[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39967.1

[Show Plain Result]


## Summary of Sequence Search
    1::139
    1::102     1e-07  28%  102 aa  HVRA_RHOCA RecName: Full=Trans-acting regulatory protein hvrA;
   63::134     1e-06  36%  134 aa  STPA_SHIFL RecName: Full=DNA-binding protein stpA;AltName:
   63::134     1e-06  36%  134 aa  STPA_ECOLI RecName: Full=DNA-binding protein stpA;AltName:
   63::134     1e-06  36%  134 aa  STPA_ECO57 RecName: Full=DNA-binding protein stpA;AltName:
   79::133     2e-05  40%  133 aa  STPA_SALTY RecName: Full=DNA-binding protein stpA;AltName:
   79::133     2e-05  40%  133 aa  STPA_SALTI RecName: Full=DNA-binding protein stpA;AltName:
   83::136     7e-04  38%  137 aa  HNS_SHIFL RecName: Full=DNA-binding protein H-NS;AltName:
   83::136     7e-04  38%  137 aa  HNS_ECOLI RecName: Full=DNA-binding protein H-NS;AltName:
   83::136     7e-04  38%  137 aa  HNS_ECOL6 RecName: Full=DNA-binding protein H-NS;AltName:
   83::136     7e-04  38%  137 aa  HNS_ECO57 RecName: Full=DNA-binding protein H-NS;AltName:
    1::139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxIDPDAMTVDELWEIHERISQVLCSKIQSEQRKLDGHLSRLRLGVTSGANQ
HVRA_RHOCA      --------------------MDIDALSLNELKALRSKVDRAIVTYEERKKKEAFAELDEIKMGYPLA---
STPA_SHIFL      ------------------------------------------------ELMKADGINPEELLGNSSAAAP
STPA_ECOLI      ------------------------------------------------ELMKADGINPEELLGNSSAAAP
STPA_ECO57      ------------------------------------------------ELMKADGINPEELLGNSSAAAP
STPA_SALTY      ----------------------------------------------------------------------
STPA_SALTI      ----------------------------------------------------------------------
HNS_SHIFL       ----------------------------------------------------------------------
HNS_ECOLI       ----------------------------------------------------------------------
HNS_ECOL6       ----------------------------------------------------------------------
HNS_ECO57       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QSDDESGPKPARRPYPKVYPKYRSLKDPSLTWAGRGKQPLWLIDELKSGKSIDDFLIRxxxxxxxxxxx
HVRA_RHOCA      ----EILTMVETKPRKTVAAKYANPANPSETWTGRGRKPKWVEAALASGKSLEDLTI------------
STPA_SHIFL      RAGKKRQPRPAKY-------KFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI------------
STPA_ECOLI      RAGKKRQPRPAKY-------KFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI------------
STPA_ECO57      RAGKKRQPRPAKY-------KFTDVNGETKTWTGQGRTPKPIAQALAEGKSLDDFLI------------
STPA_SALTY      ---DSAMPRSARQPRPAKY-RFTDFNGEEKTWTGQGRTPKPIAQALAAGKSLDDFLI------------
STPA_SALTI      ---DSAMPRSARQPRPAKY-RFTDFNGEEKTWTGQGRTPKPIAQALAAGKSLDDFLI------------
HNS_SHIFL       ----KSGTKAKRAQRPAKY-SYVDENGETKTWTGQGRTPAVIKKAMEQGKSLDDFLIK-----------
HNS_ECOLI       ----KSGTKAKRAQRPAKY-SYVDENGETKTWTGQGRTPAVIKKAMEQGKSLDDFLIK-----------
HNS_ECOL6       ----KSGTKAKRAQRPAKY-SYVDENGETKTWTGQGRTPAVIKKAMEQGKSLDDFLIK-----------
HNS_ECO57       ----KSGTKAKRAQRPAKY-SYVDENGETKTWTGQGRTPAVIKKAMEQGKSLDDFLIK-----------