFLKRTLVSGSDKVFEINRNFRNEGVSTRHNPEFTMMECYWAYADYEDIMGLVERL
SYK_XANC5       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHQIMDLTEQV
SYK_RHIL3       HNTLKLMYLRIAPELFLKRTLISGTDKVFEVNRNFRNEGVSTRHNPEFTMMECYWAYADYEDIMDLVERL
SYK_RHIE6       HNTLKLMYLRIAPELFLKRTLVSGTDKVFEINRNFRNEGVSTRHNPEFTMMECYWAYADYEDMMDLVERL
SYK_BURCM       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BURA4       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BORPE       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYADYRLMDFTEDLI
SYK_BORBR       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYADYRLMDFTEDLI
SYK_PHOLL       NALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLIEEL
SYK_NOSP7       -------YLRIATELHLKRLIVGGFEKVFELGRIFRNEGISTRHNPEFTTIEVYQAYADYNDMMALTEGI
SYK_LEPIN       -------FLRIAPELYLKRLIVGGMDRVFELNRNFRNEGISTKHNPEFTMMEAYMAGDMSTMLDLTERLI
SYK_LEPIC       -------FLRIAPELYLKRLIVGGMDRVFELNRNFRNEGISTKHNPEFTMMEAYMAGDMSTMLDLTERLI
SYK_LACPL       -------YLRIALELHLKRLIVGGMEKVYEIGRVFRNEGMDREHNPEFTMMETYVAYFDFHDVMAETEGI
SYK_ALISL       DVDM---YLRVAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEAM
SYK_ACTP7       -------YLRIAPELYLKRLVVGGFERVFELNRNFRNEGVSVRHNPEFTMIEYYQAYADYHDLMDNTEEL
SYK_MOOTA       -------YLRIALELHLKRLLVGGLEKVYEMGRIFRNEGISTKHNPEFTMLELYQAYADYYVMMDLLEEM
SYK_ERWT9       DLDM---YLRIAPELYLKRLVVGGFDRVFEINRNFRNEGISPRHNPEFTMMELYMAYADYKDLIELTESL
SYK_CLOTE       -------YLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTMIELYEAYADYNDMMEITENM
SYK_CLOBH       -------YLRIATELYLKRLIVGGFEKVYEIGRNFRNEGMDIRHNPEFTVIELYEAYADYNDMMEITENM
SYK_CLOB1       -------YLRIATELYLKRLIVGGFEKVYEIGRNFRNEGMDIRHNPEFTVIELYEAYADYNDMMEITENM
SYK_BURVG       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BURM1       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTEQLI
SYK_BACWK       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYNDIMKLTENM
SYK_BACHK       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_BACCZ       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_BACC7       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_BACC2       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYNDIMKLTENM
SYK_BACC1       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_BACAN       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_BACAH       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_AERS4       DIDM---YLRIAPELYLKRLVVGGFERVYEINRNFRNEGISVRHNPEFTMIEFYMAYADYIDLMDLTEEL
SYK2_ECOLI      DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDIELTESLF
SYK2_ECOL6      DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDIELTESLF
SYK2_ECO57      DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDIELTESLF
SYK_SHELP       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEM
SYK_LACF3       -------YMRIATELRLKRLIVGGMERVYELGRIFRNEGMDPYHNPEFDTMETYAAYFDFNDVMKETEGI
SYK_BURXL       -------FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSVRHNPEFTMIEFYAAYTDYKLMDFTEQLI
SYK_BURPP       -------FLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSVRHNPEFTMIEFYAAYTDYKLMDFTEQLI
SYK_XANOP       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQV
SYK_PORG3       NALDIPLYLRIANELYLKRLIVGGFDGVYEFSRNFRNEGMDRTHNPEFTAMEIYVAYKDYNWMMNFTEQM
SYK_ERWCT       DIDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTENL
SYK_XANAC       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHQIMDLTEQV
SYK_OCEIH       DIEL---YMRIAIELHLKRLMVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMELTENL
SYK_HERAR       DMEM---FLRIAPELYLKRLVVGGFDRVFEINRNFRNEGVSIRHNPEFTMMEFYAAYTDYKLMDFTEAVI
SYK_PHOPR       DIDM---YLRVAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYNDLMDLTEEM
SYK_LEPBL       -------FLRIAPELYLKRLIVGGMDRVFELNRNFRNEGISTKHNPEFTMMEAYIAFADMNTMLDLTERL
SYK_LEPBJ       -------FLRIAPELYLKRLIVGGMDRVFELNRNFRNEGISTKHNPEFTMMEAYIAFADMNTMLDLTERL
SYK_DICNV       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSARHNPEFTMLEFYQAYADYNDLMDLSEVL
SYK_BACC0       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_XANCP       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQV
SYK_XANC8       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQV
SYK_SYNY3       -------YLRIATELHLKRLVVGGFEKVFELGRIFRNEGVSTRHNPEFTSIEVYQAYVDYNEMMALTEAL
SYK_SODGM       NALGIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMELYMAYADYRDIVLVETLF
SYK_SHEDO       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYQDLMDLTEEM
SYK_CLONN       -------YLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDVRHNPEFTAIELYEAYADYNDMMEITENM
SYK_BACCN       -------YMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYKDIMKLTENM
SYK_PROMA       -------FLRIATELHLKRLVVGGFERVYELGRIFRNEGISTRHNPEFTSVEIYQAFADYQMMDLTEELI
SYK_XANCB       DLDL---YLRVAPELYLKRLVVGGLERVYEINRNFRNEGVSTRHNPEFTMLELYEAYATYHEIMDLTEQV
SYK_SHEAM       DIEM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLIDLTEEM
SYK_PARD8       DIDL---YLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMELYVQYKDYNMMSFTEKLL
SYK_JANMA       -------FLRIAPELYLKRLVVGGFDRVFEINRNFRNEGVSIRHNPEFTMMEFYAAYTDYKLMDFTEAVI
SYK_WOLSU       ------RYLRIAPELYLKRLVVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYKTYHELMSLTEEL
SYK_PROM9       -------YLRIATELHLKRMVVGGFEKVYELGRIFRNEGISTKHNPEFTSVEIYQAFSNYDMMNLTEELI
SYK_CHLMU       LKALHTEFLRISLEIALKKILVGGMSRVYEIGKVFRNEGIDRTHNPEFTMIEAYAAYWDYNDVMKCVENL
SYK_BURPS       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURP6       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURP1       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURP0       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURMS       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURMA       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURM9       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BURM7       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_VIBPA       -------YLRIAPELYLKRLVVGGFDRVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDFTXXX
SYK_SYNSC       --------LRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAYSDYVMMELTEQMV
SYK_SHEPW       -------YLRIAPELYLKRLVVGGFERVFEVNRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEM
SYK_NITEU       DMSL---YLRIAPELYLKRLVVGGMEKVFEINRNFRNEGISTRHNPEFTMLEFYEAYQDHNLMDLTESML
SYK_MYCHJ       -------YLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKI-------
SYK_MYCH7       -------YLRIATELPLKKLLVAGFDRVYEIGKIFRNEGFDSTHNPEFTSIEFYQAYANLEKI-------
SYK_THEMA       -------YLRIAPELYLKRLIVGGFEKIYEIGKNFRNEGISYKHSPEFTSIEIYQAYADYNDMMDLTEEL
SYK_SHEB9       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEM
SYK_SHEB8       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEM
SYK_SHEB5       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEM
SYK_LISMF       -------YLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGL
SYK_BURTA       -------FLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYTDYRLMDFTERLI
SYK_BUCAP       -------YLRIAPELYLKQLIVGGFERIFELNRNFRNEGVSARHNPEFTMMEAYIAYSNYEDMMNFTENL
SYK_THESQ       -------YLRIAPELYLKRLIIGGFEKIYEIGKNFRNEGISYKHSPEFTSIEIYQAYADYNDMMDLTEEL
SYK_THEP1       -------YLRIAPELYLKRLIIGGFEKIYEIGKNFRNEGISYKHSPEFTSIEIYQAYADYNDMMDLTEEL
SYK_SYNPX       --------LRIATELHLKRLVVGGFERVYELGRIFRNEGVSTRHNPEFTSVEIYQAYSDYGMMELTEQMV
SYK_SHEFN       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADYKDLMDLTEEM
SYK_LISMO       -------YLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGL
SYK_CLOBL       -------YLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENM
SYK_CLOBK       -------YLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENM
SYK_PSEU2       -------FLRIAPELYLKRLVVGGFEKVFEINRNFRNEGVSTRHNPEFTMLEF------YQAYADYEDNM
SYK_PROM0       -------YLRIATELHLKRMVVGGFEKVYELGRIFRNEGISTRHNPEFTSVEIYEAYSDYDMMNLTEELI
SYK_LISIN       -------YLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDYEDVMDLVEGL
SYK_LACLS       --------LRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFEDIMDLTEGI
SYK_LACLM       --------LRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFEDIMDLTEGI
SYK_LACLA       --------LRIATELHLKRLIVGGMEKVYELGRVFRNEGMDMTHNPEFTTMESYEAYADFEDIMDLTEGI
SYK_CLOBM       -------YLRIATELYLKRLIVGGFEKVYEIGKNFRNEGIDIRHNPEFTAIELYEAYADYNDMMEITENM
SYK_CHLTR       LQALHAEFLRISLEIALKKLLVGGMSRVYEIGKVFRNEGIDRTHNPEFTMIEAYAAYWDYNDVMKCVENL
SYK_CHLTB       LQALHAEFLRISLEIALKKLLVGGMSRVYEIGKVFRNEGIDRTHNPEFTMIEAYAAYWDYNDVMKCVENL
SYK_CHLTA       LQALHAEFLRISLEIALKKLLVGGMSRVYEIGKVFRNEGIDRTHNPEFTMIEAYAAYWDYNDVMKCVENL
SYK_CHLT2       LQALHAEFLRISLEIALKKLLVGGMSRVYEIGKVFRNEGIDRTHNPEFTMIEAYAAYWDYNDVMKCVENL
SYK_BACTN       DIDL---YLRIATELYLKRLIVGGFEGVYEIGKNFRNEGMDRTHNPEFTCMELYVQYKDYNMMSFTEKLL
SYK_FERNB       -------YLRIATELHLKRFIVGGFDKVYEIGKIFRNEGISYKHHPEFTSIELYQAYADYEDMMNLTEEL
SYK_STRSV       NAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQAYADFQDIMDLTEGI
SYK_SHEPA       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADFNDLMDLTEEM
SYK_SHEHH       -------YLRIAPELYLKRLVVGGFERVFEINRNFRNEGLSPRHNPEFTMMEFYMAYADFNDLMDLTEEM
SYK_PROM2       -------YLRIATELHLKRMVVGGFEKVYEMGRIFRNEGISTRHNPEFTSVEIYEAYSDYDMMNLTEELI
SYK_PHYAS       HNALNSDFLRIATELPLKKLIVGGMPKVYEIGRIFRNEGMDATHNPEFSTIEAYQAYSDIQGMMELTQKC
SYK_LEUCK       -------YMRIATELYLKRLVVGGFERVYEIGRIFRNEGMDPKHNPEFTTMETYAAYMDFTDVMD-----
SYK_BUCAI       HNEIDSQYLRIAPELYLKKLIIGGFERIF