[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39945.1

[Show Plain Result]


## Summary of Sequence Search
    1::346
    8::157     1e-18  40%  328 aa  HOLB_PSEAE RecName: Full=DNA polymerase III subunit delta';        
    9::168     1e-14  35%  578 aa  DPO3X_MYCTU RecName: Full=DNA polymerase III subunit gamma/tau;    
    9::168     1e-14  35%  578 aa  DPO3X_MYCBO RecName: Full=DNA polymerase III subunit gamma/tau;    
   12::170     2e-13  33%  363 aa  DPO3X_BUCAP RecName: Full=DNA polymerase III subunit gamma;        
   35::170     7e-13  37%  361 aa  DPO3X_BUCAI RecName: Full=DNA polymerase III subunit gamma;        
   12::278     6e-12  27%  688 aa  DPO3X_HAEIN RecName: Full=DNA polymerase III subunit gamma/tau;    
   12::172     2e-11  27%  563 aa  DPO3X_BACSU RecName: Full=DNA polymerase III subunit gamma/tau;    
   12::177     3e-11  30%  370 aa  DPO3X_BUCBP RecName: Full=DNA polymerase III subunit gamma;        
   12::176     4e-11  28%  643 aa  DPO3X_ECOLI RecName: Full=DNA polymerase III subunit tau;       
   14::159     6e-11  35%  340 aa  HOLB_YERPE RecName: Full=DNA polymerase III subunit delta';        
   12::176     8e-11  28%  642 aa  DPO3X_SALTY RecName: Full=DNA polymerase III subunit tau;       
   19::168     7e-10  29%  329 aa  HOLB_BACSU RecName: Full=DNA polymerase III subunit delta';        
   12::166     3e-09  30%  334 aa  HOLB_ECOLI RecName: Full=DNA polymerase III subunit delta';        
   94::165     4e-08  35%  336 aa  HOLB_BUCBP RecName: Full=DNA polymerase III subunit delta';        
   97::175     7e-08  34%  339 aa  RFC5_MOUSE RecName: Full=Replication factor C subunit 5;AltName:
  108::176     2e-07  34%  340 aa  RFC5_HUMAN RecName: Full=Replication factor C subunit 5;AltName:
  100::178     3e-07  34%  342 aa  RFC3_SCHPO RecName: Full=Replication factor C subunit 3;       
   25::158     9e-07  28%  328 aa  HOLB_BUCAP RecName: Full=DNA polymerase III subunit delta';        
   90::168     1e-06  30%  340 aa  RFC3_YEAST RecName: Full=Replication factor C subunit 3;       
   95::194     3e-06  31%  368 aa  RFC5_CAEEL RecName: Full=Probable replication factor C subunit
   94::172     3e-06  29%  338 aa  RFC3_ARXAD RecName: Full=Replication factor C subunit 3;       
   12::159     4e-06  32%  329 aa  RFCS1_PYRAR RecName: Full=Replication factor C small subunit 1;    
   88::166     5e-06  30%  329 aa  RFCS_STAMF RecName: Full=Replication factor C small subunit;       
   70::159     1e-05  33%  329 aa  RFCS1_PYRIL RecName: Full=Replication factor C small subunit 1;    
   70::159     1e-05  33%  329 aa  RFCS1_PYRAE RecName: Full=Replication factor C small subunit 1;    
  101::181     1e-05  29%  347 aa  RFC5_DICDI RecName: Full=Probable replication factor C subunit
   14::158     2e-05  28%  326 aa  HOLB_BUCAI RecName: Full=DNA polymerase III subunit delta';        
   80::158     2e-05  30%  315 aa  RFCS_METMP RecName: Full=Replication factor C small subunit;       
   80::158     2e-05  30%  315 aa  RFCS_METM6 RecName: Full=Replication factor C small subunit;       
   80::158     2e-05  30%  315 aa  RFCS_METM5 RecName: Full=Replication factor C small subunit;       
   85::159     3e-05  30%  326 aa  RFCS_PYRCJ RecName: Full=Replication factor C small subunit;       
   80::158     3e-05  30%  315 aa  RFCS_METVS RecName: Full=Replication factor C small subunit;       
   80::158     3e-05  30%  315 aa  RFCS_METM7 RecName: Full=Replication factor C small subunit;       
   83::161     3e-05  31%  323 aa  RFCS_METHJ RecName: Full=Replication factor C small subunit;       
  120::175     3e-05  32%  334 aa  RFC4_CAEEL RecName: Full=Replication factor C subunit 4;AltName:
  105::162     4e-05  28%  325 aa  RFCS_AERPE RecName: Full=Replication factor C small subunit;       
   12::159     4e-05  31%  322 aa  RFCS2_PYRAR RecName: Full=Replication factor C small subunit 2;    
   91::162     5e-05  31%  338 aa  RFCS_METAC RecName: Full=Replication factor C small subunit;       
   87::164     7e-05  30%  334 aa  RFCS_METBF RecName: Full=Replication factor C small subunit;       
   88::140     9e-05  32%  253 aa  Y007_MYCPN RecName: Full=Uncharacterized protein MG007 homolog;
   70::159     9e-05  32%  320 aa  RFCS2_PYRIL RecName: Full=Replication factor C small subunit 2;    
   70::159     9e-05  32%  319 aa  RFCS2_PYRAE RecName: Full=Replication factor C small subunit 2;    
   87::159     9e-05  33%  327 aa  HOLB_HAEIN RecName: Full=DNA polymerase III subunit delta';        
   91::162     2e-04  30%  338 aa  RFCS_METMA RecName: Full=Replication factor C small subunit;       
   10::179     2e-04  24%  352 aa  RFC5_NEUCR RecName: Full=Replication factor C subunit 5;       
   87::179     2e-04  26%  356 aa  RFC3_BOVIN RecName: Full=Replication factor C subunit 3;AltName:
  102::159     2e-04  28%  325 aa  RFCS_THEPD RecName: Full=Replication factor C small subunit;       
  100::158     2e-04  31%  318 aa  RFCS_PICTO RecName: Full=Replication factor C small subunit;       
   80::157     2e-04  30%  321 aa  RFCS_METST RecName: Full=Replication factor C small subunit;       
   87::179     2e-04  26%  356 aa  RFC3_MOUSE RecName: Full=Replication factor C subunit 3;AltName:
  100::158     3e-04  29%  318 aa  RFCS_THEVO RecName: Full=Replication factor C small subunit;       
  100::158     3e-04  29%  318 aa  RFCS_THEAC RecName: Full=Replication factor C small subunit;       
   91::168     3e-04  30%  325 aa  RFCS_HALMA RecName: Full=Replication factor C small subunit;       
  393::464     4e-04  29%  635 aa  RFCS_METKA RecName: Full=Replication factor C small subunit;       
   87::157     4e-04  30%  322 aa  RFCS_HALSA RecName: Full=Replication factor C small subunit;       
   87::157     4e-04  30%  322 aa  RFCS_HALS3 RecName: Full=Replication factor C small subunit;       
   87::179     4e-04  26%  356 aa  RFC3_HUMAN RecName: Full=Replication factor C subunit 3;AltName:
  214::393     6e-04  26%  466 aa  SYC_GEOSW RecName: Full=Cysteinyl-tRNA synthetase;       
   89::166     6e-04  29%  325 aa  RFCS_NATPD RecName: Full=Replication factor C small subunit;       
   77::147     6e-04  29%  309 aa  RFC4_ENCCU RecName: Full=Replication factor C subunit 4;       
   53::168     6e-04  32%  331 aa  RFC2_DROME RecName: Full=Replication factor C subunit 2;AltName:
  103::153     8e-04  31%  321 aa  RFCS_METTH RecName: Full=Replication factor C small subunit;       
  436::492     0.001  28%  649 aa  RFCS_HALWD RecName: Full=Replication factor C small subunit;       
    1::346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxARKAAADIVAKLPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYRMARFVLAHRD
HOLB_PSEAE      ----------------------------QQALWSQLGGRAAHAYLLYGPAGIGKRALAEHWAAQLLCQRP
DPO3X_MYCTU     --------------PASFAEVVGQEHVTAPLSVALDAGRINHAYLFSGPRGCGKTSSARILARSLNCAQG
DPO3X_MYCBO     --------------PASFAEVVGQEHVTAPLSVALDAGRINHAYLFSGPRGCGKTSSARILARSLNCAQG
DPO3X_BUCAP     --------------PQSFKKIIGQKYIVKAISNGFSLGKIHHAWLLSGTRGVGKTTIARLIAKSL-----
DPO3X_BUCAI     -------------------------------------GRIHHAWLLSGTRGIGKTTIARLLAKSL-----
DPO3X_HAEIN     --------------PKTFADVVGQEHIITALANGLKDNRLHHAYLFSGTRGVGKTSIARLFAKGL-----
DPO3X_BACSU     --------------PQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSGPRGTGKTSAAKIFAKAVNCEHA
DPO3X_BUCBP     --------------PQTFNDVIGQQYIVSAISNSLLLGRIHHAWLFFGIRGTGKTTIARILAK-------
DPO3X_ECOLI     --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
HOLB_YERPE      ------------------------------LVGQHSTGRGHHALLLHSLPGNGEDALIYALSRWLMCQQR
DPO3X_SALTY     --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
HOLB_BACSU      ------------------------------LYNSIEKDRLSHAYLFEGKKGTGKLDAALLLAKFCLEGGA
HOLB_ECOLI      ----------------------------EKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP
HOLB_BUCBP      ----------------------------------------------------------------------
RFC5_MOUSE      ----------------------------------------------------------------------
RFC5_HUMAN      ----------------------------------------------------------------------
RFC3_SCHPO      ----------------------------------------------------------------------
HOLB_BUCAP      -----------------------------------------HAILIKTQKGMGVFKLVWFISKWLLCLKP
RFC3_YEAST      ----------------------------------------------------------------------
RFC5_CAEEL      ----------------------------------------------------------------------
RFC3_ARXAD      ----------------------------------------------------------------------
RFCS1_PYRAR     --------------PRSFDEVVDLEEVKARLREFVRGGNMPHL-LFYGPPGTGKTTMALVLAR-------
RFCS_STAMF      ----------------------------------------------------------------------
RFCS1_PYRIL     ----------------------------------------------------------------------
RFCS1_PYRAE     ----------------------------------------------------------------------
RFC5_DICDI      ----------------------------------------------------------------------
HOLB_BUCAI      ------------------------------IVQQYQKKKAHHAILIKTPRGIGVSLLIWFISKWLLCLK-
RFCS_METMP      ----------------------------------------------------------------------
RFCS_METM6      ----------------------------------------------------------------------
RFCS_METM5      ----------------------------------------------------------------------
RFCS_PYRCJ      ----------------------------------------------------------------------
RFCS_METVS      ----------------------------------------------------------------------
RFCS_METM7      ----------------------------------------------------------------------
RFCS_METHJ      ----------------------------------------------------------------------
RFC4_CAEEL      ----------------------------------------------------------------------
RFCS_AERPE      ----------------------------------------------------------------------
RFCS2_PYRAR     --------------PRSFDEVVDLEEVKARLREFVRGGNMPHL-LFYGPPGTGKTTMALVLAR-------
RFCS_METAC      ----------------------------------------------------------------------
RFCS_METBF      ----------------------------------------------------------------------
Y007_MYCPN      ----------------------------------------------------------------------
RFCS2_PYRIL     ----------------------------------------------------------------------
RFCS2_PYRAE     ----------------------------------------------------------------------
HOLB_HAEIN      ----------------------------------------------------------------------
RFCS_METMA      ----------------------------------------------------------------------
RFC5_NEUCR      --------------PRSLDALTYHTELSERLRSLAQSGDFPHL-LVYGPSGAGKKT---RIVATLKELYG
RFC3_BOVIN      ----------------------------------------------------------------------
RFCS_THEPD      ----------------------------------------------------------------------
RFCS_PICTO      ----------------------------------------------------------------------
RFCS_METST      ----------------------------------------------------------------------
RFC3_MOUSE      ----------------------------------------------------------------------
RFCS_THEVO      ----------------------------------------------------------------------
RFCS_THEAC      ----------------------------------------------------------------------
RFCS_HALMA      ----------------------------------------------------------------------
RFCS_METKA      ----------------------------------------------------------------------
RFCS_HALSA      ----------------------------------------------------------------------
RFCS_HALS3      ----------------------------------------------------------------------
RFC3_HUMAN      ----------------------------------------------------------------------
SYC_GEOSW       --ARKYLGDTIDIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDQ
RFCS_NATPD      ----------------------------------------------------------------------
RFC4_ENCCU      ----------------------------------------------------------------------
RFC2_DROME      --------------------------------------------IIAGPPGVGKTTTIQCLARILLG--D
RFCS_METTH      ----------------------------------------------------------------------
RFCS_HALWD      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVITVDESRETIGFFGSTAAVEGW
HOLB_PSEAE      XXXXXXXXXXXXQL---------LAAGTHPDYFVLEPEEAEKP-----IRVDQVRDLVGFVVQTAQLGGR
DPO3X_MYCTU     PTANPCGVCESVSLAPNAPGVVELDAASHGG-------------------VDDTRELRDRAFYAPVQSRY
DPO3X_MYCBO     PTANPCGVCESVSLAPNAPGVVELDAASHGG-------------------VDDTRELRDRAFYAPVQSRY
DPO3X_BUCAP     ---NCEIGITSLPCRKC----------------TICQEI-EKGICLDFIEIDEIREILDNIYYTPSKSRF
DPO3X_BUCAI     ---NCQNGITS---DPCRQCI--ICKEIEKGLCLDVIEID--GASRT--KVEEMREILDSIYYSPIKSRF
DPO3X_HAEIN     ---NCVHGVTAT---PCGECENCKAIEQGNFIDLIEIDAASR------TKVEDTRELLDNVQYKPVVGRF
DPO3X_BACSU     PVDEPCNECAAC---------KGITNGSISDVIEIDAASNN-----GVDEIRDIRDKVKFAPSAVT---Y
DPO3X_BUCBP     ----SLNCKLGISPNPCRKCSNCVEVE-QGNFIDLYEV--DAASRTKVEDMKELLDNIRYLPSKGR---F
DPO3X_ECOLI     ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
HOLB_YERPE      ------QGEKS-------------CGECHSCRLMLAGNHPDWYVLKSSIGVELVRQLIDKLYSHAQQGGA
DPO3X_SALTY     ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
HOLB_BACSU      EPCESCRNCKRIE-SGNHPDLHLVQPDG----LSIKKA--------QIQALQEE------FSKTGLESHK
HOLB_ECOLI      QGHKSCGHCRGCQL---------MQAGTHPDYYTL---APEKG--KNTLGVDAVREVTEKLNEHARLGGA
HOLB_BUCBP      ------------------------------------------------IGVNEVRNFTNTIFNSAQQGQN
RFC5_MOUSE      --------------------------------------------------IDIVRGPILSFASTRTIKGF
RFC5_HUMAN      ------------------------------------------------------------FASTRTIKGF
RFC3_SCHPO      --------------------------------------------------IDAVREQIKNFASTRQISTF
HOLB_BUCAP      KGTNFCDNCHGCKL---------MSANNHPDWHTIINEKND------VFDVDSIRVINEKIFKRAQQGNN
RFC3_YEAST      --------------------------------------------------IDVVRNQIKDFASTRQIKGF
RFC5_CAEEL      --------------------------------MVLELNASDEDVVRNTIVNFAQTKGLQAFSSNTGTVPF
RFC3_ARXAD      --------------------------------------------------IDVVRDQIKTFASTRQISGF
RFCS1_PYRAR     ELYGEYWRENTLELNAS----------------------DERGI--NVI-----RERVKEFARTAPVAPF
RFCS_STAMF      --------------------------------------------------IDVIRSKVKEFARTAANIPF
RFCS1_PYRIL     ---------------------------------TLELNASDERGI-NVI-----RERVKEFARTAPVAPF
RFCS1_PYRAE     ---------------------------------TLELNASDERGI-NVI-----RERVKEFARTAPVAPF
RFC5_DICDI      --------------------------------------------------IDVVREQIKTFASSMTTVPY
HOLB_BUCAI      PIGDKCHGCKLMSAN-NHPDWHNFTPEKNN-LFSIERIINEK-----IFTCSRQG-------------GS
RFCS_METMP      --------------------------------------------------IDVIRTKVKDFARTKPIGDF
RFCS_METM6      --------------------------------------------------IDVIRTKVKDFARTKPIGDF
RFCS_METM5      --------------------------------------------------IDVIRTKVKDFARTKPIGDF
RFCS_PYRCJ      ------------------------------------------------------RERVKEFARTAPVAPF
RFCS_METVS      --------------------------------------------------IDVIRTKVKDFARTKPIGDF
RFCS_METM7      --------------------------------------------------IDVIRTKVKDFARTKPIGDF
RFCS_METHJ      --------------------------------------------------IDVVRNQIKQFARTSPFGGF
RFC4_CAEEL      ----------------------------------------------------------------------
RFCS_AERPE      ---------------------------------------------------------------------F
RFCS2_PYRAR     ELYGEYWRENTLELNAS----------------------DERGI--NVI-----RERVKEFARTAPVAPF
RFCS_METAC      --------------------------------------------------IDIVRNKIKNFAKTAPIGGF
RFCS_METBF      --------------------------------------------------IDVVRTKIKNFAKTAPMGGF
Y007_MYCPN      ----------------------------------------------------------------------
RFCS2_PYRIL     ---------------------------------TLELNASDERGI-NVI-----RERVKEFARTAPVAPF
RFCS2_PYRAE     ---------------------------------TLELNASDERGI-NVI-----RERVKEFARTAPVAPF
HOLB_HAEIN      ------------------------------------------------IGVDQVRDINEMVAQHAQQNGN
RFCS_METMA      --------------------------------------------------IDIVRNKIKNFAKTAPMGGF
RFC5_NEUCR      PGVEKIKIDARVFQTSSN---RKLEFNIVASVYHLEITPSDVGNYDRVVVQDLLKEVAQTQQDLSAKQRF
RFC3_BOVIN      -----------------------IASNYHLEVNPSDAGNSDRVVIQEMLTVAQSQQL-----ETSSQKDF
RFCS_THEPD      ---------------------------------------------------------------------F
RFCS_PICTO      --------------------------------------------------------------------GF
RFCS_METST      --------------------------------------------------IDTVRNEIKSFCKLKAVGAF
RFC3_MOUSE      -----------------------IASNYHLEVNPSDAGNSDRVVIQEMLTVAQSQQL-----ETSSQRDF
RFCS_THEVO      --------------------------------------------------------------------GF
RFCS_THEAC      --------------------------------------------------------------------GF
RFCS_HALMA      --------------------------------------------------IDVVRDRIKNFARTSGVE-Y
RFCS_METKA      --------------------------------------------------IDVIRTKVKNFARTRPMGGF
RFCS_HALSA      --------------------------------------------------IDVVRDRIKDFASSFGGHNY
RFCS_HALS3      --------------------------------------------------IDVVRDRIKDFASSFGGHNY
RFC3_HUMAN      -----------------------IASNYHLEVNPSDAGNSDRVVIQEMLTVAQSQQL-----ETNSQRDF
SYC_GEOSW       QIDPQVLRFFMLSVHYRHPISEELLESAKKGLERLKTSFNLKHRLQSSTNLTDDDDQ-----WLARIQEQ
RFCS_NATPD      --------------------------------------------------IDVVRDRIKSF-ARASFGGY
RFC4_ENCCU      --------------------------------------------------IDTVRTTIKSFAQRRVKDEF
RFC2_DROME      SYKEAV-----LELNASN-----------------ERGID---VVRNKIKMFAQQKV------TLPRGRH
RFCS_METTH      ---------------------------------------------------------------------F
RFCS_HALWD      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPARVLPTIQSRCRKLMLRPXXXXXXXXXXXXX
HOLB_PSEAE      KVVLLEPAEAMNVNAANALLKSLEEPSGDTVLLLISHQPSRLLPTIKSRC--------------------
DPO3X_MYCTU     RVFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLPTIRSR---------------------
DPO3X_MYCBO     RVFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLPTIRSR---------------------
DPO3X_BUCAP     KVYLIDEVHMLSRHSFNALLKTLEEPPQHIKFILATTDVEKIPKTIRSRC--------------------
DPO3X_BUCAI     KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFVLATTDVDRIPKTIISRC--------------------
DPO3X_HAEIN     KVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKALDETQISQHLAHI
DPO3X_BACSU     KVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIPLTIISRCQR------------------
DPO3X_BUCBP     KIYLIDEVHMLSRYSFNFLLKNIEEPPQHIKFILATTNLEKIPDTILSRCLQFQLKP-------------
DPO3X_ECOLI     KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
HOLB_YERPE      KVVWLPHAEVLTDAAANALLKTLEEPPEKTYFLLDCHQPASLLATLRSRC--------------------
DPO3X_SALTY     KVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
HOLB_BACSU      KLYIISHADQMTANAANSLLKFLEEPNKDTMAVLITEQPQRLLDTIISRCQTLPFQP-------------
HOLB_ECOLI      KVVWVXXXXXXXXXXXXXXXXXXEEPPAETWFFLATREPERLLATLRSRCRLHYLAP-------------
HOLB_BUCBP      KIVYIPNIKKLTEFAINSLLKIIEEPPQNTYFLLINYLPHKIITTLRSRC--------------------
RFC5_MOUSE      KLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGP-------------
RFC5_HUMAN      KLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGP-------------
RFC3_SCHPO      KMIILDEADAMTLAAQNALRRVIEKYTKNVRFCIICNYINKISPAIQSRCTRFRFQP-------------
HOLB_BUCAP      KIIFLPNVHKLTESAVNALLKILEEPPEKNWFFLIDYNYLKLHSTLKSRC--------------------
RFC3_YEAST      KLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQP-------------
RFC5_CAEEL      KLVILDEADAMTKDAQNALRRVIEKYTDNVRFCIICNYLASIVPAIQSRCTRFRFAP-------------
RFC3_ARXAD      KLVILDEADAMTNAAQNALRRIIEKYSAHTRFCILANYTHKLNPALLSRCTRFRFSP-------------
RFCS1_PYRAR     KLVILDEADNMTSDAQQALRRIMEMYAQNTRFILLANYVSRIIDPIISRCAVFRFSP-------------
RFCS_STAMF      KIVLLDEADNMTADAQQALRRLMEMYTATTRFILIANYPSKIIEPIQSRCAVFRFAP-------------
RFCS1_PYRIL     KLVILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYVSRIIDPIISRCAVFRFSP-------------
RFCS1_PYRAE     KLVILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYVSRIIDPIISRCAVFRFSP-------------
RFC5_DICDI      KLIILDEADSMTNIAQTALRRVIEKYTKTTRFCIVCNYVIKIIPALQSRCTRFRFSP-------------
HOLB_BUCAI      KIIFLSDTGKLTESAINAFLKTLEEPPRKTWFFLVNYKNLNSHSTLNSRC--------------------
RFCS_METMP      KVIFLDESDALTSDAQNALRRTMEKYSDICRFILSCNYPSKIIPPIQSRCAIFRFSP-------------
RFCS_METM6      KVIFLDESDALTSDAQNALRRTMEKYSDICRFILSCNYPSKIIPPIQSRCAIFRFSP-------------
RFCS_METM5      KVIFLDESDALTSDAQNALRRTMEKYSDICRFILSCNYPSKIIPPIQSRCAIFRFSP-------------
RFCS_PYRCJ      KLVILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYVSRIIDPIISRCAVFRFSP-------------
RFCS_METVS      KVIFLDESDALTSDAQNALRRTMEKYSDICRFVLSCNYPSKIIPPIQSRCAIFRFSP-------------
RFCS_METM7      KVIFLDESDALTSDAQNALRRTMEKYSDICRFVLSCNYPSKIIPPIQSRCAIFRFSP-------------
RFCS_METHJ      KILFLDEADALTTDAQSALRRTMETYAQTCRFILSCNYSAKIIDPIQSRCAIYRFRP-------------
RFC4_CAEEL      KIIILDEVDAMTREAQAAMRRVIEDFSKTTRFILICNYVSRLIPPVVSRCAKFRFK--------------
RFCS_AERPE      KIVLLDEADNMTSDAQQALRRLMELYSSVTRFILIANYPSKIIDPIQSRCAFFRFQP-------------
RFCS2_PYRAR     KLVILDEADNMTSDAQQALRRIMEMYAQNTRFILLANYISGIIEPIQSRTVMIRFSP-------------
RFCS_METAC      KIIFLDEADALTADAQSALRRTMERFSSNCRFILSCNYSSKIIEPIQSRC--------------------
RFCS_METBF      KIIFLDEADALTSDAQSALRRTMERFSNNCRFILSCNYSSRIIEPIQSRCAVFRFR--------------
Y007_MYCPN      ---LIKNLETLTATAMNSLLRLIEEHPVNTYGVFTTKNENMILPTILSRVQKVVLK--------------
RFCS2_PYRIL     KLVILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYISGIIEPIQSRVVMIRFNP-------------
RFCS2_PYRAE     KLVILDEADNMTSDAQQALRRIMEIYAQNTRFILLANYVSGIIEPIQSRTVMIRFSP-------------
HOLB_HAEIN      KVVYVQGAERLTEAAANALLKTLEEPRPNTYFXXXXXXXXXXXXTIYSRCQ-------------------
RFCS_METMA      KIIFLDEADALTSDAQSALRRTMEKFSSNCRFILSCNYSSKIIEPIQSRC--------------------
RFC5_NEUCR      KVVVINEADHLTRDAQAALRRTMEKYSPNLRLILLANSTANIIAPIRSRC--------------------
RFC3_BOVIN      KVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRC--------------------
RFCS_THEPD      KLVILDEADNMTGDAQQALRRTMELFSRNTRFILIANYASKIIEPIQSRCAVFRFQP-------------
RFCS_PICTO      KIIFLDEADQLTNEAQAALRRTMEMFYSTTRFIFSCNYSSKIIPPIQSRCVVLRFRP-------------
RFCS_METST      RIIFLDEVDNMTKDAQQALRREMEMYTKTSSFILSCNYSSKIIDPIQSRCAIFRFSP-------------
RFC3_MOUSE      KVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRC--------------------
RFCS_THEVO      KILFLDEADQLTAEAQAALRRTMEMYSETTRFVFACNYSSKIIPPIQSRTVVMRFRP-------------
RFCS_THEAC      KILFLDEADQLTAEAQAALRRTMEIYSETTRFIFSCNYSSKIIPPIQSRTVVMRFRP-------------
RFCS_HALMA      RIIFLDEADALTSDAQSALRRTMEQFSNNVRFILSCNYSSQIIDPIQSRCAVFRFSP-------------
RFCS_METKA      KIIFLDEADNLTRDSQQALRRIMEMYSDACRFILAANYSSAIIDPIQSRC--------------------
RFCS_HALSA      RVIFLDEADALTDDAQSALRRTMEQFSNNTRFILSCNYSSKIIDPIQSRC--------------------
RFCS_HALS3      RVIFLDEADALTDDAQSALRRTMEQFSNNTRFILSCNYSSKIIDPIQSRC--------------------
RFC3_HUMAN      KVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRC--------------------
SYC_GEOSW       HEAFIREMDD-DFNTANGIAVLFELSKQANLYLLEKNTSERVI---------------------------
RFCS_NATPD      RIIFLDEADALTSDAQSALRRTMEQFSDNTRFILSCNYSSQIIDPIQSRCAVFRFSP-------------
RFC4_ENCCU      KIIILDEADSMTTTAQQAMRRVMEIHSSECRFILICNVFTKIFEPIQSRC--------------------
RFC2_DROME      KIVILDEADSMTEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAML-----------------
RFCS_METTH      RIIFLDEVDNMTKDAQHALRREMEMYTKTSSFILSCNYSSKIIDPIQSRC--------------------
RFCS_HALWD      RIIFLDEADSLTDDAQSALRRTMEQFADNTRFILSCNYSSKIIDPIQSRCAVFRFSP-------------


                         .         .         .         +         .         .         .:280
query           XXXXPGDPKLADAAAASEGSVSRXXXXXXXXXXXXHQKTTALLDSLPNVDPRALHALGESIGGTDRATLA
HOLB_PSEAE      ----------------------------------------------------------------------
DPO3X_MYCTU     ----------------------------------------------------------------------
DPO3X_MYCBO     ----------------------------------------------------------------------
DPO3X_BUCAP     ----------------------------------------------------------------------
DPO3X_BUCAI     ----------------------------------------------------------------------
DPO3X_HAEIN     LTQENEDPALVKLAKAAQGSIRDSLSLTDQAIAMGDRQVTGLLDDNYSVD--ILYALHQGNGELLMRTLQ
DPO3X_BACSU     ----------------------------------------------------------------------
DPO3X_BUCBP     ----------------------------------------------------------------------
DPO3X_ECOLI     ----------------------------------------------------------------------
HOLB_YERPE      ----------------------------------------------------------------------
DPO3X_SALTY     ----------------------------------------------------------------------
HOLB_BACSU      ----------------------------------------------------------------------
HOLB_ECOLI      ----------------------------------------------------------------------
HOLB_BUCBP      ----------------------------------------------------------------------
RFC5_MOUSE      ----------------------------------------------------------------------
RFC5_HUMAN      ----------------------------------------------------------------------
RFC3_SCHPO      ----------------------------------------------------------------------
HOLB_BUCAP      ----------------------------------------------------------------------
RFC3_YEAST      ----------------------------------------------------------------------
RFC5_CAEEL      ----------------------------------------------------------------------
RFC3_ARXAD      ----------------------------------------------------------------------
RFCS1_PYRAR     ----------------------------------------------------------------------
RFCS_STAMF      ----------------------------------------------------------------------
RFCS1_PYRIL     ----------------------------------------------------------------------
RFCS1_PYRAE     ----------------------------------------------------------------------
RFC5_DICDI      ----------------------------------------------------------------------
HOLB_BUCAI      ----------------------------------------------------------------------
RFCS_METMP      ----------------------------------------------------------------------
RFCS_METM6      ----------------------------------------------------------------------
RFCS_METM5      ----------------------------------------------------------------------
RFCS_PYRCJ      ----------------------------------------------------------------------
RFCS_METVS      ----------------------------------------------------------------------
RFCS_METM7      ----------------------------------------------------------------------
RFCS_METHJ      ----------------------------------------------------------------------
RFC4_CAEEL      ----------------------------------------------------------------------
RFCS_AERPE      ----------------------------------------------------------------------
RFCS2_PYRAR     ----------------------------------------------------------------------
RFCS_METAC      ----------------------------------------------------------------------
RFCS_METBF      ----------------------------------------------------------------------
Y007_MYCPN      ----------------------------------------------------------------------
RFCS2_PYRIL     ----------------------------------------------------------------------
RFCS2_PYRAE     ----------------------------------------------------------------------
HOLB_HAEIN      ----------------------------------------------------------------------
RFCS_METMA      ----------------------------------------------------------------------
RFC5_NEUCR      ----------------------------------------------------------------------
RFC3_BOVIN      ----------------------------------------------------------------------
RFCS_THEPD      ----------------------------------------------------------------------
RFCS_PICTO      ----------------------------------------------------------------------
RFCS_METST      ----------------------------------------------------------------------
RFC3_MOUSE      ----------------------------------------------------------------------
RFCS_THEVO      ----------------------------------------------------------------------
RFCS_THEAC      ----------------------------------------------------------------------
RFCS_HALMA      ----------------------------------------------------------------------
RFCS_METKA      ----------------------------------------------------------------------
RFCS_HALSA      ----------------------------------------------------------------------
RFCS_HALS3      ----------------------------------------------------------------------
RFC3_HUMAN      ----------------------------------------------------------------------
SYC_GEOSW       ----------------------------------------------------------------------
RFCS_NATPD      ----------------------------------------------------------------------
RFC4_ENCCU      ----------------------------------------------------------------------
RFC2_DROME      ----------------------------------------------------------------------
RFCS_METTH      ----------------------------------------------------------------------
RFCS_HALWD      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AFVDGVDRWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HOLB_PSEAE      ------------------------------------------------------------------
DPO3X_MYCTU     ------------------------------------------------------------------
DPO3X_MYCBO     ------------------------------------------------------------------
DPO3X_BUCAP     ------------------------------------------------------------------
DPO3X_BUCAI     ------------------------------------------------------------------
DPO3X_HAEIN     RVADAAGDW---------------------------------------------------------
DPO3X_BACSU     ------------------------------------------------------------------
DPO3X_BUCBP     ------------------------------------------------------------------
DPO3X_ECOLI     ------------------------------------------------------------------
HOLB_YERPE      ------------------------------------------------------------------
DPO3X_SALTY     ------------------------------------------------------------------
HOLB_BACSU      ------------------------------------------------------------------
HOLB_ECOLI      ------------------------------------------------------------------
HOLB_BUCBP      ------------------------------------------------------------------
RFC5_MOUSE      ------------------------------------------------------------------
RFC5_HUMAN      ------------------------------------------------------------------
RFC3_SCHPO      ------------------------------------------------------------------
HOLB_BUCAP      ------------------------------------------------------------------
RFC3_YEAST      ------------------------------------------------------------------
RFC5_CAEEL      ------------------------------------------------------------------
RFC3_ARXAD      ------------------------------------------------------------------
RFCS1_PYRAR     ------------------------------------------------------------------
RFCS_STAMF      ------------------------------------------------------------------
RFCS1_PYRIL     ------------------------------------------------------------------
RFCS1_PYRAE     ------------------------------------------------------------------
RFC5_DICDI      ------------------------------------------------------------------
HOLB_BUCAI      ------------------------------------------------------------------
RFCS_METMP      ------------------------------------------------------------------
RFCS_METM6      ------------------------------------------------------------------
RFCS_METM5      ------------------------------------------------------------------
RFCS_PYRCJ      ------------------------------------------------------------------
RFCS_METVS      ------------------------------------------------------------------
RFCS_METM7      ------------------------------------------------------------------
RFCS_METHJ      ------------------------------------------------------------------
RFC4_CAEEL      ------------------------------------------------------------------
RFCS_AERPE      ------------------------------------------------------------------
RFCS2_PYRAR     ------------------------------------------------------------------
RFCS_METAC      ------------------------------------------------------------------
RFCS_METBF      ------------------------------------------------------------------
Y007_MYCPN      ------------------------------------------------------------------
RFCS2_PYRIL     ------------------------------------------------------------------
RFCS2_PYRAE     ------------------------------------------------------------------
HOLB_HAEIN      ------------------------------------------------------------------
RFCS_METMA      ------------------------------------------------------------------
RFC5_NEUCR      ------------------------------------------------------------------
RFC3_BOVIN      ------------------------------------------------------------------
RFCS_THEPD      ------------------------------------------------------------------
RFCS_PICTO      ------------------------------------------------------------------
RFCS_METST      ------------------------------------------------------------------
RFC3_MOUSE      ------------------------------------------------------------------
RFCS_THEVO      ------------------------------------------------------------------
RFCS_THEAC      ------------------------------------------------------------------
RFCS_HALMA      ------------------------------------------------------------------
RFCS_METKA      ------------------------------------------------------------------
RFCS_HALSA      ------------------------------------------------------------------
RFCS_HALS3      ------------------------------------------------------------------
RFC3_HUMAN      ------------------------------------------------------------------
SYC_GEOSW       ------------------------------------------------------------------
RFCS_NATPD      ------------------------------------------------------------------
RFC4_ENCCU      ------------------------------------------------------------------
RFC2_DROME      ------------------------------------------------------------------
RFCS_METTH      ------------------------------------------------------------------
RFCS_HALWD      ------------------------------------------------------------------