[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE40018.1

[Show Plain Result]


## Summary of Sequence Search
    1::79
    1::79      5e-42 100%   79 aa  TATA_RHOPS RecName: Full=Sec-independent protein translocase
    1::79      7e-38  91%   79 aa  TATA_RHOP2 RecName: Full=Sec-independent protein translocase
    1::78      7e-35  90%   78 aa  TATA_RHOPT RecName: Full=Sec-independent protein translocase
    1::78      7e-35  90%   78 aa  TATA_RHOPA RecName: Full=Sec-independent protein translocase
    1::76      7e-35  87%   79 aa  TATA_NITHX RecName: Full=Sec-independent protein translocase
    1::77      4e-33  86%   77 aa  TATA_BRASO RecName: Full=Sec-independent protein translocase
    1::77      4e-33  86%   77 aa  TATA_BRASB RecName: Full=Sec-independent protein translocase
    1::78      1e-32  78%   78 aa  TATA_NITWN RecName: Full=Sec-independent protein translocase
    1::78      6e-32  82%   78 aa  TATA_RHOPB RecName: Full=Sec-independent protein translocase
    1::78      4e-30  78%   78 aa  TATA_RHOP5 RecName: Full=Sec-independent protein translocase
    1::77      1e-25  76%   77 aa  TATA_BRAJA RecName: Full=Sec-independent protein translocase
    1::64      8e-21  67%   68 aa  TATA_RHIME RecName: Full=Sec-independent protein translocase
    1::67      8e-21  65%   71 aa  TATA_AGRVS RecName: Full=Sec-independent protein translocase
    1::65      8e-21  72%   69 aa  TATA_AGRRK RecName: Full=Sec-independent protein translocase
    1::64      3e-20  65%   68 aa  TATA_SINMW RecName: Full=Sec-independent protein translocase
    1::43      8e-20  95%   78 aa  TATA_XANP2 RecName: Full=Sec-independent protein translocase
    1::75      1e-19  67%   82 aa  TATA_METSB RecName: Full=Sec-independent protein translocase
    1::63      2e-19  60%   76 aa  TATA_OCHA4 RecName: Full=Sec-independent protein translocase
    1::43      2e-19  91%   75 aa  TATA_AZOC5 RecName: Full=Sec-independent protein translocase
    1::47      7e-19  72%   90 aa  TATA_METRJ RecName: Full=Sec-independent protein translocase
    1::59      9e-19  61%   73 aa  TATA_RHILO RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUSU RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUSI RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUME RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUMB RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUC2 RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUAB RecName: Full=Sec-independent protein translocase
    1::59      2e-18  68%   72 aa  TATA_BRUA1 RecName: Full=Sec-independent protein translocase
    1::69      8e-18  57%   90 aa  TATA_METNO RecName: Full=Sec-independent protein translocase
    1::48      3e-17  69%   88 aa  TATA_METS4 RecName: Full=Sec-independent protein translocase
    1::59      3e-16  59%   63 aa  TATA_RHIE6 RecName: Full=Sec-independent protein translocase
    1::49      7e-16  63%   87 aa  TATA_ZYMMO RecName: Full=Sec-independent protein translocase
    1::59      7e-16  58%   63 aa  TATA_RHILW RecName: Full=Sec-independent protein translocase
    1::59      7e-16  58%   63 aa  TATA_RHIL3 RecName: Full=Sec-independent protein translocase
    1::59      7e-16  58%   63 aa  TATA_RHIEC RecName: Full=Sec-independent protein translocase
    1::66      1e-15  54%   70 aa  TATA_AGRT5 RecName: Full=Sec-independent protein translocase
    1::64      1e-15  52%   68 aa  TATA_RHISN RecName: Full=Sec-independent protein translocase
    1::83      1e-14  51%   91 aa  TATA_METPB RecName: Full=Sec-independent protein translocase
    1::71      1e-14  51%   77 aa  TATA_SPHAL RecName: Full=Sec-independent protein translocase
    1::52      5e-14  57%   70 aa  TATA_PHEZH RecName: Full=Sec-independent protein translocase
    1::78      1e-13  52%   95 aa  TATA_METC4 RecName: Full=Sec-independent protein translocase
    1::55      1e-13  53%   71 aa  TATA_MESSB RecName: Full=Sec-independent protein translocase
    1::51      3e-13  51%   85 aa  TATA_SPHWW RecName: Full=Sec-independent protein translocase
    1::59      3e-13  52%   74 aa  TATA_CAUCR RecName: Full=Sec-independent protein translocase
    1::59      3e-13  52%   74 aa  TATA_CAUCN RecName: Full=Sec-independent protein translocase
    1::69      4e-13  46%   95 aa  TATA_METEP RecName: Full=Sec-independent protein translocase
    3::75      1e-12  51%   78 aa  TATA_OLICO RecName: Full=Sec-independent protein translocase
    1::61      2e-12  47%   75 aa  TATA_STRM5 RecName: Full=Sec-independent protein translocase
    1::59      2e-12  41%   76 aa  TATA_NITEU RecName: Full=Sec-independent protein translocase
    1::48      3e-12  50%   75 aa  TATA_STRMK RecName: Full=Sec-independent protein translocase
    1::76      4e-12  38%   79 aa  TATA_DELAS RecName: Full=Sec-independent protein translocase
    1::79      4e-12  39%   82 aa  TATA_ACISJ RecName: Full=Sec-independent protein translocase
    1::55      8e-12  44%   77 aa  TATA_NITEC RecName: Full=Sec-independent protein translocase
    1::63      8e-12  43%   77 aa  TATA_JANMA RecName: Full=Sec-independent protein translocase
    1::79      1e-11  38%   82 aa  TATA_DIAST RecName: Full=Sec-independent protein translocase
    1::72      1e-11  41%   76 aa  TATA_BURM1 RecName: Full=Sec-independent protein translocase
    1::62      2e-11  43%   76 aa  TATA_HERAR RecName: Full=Sec-independent protein translocase
    1::59      2e-11  39%   76 aa  TATA_CUPTR RecName: Full=Sec-independent protein translocase
    1::57      3e-11  44%   77 aa  TATA_RALEH RecName: Full=Sec-independent protein translocase
    1::68      4e-11  43%   71 aa  TATA_CAMFF RecName: Full=Sec-independent protein translocase
    1::77      4e-11  36%   77 aa  TATA_BURTA RecName: Full=Sec-independent protein translocase
    1::50      4e-11  44%   79 aa  TATA_BURPP RecName: Full=Sec-independent protein translocase
    1::47      4e-11  47%   78 aa  TATA_BURP8 RecName: Full=Sec-independent protein translocase
    1::43      5e-11  58%   96 aa  TATA_RHORT RecName: Full=Sec-independent protein translocase
    1::61      5e-11  39%   76 aa  TATA_DECAR RecName: Full=Sec-independent protein translocase
    1::72      5e-11  40%   76 aa  TATA_BURS3 RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURPS RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURP6 RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURP1 RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURP0 RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURMS RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURMA RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURM9 RecName: Full=Sec-independent protein translocase
    1::73      5e-11  34%   77 aa  TATA_BURM7 RecName: Full=Sec-independent protein translocase
    1::72      5e-11  40%   76 aa  TATA_BURCJ RecName: Full=Sec-independent protein translocase
    1::72      5e-11  40%   76 aa  TATA_BURCH RecName: Full=Sec-independent protein translocase
    1::72      5e-11  40%   76 aa  TATA_BURCC RecName: Full=Sec-independent protein translocase
    1::72      5e-11  40%   76 aa  TATA_BURCA RecName: Full=Sec-independent protein translocase
    1::51      7e-11  43%   75 aa  TATA_BORPE RecName: Full=Sec-independent protein translocase
    1::62      7e-11  42%   75 aa  TATA_BORPD RecName: Full=Sec-independent protein translocase
    1::51      7e-11  43%   75 aa  TATA_BORPA RecName: Full=Sec-independent protein translocase
    1::51      7e-11  43%   75 aa  TATA_BORBR RecName: Full=Sec-independent protein translocase
    1::51      1e-10  41%   76 aa  TATA_BURVG RecName: Full=Sec-independent protein translocase
    1::51      1e-10  41%   76 aa  TATA_BURCM RecName: Full=Sec-independent protein translocase
    1::51      1e-10  41%   76 aa  TATA_BURA4 RecName: Full=Sec-independent protein translocase
    1::60      2e-10  42%   73 aa  TATA_POLSQ RecName: Full=Sec-independent protein translocase
    1::48      2e-10  57%   88 aa  TATA_GLUDA RecName: Full=Sec-independent protein translocase
    1::50      2e-10  44%   79 aa  TATA_BURXL RecName: Full=Sec-independent protein translocase
    1::72      2e-10  44%   73 aa  TATA_POLNS RecName: Full=Sec-independent protein translocase
    2::58      2e-10  51%   66 aa  TATA_PELUB RecName: Full=Sec-independent protein translocase
    1::51      3e-10  44%   73 aa  TATA_RALEJ RecName: Full=Sec-independent protein translocase
    1::45      3e-10  42%   83 aa  TATA_POLSJ RecName: Full=Sec-independent protein translocase
    1::80      3e-10  35%   84 aa  TATA_POLNA RecName: Full=Sec-independent protein translocase
    1::51      4e-10  37%   85 aa  TATA_RALPJ RecName: Full=Sec-independent protein translocase
   20::66      4e-10  51%   80 aa  TATA_ERYLH RecName: Full=Sec-independent protein translocase
    1::45      4e-10  44%   71 aa  TATA_BORA1 RecName: Full=Sec-independent protein translocase
    1::60      5e-10  37%   77 aa  TATA_RALME RecName: Full=Sec-independent protein translocase
    1::45      5e-10  42%   87 aa  TATA_ACIAC RecName: Full=Sec-independent protein translocase
    1::45      6e-10  38%   85 aa  TATA_RALSO RecName: Full=Sec-independent protein translocase
    1::45      1e-09  49%   73 aa  TATA_CAMC1 RecName: Full=Sec-independent protein translocase
    1::44      2e-09  43%   77 aa  TATA_AZOSB RecName: Full=Sec-independent protein translocase
    1::68      5e-09  43%   82 aa  TATA_MYCVP RecName: Full=Sec-independent protein translocase
    1::76      5e-09  43%   79 aa  TATA_MYCSS RecName: Full=Sec-independent protein translocase
    1::76      5e-09  43%   79 aa  TATA_MYCSK RecName: Full=Sec-independent protein translocase
    1::76      5e-09  43%   79 aa  TATA_MYCSJ RecName: Full=Sec-independent protein translocase
    1::44      5e-09  58%   81 aa  TATA_BEII9 RecName: Full=Sec-independent protein translocase
    1::47      9e-09  47%   83 aa  TATA_NOVAD RecName: Full=Sec-independent protein translocase
    1::71      9e-09  35%   81 aa  TATA_MYCS2 RecName: Full=Sec-independent protein translocase
    1::82      1e-08  43%   93 aa  TATA_MYCPA RecName: Full=Sec-independent protein translocase
    1::58      1e-08  42%   84 aa  TATA_MYCGI RecName: Full=Sec-independent protein translocase
    1::82      1e-08  43%   93 aa  TATA_MYCA1 RecName: Full=Sec-independent protein translocase
    1::52      2e-08  40%   75 aa  TATA_XANCP RecName: Full=Sec-independent protein translocase
    1::52      2e-08  40%   75 aa  TATA_XANCB RecName: Full=Sec-independent protein translocase
    1::52      2e-08  40%   75 aa  TATA_XANC8 RecName: Full=Sec-independent protein translocase
    1::64      2e-08  43%   83 aa  TATA_MYCTU RecName: Full=Sec-independent protein translocase
    1::64      2e-08  43%   83 aa  TATA_MYCTA RecName: Full=Sec-independent protein translocase
    1::64      2e-08  43%   83 aa  TATA_MYCBT RecName: Full=Sec-independent protein translocase
    1::64      2e-08  43%   83 aa  TATA_MYCBP RecName: Full=Sec-independent protein translocase
    1::64      2e-08  43%   83 aa  TATA_MYCBO RecName: Full=Sec-independent protein translocase
    1::47      2e-08  52%   74 aa  TATA_CAUSK RecName: Full=Sec-independent protein translocase
    1::57      3e-08  42%   58 aa  TATA_FLAPJ RecName: Full=Sec-independent protein translocase
    1::73      4e-08  33%   88 aa  TATA_MYCUA RecName: Full=Sec-independent protein translocase
    1::73      4e-08  33%   88 aa  TATA_MYCMM RecName: Full=Sec-independent protein translocase
    1::52      6e-08  38%   75 aa  TATA_XANOP RecName: Full=Sec-independent protein translocase
    1::52      6e-08  38%   75 aa  TATA_XANOM RecName: Full=Sec-independent protein translocase
    1::52      6e-08  38%   75 aa  TATA_XANC5 RecName: Full=Sec-independent protein translocase
    1::52      6e-08  38%   75 aa  TATA_XANAC RecName: Full=Sec-independent protein translocase
    1::51      7e-08  39%   75 aa  TATA_AZOSE RecName: Full=Sec-independent protein translocase
    1::54      2e-07  35%   70 aa  TATA_THIDA RecName: Full=Sec-independent protein translocase
    1::65      2e-07  37%   68 aa  TATA_CHRVO RecName: Full=Sec-independent protein translocase
    1::49      2e-07  37%   82 aa  TATA_VARPS RecName: Full=Sec-independent protein translocase
    4::82      2e-07  28%   82 aa  TATA_PSEHT RecName: Full=Sec-independent protein translocase
    1::73      6e-07  33%   76 aa  TATA_METPP RecName: Full=Sec-independent protein translocase
   21::44      6e-07  75%  103 aa  TATA_BARQU RecName: Full=Sec-independent protein translocase
   21::44      6e-07  75%  103 aa  TATA_BARHE RecName: Full=Sec-independent protein translocase
    1::45      8e-07  36%   74 aa  TATA_VEREI RecName: Full=Sec-independent protein translocase
    1::63      8e-07  33%   87 aa  TATA_PSYA2 RecName: Full=Sec-independent protein translocase
    1::69      8e-07  41%   84 aa  TATA_GLUOX RecName: Full=Sec-independent protein translocase
    1::49      1e-06  41%   91 aa  TATA_RHOSR RecName: Full=Sec-independent protein translocase
    1::49      1e-06  41%   93 aa  TATA_RHOOB RecName: Full=Sec-independent protein translocase
    1::49      1e-06  41%   98 aa  TATA_RHOER RecName: Full=Sec-independent protein translocase
    1::55      1e-06  33%   73 aa  TATA_LARHH RecName: Full=Sec-independent protein translocase
    3::48      2e-06  37%   51 aa  TATA_RICBR RecName: Full=Sec-independent protein translocase
    1::72      5e-06  29%   81 aa  TATA_VIBPA RecName: Full=Sec-independent protein translocase
    1::63      5e-06  33%   74 aa  TATA_NITMU RecName: Full=Sec-independent protein translocase
    1::65      7e-06  34%   89 aa  TATA_SHIFL RecName: Full=Sec-independent protein translocase
    1::65      7e-06  34%   89 aa  TATA_ECOLI RecName: Full=Sec-independent protein translocase
    1::65      7e-06  34%   89 aa  TATA_ECOL6 RecName: Full=Sec-independent protein translocase
    1::65      7e-06  34%   89 aa  TATA_ECO57 RecName: Full=Sec-independent protein translocase
    1::74      1e-05  29%   78 aa  TATA_VIBVU RecName: Full=Sec-independent protein translocase
    1::77      2e-05  33%   83 aa  TATA_SHEWM RecName: Full=Sec-independent protein translocase
   20::64      2e-05  42%   69 aa  TATA_MAGSM RecName: Full=Sec-independent protein translocase
    1::50      2e-05  36%   91 aa  TATA_RHOE4 RecName: Full=Sec-independent protein translocase
    1::74      3e-05  29%   78 aa  TATA_VIBVY RecName: Full=Sec-independent protein translocase
    1::52      3e-05  33%   84 aa  TATA_SALTY RecName: Full=Sec-independent protein translocase
    1::52      3e-05  33%   84 aa  TATA_SALTI RecName: Full=Sec-independent protein translocase
   20::51      3e-05  47%   53 aa  TATA_RICAH RecName: Full=Sec-independent protein translocase
    1::56      3e-05  36%   74 aa  TATA_ACTSZ RecName: Full=Sec-independent protein translocase
    1::65      3e-05  29%   72 aa  TATA_ACIBS RecName: Full=Sec-independent protein translocase
    1::70      3e-05  27%   82 aa  TATA_VIBF1 RecName: Full=Sec-independent protein translocase
    1::48      3e-05  38%   92 aa  TATA_PSEPF RecName: Full=Sec-independent protein translocase
    1::48      3e-05  38%   92 aa  TATA_PSEFS RecName: Full=Sec-independent protein translocase
    1::48      3e-05  38%   93 aa  TATA_PSEF5 RecName: Full=Sec-independent protein translocase
    1::41      6e-05  39%   88 aa  TATA_SODGM RecName: Full=Sec-independent protein translocase
    3::51      6e-05  33%   53 aa  TATA_RICM5 RecName: Full=Sec-independent protein translocase
   20::51      6e-05  47%   53 aa  TATA_RICAE RecName: Full=Sec-independent protein translocase
    1::59      6e-05  33%   67 aa  TATA_NEIMB RecName: Full=Sec-independent protein translocase
    1::59      6e-05  33%   67 aa  TATA_NEIMA RecName: Full=Sec-independent protein translocase
    1::59      6e-05  33%   67 aa  TATA_NEIM0 RecName: Full=Sec-independent protein translocase
    1::59      6e-05  33%   67 aa  TATA_NEIG2 RecName: Full=Sec-independent protein translocase
    1::59      6e-05  33%   67 aa  TATA_NEIG1 RecName: Full=Sec-independent protein translocase
    1::73      6e-05  30%   79 aa  TATA_ALTMD RecName: Full=Sec-independent protein translocase
    2::54      8e-05  35%   55 aa  TATA_WOLTR RecName: Full=Sec-independent protein translocase
    2::54      8e-05  35%   55 aa  TATA_WOLPP RecName: Full=Sec-independent protein translocase
    2::54      8e-05  35%   55 aa  TATA_WOLPM RecName: Full=Sec-independent protein translocase
    3::51      8e-05  33%   53 aa  TATA_RICCN RecName: Full=Sec-independent protein translocase
    1::48      8e-05  35%   91 aa  TATA_PSEU2 RecName: Full=Sec-independent protein translocase
    1::48      8e-05  35%   91 aa  TATA_PSE14 RecName: Full=Sec-independent protein translocase
    1::77      8e-05  34%   86 aa  TATA_PHOLL RecName: Full=Sec-independent protein translocase
    1::52      8e-05  37%   75 aa  TATA_MANSM RecName: Full=Sec-independent protein translocase
   21::40      8e-05  70%  103 aa  TATA_BART1 RecName: Full=Sec-independent protein translocase
    1::65      8e-05  28%   72 aa  TATA_ACIBY RecName: Full=Sec-independent protein translocase
    1::65      8e-05  28%   72 aa  TATA_ACIBT RecName: Full=Sec-independent protein translocase
    1::65      8e-05  28%   72 aa  TATA_ACIBC RecName: Full=Sec-independent protein translocase
    1::65      8e-05  28%   72 aa  TATA_ACIB5 RecName: Full=Sec-independent protein translocase
    1::65      8e-05  28%   72 aa  TATA_ACIB3 RecName: Full=Sec-independent protein translocase
   20::51      1e-04  44%   53 aa  TATA_RICRS RecName: Full=Sec-independent protein translocase
   20::51      1e-04  44%   53 aa  TATA_RICRO RecName: Full=Sec-independent protein translocase
    1::48      1e-04  35%   91 aa  TATA_PSESM RecName: Full=Sec-independent protein translocase
    1::47      1e-04  34%   76 aa  TATA_ACTPJ RecName: Full=Sec-independent protein translocase
    1::47      1e-04  34%   76 aa  TATA_ACTP7 RecName: Full=Sec-independent protein translocase
    1::47      1e-04  34%   76 aa  TATA_ACTP2 RecName: Full=Sec-independent protein translocase
    1::77      2e-04  26%   81 aa  TATA_SHEFN RecName: Full=Sec-independent protein translocase
   20::65      2e-04  33%   67 aa  TATA_ROSS1 RecName: Full=Sec-independent protein translocase
    1::58      2e-04  29%   74 aa  TATA_HAEDU RecName: Full=Sec-independent protein translocase
    1::47      2e-04  32%   82 aa  TATA_VIBFM RecName: Full=Sec-independent protein translocase
    1::78      2e-04  27%   82 aa  TATA_VIBCH RecName: Full=Sec-independent protein translocase
   20::57      2e-04  39%   61 aa  TATA_SYNAS RecName: Full=Sec-independent protein translocase
    1::47      2e-04  32%   82 aa  TATA_ALISL RecName: Full=Sec-independent protein translocase
   12::49      3e-04  42%   87 aa  TATA_TRIEI RecName: Full=Sec-independent protein translocase
    1::56      3e-04  32%   89 aa  TATA_SHEPA RecName: Full=Sec-independent protein translocase
    1::51      3e-04  36%   76 aa  TATA_SHELP RecName: Full=Sec-independent protein translocase
   20::51      3e-04  41%   54 aa  TATA_RICFE RecName: Full=Sec-independent protein translocase
   20::65      3e-04  35%   87 aa  TATA_PHOPR RecName: Full=Sec-independent protein translocase
    1::61      3e-04  33%   76 aa  TATA_PASMU RecName: Full=Sec-independent protein translocase
   20::50      3e-04  42%   60 aa  TATA_HERA2 RecName: Full=Sec-independent protein translocase
    1::48      4e-04  31%   78 aa  TATA_SHESH RecName: Full=Sec-independent protein translocase
    1::48      4e-04  31%   79 aa  TATA_SHEPW RecName: Full=Sec-independent protein translocase
    3::50      4e-04  29%   57 aa  TATA_PSEST RecName: Full=Sec-independent protein translocase
    1::48      4e-04  31%   88 aa  TATA_PROMH RecName: Full=Sec-independent protein translocase
    3::77      4e-04  23%   80 aa  TATA_HAHCH RecName: Full=Sec-independent protein translocase
    1::47      5e-04  32%   79 aa  TATA_SHESW RecName: Full=Sec-independent protein translocase
    1::47      5e-04  32%   79 aa  TATA_SHEPC RecName: Full=Sec-independent protein translocase
    1::53      5e-04  33%   95 aa  TATA_SHEHH RecName: Full=Sec-independent protein translocase
    1::47      5e-04  32%   79 aa  TATA_SHEB9 RecName: Full=Sec-independent protein translocase
    1::47      5e-04  32%   79 aa  TATA_SHEB8 RecName: Full=Sec-independent protein translocase
    1::47      5e-04  32%   79 aa  TATA_SHEB5 RecName: Full=Sec-independent protein translocase
    1::47      5e-04  32%   79 aa  TATA_SHEB2 RecName: Full=Sec-independent protein translocase
    1::45      5e-04  33%   88 aa  TATA_MYCLE RecName: Full=Sec-independent protein translocase
   20::58      7e-04  38%   82 aa  TATA_HELHP RecName: Full=Sec-independent protein translocase
    1::52      9e-04  33%   67 aa  TATE_SALTY RecName: Full=Sec-independent protein translocase
    1::52      9e-04  33%   67 aa  TATE_SALTI RecName: Full=Sec-independent protein translocase
   20::64      9e-04  38%   89 aa  TATA_HAEIN RecName: Full=Sec-independent protein translocase
   20::64      9e-04  38%   75 aa  TATA_HAEIE RecName: Full=Sec-independent protein translocase
    1::79

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDPVKSIDHNAPTAAAPT
TATA_RHOPS      MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDPVKSIDHNAPTAAAPT
TATA_RHOP2      MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPDAVKSLDHNATTGTPPN
TATA_RHOPT      MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKSEPVKSIDHTS-TPGATN
TATA_RHOPA      MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKSEPVKSIDHTS-TPGATN
TATA_NITHX      MGSLSIWHWIVVIAVILLLFGRGKISDLMGDVAQGIKAFKKGMQDDEKTAEKPEPVKTIDHNAPAPGA-S
TATA_BRASO      MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKAFKKGMQDDDKAPEKTEPVKSIDHGATPSA--T
TATA_BRASB      MGSLSIWHWIVVIAVVLLLFGRGKISDLMGDVAQGIKAFKKGMQDDDKAPEKTEPVKSIDHGATPSA--T
TATA_NITWN      MGSLSIWHWIVVVAVILLLFGRGKISDLMGDVAQGIKAFKKGMKDDEKTAEKPEPVKTINHNADGSGA-A
TATA_RHOPB      MGSLSIWHWXXXXXXXXXXFGRGKISDLMGDVAQGIKSFKKGLQDDEKTAEKPEPVKSIDHTAPPAAAP-
TATA_RHOP5      MGSLSIWHWXXXXXXXXXXFGRGKISDLMGDVAQGIKSFKKGLQDDDKTAEKTEPVKSIDHAAPPASAP-
TATA_BRAJA      MGSLSIWHWILVIAVVLLLFGRGKISDLMGDVAQGIKAFKKGMQXXXXXXXXXXXXXSIEHNAPTAA---
TATA_RHIME      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKKGMGDDEASADKSVDGKTVDHKS-------
TATA_AGRVS      MGSFSMWHWLIVLAIVLLLFGRGKIPELMGDVAKGIKSFKKGMSDDDTTPKPADQSKTVDHRA-------
TATA_AGRRK      MGSLSIWHWLIVLAIALLLFGRGKIPELMGDVAKGIKSFKKGMNDDEET---PPPAQSVEHKA-------
TATA_SINMW      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKKGMSDDAAAADKSIDGKTVDHKS-------
TATA_XANP2      MGSLSIWHWIVVLAVVLLLFGRGKISDLMGDVAKGIKSFKKGL---------------------------
TATA_METSB      MGSLSIWHWLIVGAVVLLVFGKGKISDIMGDVAKGIKSFKRGLSEDEEKAEKPPSLRSLDHQG--AGDPL
TATA_OCHA4      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMSDEDAKDDARDSGRTIDAKA-------
TATA_AZOC5      MGSMSIWHWIVVLAVVLLLFGRGKISDLMGDVAKGIKSFKKGM---------------------------
TATA_METRJ      MGSMSIWHWVIVAVIVMLLFGRGKVSDLMGDVAKGIKAFKKGMAEDE-----------------------
TATA_RHILO      MGSFSIWHWMIVLVIVLLVFGRGKIPELMGDMAKGIKSFKKGMADDDVADDK----RTVEHRA-------
TATA_BRUSU      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_BRUSI      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_BRUME      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_BRUMB      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_BRUC2      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_BRUAB      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_BRUA1      MGSFSIWHWLIVLAVVLLLFGRGKIPELMGDVAKGIKNFKQGMADED---AKEDP-RTIDAKA-------
TATA_METNO      MGGASIWHWIVVGVIVMLLFGRGKVSELMGDVAKGIKAFKKGMADED---QPQAPVANQSPPPVSATEPV
TATA_METS4      MGGASIWHWIVVGVIVMLLFGRGKVSELMGDVAKGIKAFKKGMADEDQ----------------------
TATA_RHIE6      MGSFSMWHWXXXXXXXXXXFGRGKIPELMGDVAKGIKSFKKGMTDD----DAPDTAKTVDHKA-------
TATA_ZYMMO      MGGMSITHWIVVAVVVMIFFGKGRFSDMMGDVAKGIKSFKKGMSEDDTT---------------------
TATA_RHILW      MGSFSMWHWXXXXXXXXXXFGRGKIPELMGDVAKGIKSFKKGMTDE----DAPDTAKTVDHKA-------
TATA_RHIL3      MGSFSMWHWXXXXXXXXXXFGRGKIPELMGDVAKGIKSFKKGMTDE----DAPDTAKTVDHKA-------
TATA_RHIEC      MGSLSMWHWXXXXXXXXXXFGRGKIPELMGDVAKGIKSFKKGMTDE----DAPETAKTVDHKA-------
TATA_AGRT5      MGSFSVWHWXXXXXXXXXXFGRGKIPELMGDVAKGIKSFKKGMADEDQTPPPADAAKTVDHKA-------
TATA_RHISN      MGSFSIWHWLIXXXXXXXXFGRGKIPELMGDVAKGIKNFKKGMTDEEASADKTIDGKTVEHKS-------
TATA_METPB      MGSMSXXXXXXXXXXXMLLFGRGKVSELMGDVAKGIKAFKKGMADDENTTSVPDPVRTLPHQGAPGTAPQ
TATA_SPHAL      MGSFSIWHWXXXXXXXXXXFGKGRFSDMMGDVAKGIKSFKKGMSEDD--APTPAPKQIDAQRAPLSATPT
TATA_PHEZH      MGSFSIWHWLIVLVVVALLFGRGRLSGIMGDAAKGIRAFRDGLKGESEQAE-------------------
TATA_METC4      MGSMSXXXXXXXXXXXMLLFGRGKVSELMGDVAKGIKAFKKGMADDEATSVPPDPVRTLPHQGAPGTAP-
TATA_MESSB      MGSFSIWHWLIXXXXXXXXFGRGKIPELMGDMAKGIKNFRKGMTDEAEEA------KTVEH---------
TATA_SPHWW      MGSMSIWHWXXXXXXXXXXFGKGRFSDMMGDVAKGIKSFKKGMSEEDEPTQ-------------------
TATA_CAUCR      MGSMSWIHWVIVLGIVALLFGRGKLSSIMGDAAKGIKAFKDGLKDESSSEVADNKAKS------------
TATA_CAUCN      MGSMSWIHWVIVLGIVALLFGRGKLSSIMGDAAKGIKAFKDGLKDESSSEVADNKAKS------------
TATA_METEP      MGSMSXXXXXXXXXXXMLLFGRGKVSELMGDVAKGIKAFKKGMADDETQPNTATSVPPVGPNDPVRTLP-
TATA_OLICO      ---LSFQHXXXXXXXXXXXFGRNKISDLMGDFAKGIKAFKKGMSDDEVETAKSDSIKTIDNTGPTQANPQ
TATA_STRM5      MGSFSIWHWLVVLAIVLLVFGTKRLTSGAKDLGSAVKEFKKGMRDEDKNAQLGDESRSQD----------
TATA_NITEU      MGSFSIWHWLVVLAIVVLVFGTKKLRNLGSDLGGAVRGFKEGMKGAEEESTPPPPAQQV-----------
TATA_STRMK      MGSFSIWHWLVVLAIVLLVFGTKRLTSGAKDLGSAVKEFKKGMRDEDK----------------------
TATA_DELAS      MGSFSIWHWLIVLAIVVLVFGTKKLKNIGSDLGGAVKGFKDGVKDGSTSTDTPAAAPG-QVAGQTAADKT
TATA_ACISJ      MGSFSIWHWLIVLLIVVMVFGTKKLKNIGSDLGGAVKGFKDGMKDGASTATTSAPAGQVTNNS-TAADKT
TATA_NITEC      MGSFSIWHWLVVLAIVVLVFGTKKLRNLGSDLGGAVRGFKEGMKGAEEENTQPPP---------------
TATA_JANMA      MGSFSIWHWLIVLVIVMLVFGTKKLGNMGSDVGKAVKGFKKGGEDDKPAAQNAAPSQVAD----------
TATA_DIAST      MGSFSIWHWLIVLLIVVMVFGTKKLKNIGSDLGGAVKGFKDGMKDGASTATTSAPAGQVTNNS-AAADKT
TATA_BURM1      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKDGDAPADAQQLPRSVDVNAKEA---T
TATA_HERAR      MGSFSIWHWLIVLVIVALVFGTKKIGSMGTDVGKAVKGFKDGMEDDKPAAQNAAPSQVAD----------
TATA_CUPTR      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKDGEDKGAQPAASKEL-----------
TATA_RALEH      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKDGEGKA-AADPAQS------------
TATA_CAMFF      MGSFSMGHWLIVLAIIVLLFGAKKIPELAKGVGKGIKTFKKEMEDEEKIEKADSETQSTKQNETT-----
TATA_BURTA      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMREGEAPADPQQLPRSGSVNVDAKDA-T
TATA_BURPP      MGSLSIWHWLIVLLIVALVFGTKKLRNIGGDLGGAVKGFKEGMKEADAPA--------------------
TATA_BURP8      MGSLSIWHWLIVLLIVALVFGTKKLRNIGSDLGGAVKGFKEGMKDGE-----------------------
TATA_RHORT      MGFSSIWHWIIXXXXXXXXFGAGKIPRLMGDVAKGVKAFKKGM---------------------------
TATA_DECAR      MGSFSIWHWLIVLVIVMLIFGTKKLRNVGQDLGGAVKGFKDGMKEADKPAEEAQPTQQV-----------
TATA_BURS3      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGEAPADAQQLPRSVDVNAKET---T
TATA_BURPS      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURP6      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURP1      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURP0      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURMS      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURMA      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURM9      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURM7      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKESEAPADAQQLPRSGSVNVDAKDAAR
TATA_BURCJ      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPADAQQLPRSVDVNAKET---T
TATA_BURCH      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPADAQQLPRSVDVNAKET---T
TATA_BURCC      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPADAQQLPRSVDVNAKET---T
TATA_BURCA      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPADAQQLPRSVDVNAKET---T
TATA_BORPE      MGSFSIWHWLIVLVIIALVFGTKKLRNVGSDLGSAVKGFKEGMKD--ASADKP-----------------
TATA_BORPD      MGSFSIWHWLIVLVIVALVFGTKKLRNIGSDLGGAVKGFKEGMKDSDKPAEQVTQQKVAD----------
TATA_BORPA      MGSFSIWHWLIVLVIIALVFGTKKLRNVGSDLGSAVKGFKEGMKD--ASADKP-----------------
TATA_BORBR      MGSFSIWHWLIVLVIIALVFGTKKLRNVGSDLGSAVKGFKEGMKD--ASADKP-----------------
TATA_BURVG      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPAD-------------------
TATA_BURCM      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPAD-------------------
TATA_BURA4      MGGLSIWHWLIVLLIVALVFGTKKLRNIGNDLGSAVKGFKDGMKEGETPAD-------------------
TATA_POLSQ      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKSAE------DPNEQIPQSTTTA----
TATA_GLUDA      MGSLSIWHWLIXXXXXXXXXXXXKISTLMGDVARGVKSFKKNMADDE-----------------------
TATA_BURXL      MGSLSIWHWLIVLLIVALVFGTKKLRNIGTDLGGAVKGFKEGMKEAETPA--------------------
TATA_POLNS      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGIQQSSATAEKTVDVQAKDVN--------
TATA_PELUB      --SIGIWQXXXXXXXXXXXFGRGKISSLMGDVAKGIKSFKKGMATD--ITDEPEP-KNVSEN--------
TATA_RALEJ      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKEDDKAA--------------------
TATA_POLSJ      MGSFSIWHWLIVLLIVVMVFGTKKLKNMGSDLGSAVKGFKDGMKD-------------------------
TATA_POLNA      MGGFSIWHWLIVLLIVVMVFGTKKLRNMGSDLGGAVKGFKDGMKDGGQSPEKPVVPASQVTNAQAADKAE
TATA_RALPJ      MGSFSIWHWLIVLVIIMMVFGTKKLRNIGSDLGSAVKGFKDGMREGQE--DKP-----------------
TATA_ERYLH      -------------------FGRGKISDMMGDFGKGVSSFKKGLNEEDKPAEPAAKIEGPSHEAKPA----
TATA_BORA1      MGSFSIWHWLIVLVIVALIFGTKKLRNIGSDLGGAVKGFKDGMQE-------------------------
TATA_RALME      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMKENTDEPATPTPAKEL-----------
TATA_ACIAC      MGSFSIWHWLIVLLIVVMVFGTKKLKNIGSDLGGAVKGFKDGMKD-------------------------
TATA_RALSO      MGSFSIWHWLIVLLIIMMVFGTKKLRNIGSDLGSAVKGFKEGMRE-------------------------
TATA_CAMC1      MGSFSIGHWLIVLAIIVLLFGAKKIPELAKGLGKGIKTFKAEMED-------------------------
TATA_AZOSB      MGSFSIWHWLIVLVIVMLVFGTKKLRNIGQDLGGAVKGFKDGMK--------------------------
TATA_MYCVP      MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKKEMQADSQSAKPDQPA------APTQIASE
TATA_MYCSS      MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKKEMQSEGKSDNPPTPITSVDTN-PTAEQPD
TATA_MYCSK      MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKKEMQSEGKSDNPPTPITSVDTN-PTAEQPD
TATA_MYCSJ      MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKKEMQSEGKSDNPPTPITSVDTN-PTAEQPD
TATA_BEII9      MGSLSLWHWIIXXXXXXXXXXXXXXSDIMGDVAKGIKSFKKGL---------------------------
TATA_NOVAD      MGGLSLPHXXXXXXXXXXXFGRGRISEMMGDFGKGIKSFKQGMNDED-----------------------
TATA_MYCS2      MGGLQPWHWVIVIAVFVLLFGAKKLPDAARSLGKSMRIFKSEIKEAESKGDEPKPATPIASERVDTTAP-
TATA_MYCPA      MGSLSPWHWAILAVVVILLFGAKKLPDAARSLGKSMRIFKSELRESESSAANPTPVQSVDPPAPS-----
TATA_MYCGI      MGGLQPWHWLIVIAVFVLLFGAKKLPDAARSLGKSMRIFKKEMQSDSNAAKSDQP---------------
TATA_MYCA1      MGSLSPWHWAILAVVVILLFGAKKLPDAARSLGKSMRIFKSELRESESSAANPTPVQSVDPPAPS-----
TATA_XANCP      MGSFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_XANCB      MGSFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_XANC8      MGSFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_MYCTU      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKRELQNENKSIETPTPVQS------------
TATA_MYCTA      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKRELQNENKSIETPTPVQS------------
TATA_MYCBT      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKRELQNENKSIETPTPVQS------------
TATA_MYCBP      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKRELQNENKSIETPTPVQS------------
TATA_MYCBO      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKRELQNENKSIETPTPVQS------------
TATA_CAUSK      MGGMSWIHWXXXXXXXXXXFGRGKLSGIMGDAAKGIKAFKDGLKDD------------------------
TATA_FLAPJ      MGRLGVTEILMILAVVLLLFGGKKIPELMKGLGSGLSEFKKAAKGDEVPDSKKDETK-------------
TATA_MYCUA      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSMRIFKSEMREQSETKAEPSAIETNTAN-PTPVQSQ
TATA_MYCMM      MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSMRIFKSEMREQSETKAEPSAIETNTAN-PTPVQSQ
TATA_XANOP      MGGFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_XANOM      MGGFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_XANC5      MGGFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_XANAC      MGGFSIWHWXXXXXXXXXXFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPAGK------------------
TATA_AZOSE      MGSFSIWHWXXXXXXXXXXFGTKKLRNVGQDLGGAVKGFKDGMRDSEKSGE-------------------
TATA_THIDA      MGSFSIWHWXXXXXXXXXXFGTKKLRNIGSDLGGAVKGFKEGMKDDAPKISESD----------------
TATA_CHRVO      MGSLSIWHWXXXXXXXXXXFGTKKLPGIGKDLGNAVKGFKEGMNEGAKDGQPPDAGRIIDGEA-------
TATA_VARPS      MGSFSIWHWXXXXXXXXMIFGTKKLRNMGSDLGGAVKGFKDGMKDGSTT---------------------
TATA_PSEHT      -GGISLWQXXXXXXXXXXXFGTKKLRGIGGDLGGAVKGFKKAMSDEKNTKEKPEQIQKSEESAPLDSAHT
TATA_METPP      MGSFSIWHWXXXXXXXXXXFGTKKLKNIGSDLGGAVKGFKDGVRDG--STAPADPAQQVTAN--KSADAN
TATA_BARQU      -------------------FGRGKVSELMGDVAKGIKAFKKNM---------------------------
TATA_BARHE      -------------------FGRGKVSELMGDVAKGIKAFKKNM---------------------------
TATA_VEREI      MGTFSIWHWLIXXXXXXXXFGTKKLRNIGTDLGSAVKGFKDGMKD-------------------------
TATA_PSYA2      MGSFSITHWLILLXXXXXXFGTSKLRNAGKDLGGAVKGFKEAVKDENTEHAKKHVV--LDHDAGT-----
TATA_GLUOX      MGSMSPVHWXXXXXXXXXXXXXXKISGLMGDFAKGIKSFKKNMADDE-SMTATDATQAPGHISPPNQNP-
TATA_RHOSR      MGAMSPWHWAIVALVVIILFGSKKLPDAARGLGRSLRIFKKEMQND------------------------
TATA_RHOOB      MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKKEMQND------------------------
TATA_RHOER      MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKKEMQND------------------------
TATA_LARHH      MGSFSIWHWXXXXXXXXXXFGTKKLRNVGQDLGGAVKGFKEGMKSEGEDAAQTPP---------------
TATA_RICBR      ---MSFSHXXXXXXXXFVLFGAGKLPQVMSDLAKGLKAFKDGMKEDDST---------------------
TATA_VIBPA      MGGISVWQXXXXXXXXXXXFGTKKLRGIGGDLGSAVKGFKKAMSDEDSAKNEKDEPKSLEKQQQKEAAP-
TATA_NITMU      MGSFSIWHWXXXXXXXXXXFGTKKLRNLGSDLGGAVKGFREGVKEEEISAHNHTEARIID----------
TATA_SHIFL      MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTS--QDADFTAKTIA---
TATA_ECOLI      MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTS--QDADFTAKTIA---
TATA_ECOL6      MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTS--QDADFTAKTIA---
TATA_ECO57      MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTS--QDADFTAKTIA---
TATA_VIBVU      MGGISIWQXXXXXXXXXXXFGTKKLRGIGSDLGGAIKGFKKAMNEEESEKKDADEPKSLEQQSKQAATES
TATA_SHEWM      MGNMGIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEEEASEKATP--SVEKTAPNAEKKT
TATA_MAGSM      -------------------FGAGKLPKVMGDMGRGVKSFKKAMNAEDDAPAEPEVSK------PAAAEST
TATA_RHOE4      MGAMQPMHWLIVAVVVVILFGSKKLPDAARGLGRSLRIFKKEMQNDD-----------------------
TATA_VIBVY      MGGISIWQXXXXXXXXXXXFGTKKLRGIGSDLGGAIKGFKKAMNEEESEKKDADEPKSLEQQNKQAATES
TATA_SALTY      MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDDAKQDK------------------
TATA_SALTI      MGGISIWQXXXXXXXXXXXFGTKKLGSIGSDLGASIKGFKKAMSDDDAKQDK------------------
TATA_RICAH      --------------------GAGKLPQVMSDLAKGLKAFKNGMQDDGSDNDK------------------
TATA_ACTSZ      MGGISIWQXXXXXXXXXXXFGTKKLRTLGSDLGESVKGFKKAMAEEPKDAE----FKSLD----------
TATA_ACIBS      MAGLSIWHXXXXXXXXXXXXGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSP-RTIDAQAKTS----
TATA_VIBF1      MGGISIWQXXXXXXXXXXXFGTKKLRGVGSDLGSAVKGFKKAISEDEPAKEAKKDADFVPQNLEKKEAET
TATA_PSEPF      MGIFDWKHWXXXXXXXXXXFGTKKLKNLGTDVGESIKGFRKAMNDDEK----------------------
TATA_PSEFS      MGIFDWKHWXXXXXXXXXXFGTKKLKNLGTDVGESIKGFRKAMNDDEK----------------------
TATA_PSEF5      MGIFDWKHWXXXXXXXXXXFGTKKLKNLGTDVGESIKGFRKAMNDDEK----------------------
TATA_SODGM      MGGISITQLLIIASIVVVLFGTKKLRGLGSDLGASIKGFKK-----------------------------
TATA_RICM5      ---MSVSHXXXXXXXXXXXXGAGKLPQVMSDLAKGLKAFKDGMKDDGSDNDK------------------
TATA_RICAE      --------------------GAGKLPQVMSDLAKGLKAFKDGLKDDGSDNDK------------------
TATA_NEIMB      MGSFSLTHWXXXXXXXXXXFGTKKLRNVGKDLGGAVHDFKQGLNEDGKEAQKDDVIE-------------
TATA_NEIMA      MGSFSLTHWXXXXXXXXXXFGTKKLRNVGKDLGGAVHDFKQGLNEDGKEAQKDDVIE-------------
TATA_NEIM0      MGSFSLTHWXXXXXXXXXXFGTKKLRNVGKDLGGAVHDFKQGLNEDGKEAQKDDVIE-------------
TATA_NEIG2      MGSFSLTHWXXXXXXXXXXFGTKKLRNVGKDLGGAVHDFKQGLNEDGKEAQKDDVIE-------------
TATA_NEIG1      MGSFSLTHWXXXXXXXXXXFGTKKLRNVGKDLGGAVHDFKQGLNEDGKEAQKDDVIE-------------
TATA_ALTMD      MGGISIWQXXXXXXXXXXXFGTKRLKGIGTDLGGAIKGFKKAVSEEEKDADF-EQKKQVEEK--SAAEPV
TATA_WOLTR      --SLGPWQXXXXXXXXXXXXGAGRLPQVMGDLGKGIKNLKQELKDSEKSSNEPD----------------
TATA_WOLPP      --SLGPWQXXXXXXXXXXXXGAGRLPQVMGDLGKGIKNLKQELKDSEKSSNEPD----------------
TATA_WOLPM      --SLGPWQXXXXXXXXXXXXGAGRLPQVMGDLGKGIKNLKQELKDSEKSSNEPD----------------
TATA_RICCN      ---MSLSHXXXXXXXXXXXXGAGKLPQVMSDLAKGLKAFKDGMKDDGSDNDK------------------
TATA_PSEU2      MGIFDWKHWXXXXXXXXXXFGTKKLKGLGSDVGESIKGFRKAMNDDDK----------------------
TATA_PSE14      MGIFDWKHWXXXXXXXXXXFGTKKLKGLGSDVGESIKGFRKAMNDDDK----------------------
TATA_PHOLL      MGGISIWQXXXXXXXXXXXFGTNKLRTLGSDLGASIKGFKKAIGDDQKTSSDADETKNITEKQSVAQSET
TATA_MANSM      MGGISIWQXXXXXXXXXXXFGTKKLRTLGTDLGESVKGFKKAMNEDEKDAE-------------------
TATA_BART1      -------------------FGRGRVAELMGDVAKGIKAF-------------------------------
TATA_ACIBY      MAGLSIWHXXXXXXXXXXXXGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSP-RTIDAQVKTS----
TATA_ACIBT      MAGLSIWHXXXXXXXXXXXXGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSP-RTIDAQVKTS----
TATA_ACIBC      MAGLSIWHXXXXXXXXXXXXGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSP-RTIDAQVKTS----
TATA_ACIB5      MAGLSIWHXXXXXXXXXXXXGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSP-RTIDAQVKTS----
TATA_ACIB3      MAGLSIWHXXXXXXXXXXXXGTSKLKNIGKDVGGAVRDFKKSVREEDEAASLNSP-RTIDAQVKTS----
TATA_RICRS      --------------------GAGKLPQVMSDLAKGLKAFKDGMKDDGSDNDK------------------
TATA_RICRO      --------------------GAGKLPQVMSDLAKGLKAFKDGMKDDGSDNDK------------------
TATA_PSESM      MGIFDWKHWXXXXXXXXXXFGTKKLKGLGTDVGESIKGFRKAMHDDDK----------------------
TATA_ACTPJ      MGGISIWQXXXXXXXXXXXFGTKKLRTLGTDLGESVKGFKKAMADDK-----------------------
TATA_ACTP7      MGGISIWQXXXXXXXXXXXFGTKKLRTLGTDLGESVKGFKKAMADDK-----------------------
TATA_ACTP2      MGGISIWQXXXXXXXXXXXFGTKKLRTLGTDLGESVKGFKKAMADDK-----------------------
TATA_SHEFN      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMTPEDENKSLDDKEKDQTAATSQQAAEK
TATA_ROSS1      -------------------FGASRITGVASALGGSIKAFRKAVRDDDVPASKSEPAESTDKKVET-----
TATA_HAEDU      MGGISIWQXXXXXXXXXXXFGTKKLRTLGTDLGESVKGFKKAMAEDKSQDANFDKVEA------------
TATA_VIBFM      MGGISIWQXXXXXXXXXXXFGTKKLRGVGSDLGSAVKGFKKAISEDE-----------------------
TATA_VIBCH      MGGISIWQXXXXXXXXXXXFGTKKLRGIGSDLGSAVKGFKKAMSEEESAANQKDETKNLEQAKTNASAEV
TATA_SYNAS      -------------------FGAGKLPEIGGAIGKGIKNFKKASNESEEIDENSRPKK-------------
TATA_ALISL      MGGISIWQXXXXXXXXXXXFGTKKLRGVGSDLGSAVKGFKKAISEDE-----------------------
TATA_TRIEI      ---------IVILVVALLIFGPKKLPEIGRSLGQAINSFKAGARDFE-----------------------
TATA_SHEPA      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEEEK-------KALEENA-------
TATA_SHELP      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSEDEKKA--------------------
TATA_RICFE      --------------------GAGKLPQVMSDLAKGLKAFKDGMKDEGSDNDK------------------
TATA_PHOPR      -------------------FGTKKLRSLGGDLGSAVKGFKKAIGDEELTVKKDNTEADADFEQKT-----
TATA_PASMU      MGGISITQXXXXXXXXXXXFGTKKLRTLGSDLGESVKGFKKAMADDNK--EKDAEFKSLSDDS-------
TATA_HERA2      -------------------FGASRIGDLGGAMGRGIREFRRGVRDEDATA--------------------
TATA_SHESH      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKSAMSSEEE----------------------
TATA_SHEPW      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEEE----------------------
TATA_PSEST      ---ISVWQXXXXXXXVVMLFGTKRLRGLGSDLGSAINGFRKSVSDGETTTQ-------------------
TATA_PROMH      MGGISIWQXXXXXXXXXXXFGTNKLRTLGSDLGASVKGFKKAMGDENQ----------------------
TATA_HAHCH      ---ISMWQXXXXXXXXXXXFGTKKLKNIGGDLGGAVKGFKKAMSDGESEEDKEPKKLSQNESRTIEGSVE
TATA_SHESW      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEE-----------------------
TATA_SHEPC      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEE-----------------------
TATA_SHEHH      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMEEDKKALE-------------------
TATA_SHEB9      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEE-----------------------
TATA_SHEB8      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEE-----------------------
TATA_SHEB5      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEE-----------------------
TATA_SHEB2      MGGISIWQXXXXXXXXXXXFGTKKLRSLGGDLGGAVKGFKNAMSSEE-----------------------
TATA_MYCLE      MGSLSPWHWXXXXXXXXXXFGAKKLPDAARSLGKSMRIFKSELRE-------------------------
TATA_HELHP      -------------------FGAKKIPELAKGLGSGIKNFKKAVKEDEEDNQSEENTKS------------
TATE_SALTY      MGEISITKXXXXXXXXXXXFGTKKLRTLGGDLGTAIKGFKKAMNDEDAGVKK------------------
TATE_SALTI      MGEISITKXXXXXXXXXXXFGTKKLRTLGGDLGTAIKGFKKAMNDEDAGVKK------------------
TATA_HAEIN      -------------------FGTKKLRNAGSDLGAAVKGFKKAMKEDEKV--KDAEFKSIDNETASA----
TATA_HAEIE      -------------------FGTKKLRNAGSDLGAAVKGFKKAMKEDEKV--KDAEFKSIDNETASA----


                         .         .         *         .         .         .         .:140
query           RTDVGSKAV
TATA_RHOPS      RTDVGSKAV
TATA_RHOP2      RTDVGSKAV
TATA_RHOPT      RTDVGSKAV
TATA_RHOPA      RTDVGSKAV
TATA_NITHX      RSDVGSK--
TATA_BRASO      RTDVGSKAV
TATA_BRASB      RTDVGSKAV
TATA_NITWN      RSDTGSKVI
TATA_RHOPB      RTDVGSKVV
TATA_RHOP5      RSDVGSKAV
TATA_BRAJA      RSDVGSKAV
TATA_RHIME      ---------
TATA_AGRVS      ---------
TATA_AGRRK      ---------
TATA_SINMW      ---------
TATA_XANP2      ---------
TATA_METSB      KT-------
TATA_OCHA4      ---------
TATA_AZOC5      ---------
TATA_METRJ      ---------
TATA_RHILO      ---------
TATA_BRUSU      ---------
TATA_BRUSI      ---------
TATA_BRUME      ---------
TATA_BRUMB      ---------
TATA_BRUC2      ---------
TATA_BRUAB      ---------
TATA_BRUA1      ---------
TATA_METNO      RT-------
TATA_METS4      ---------
TATA_RHIE6      ---------
TATA_ZYMMO      ---------
TATA_RHILW      ---------
TATA_RHIL3      ---------
TATA_RHIEC      ---------
TATA_AGRT5      ---------
TATA_RHISN      ---------
TATA_METPB      QTHV-----
TATA_SPHAL      PT-------
TATA_PHEZH      ---------
TATA_METC4      ---------
TATA_MESSB      ---------
TATA_SPHWW      ---------
TATA_CAUCR      ---------
TATA_CAUCN      ---------
TATA_METEP      ---------
TATA_OLICO      RQD------
TATA_STRM5      ---------
TATA_NITEU      ---------
TATA_STRMK      ---------
TATA_DELAS      TIDVEAK--
TATA_ACISJ      TIDVEAK--
TATA_NITEC      ---------
TATA_JANMA      ---------
TATA_DIAST      TIDVEAK--
TATA_BURM1      RSD------
TATA_HERAR      ---------
TATA_CUPTR      ---------
TATA_RALEH      ---------
TATA_CAMFF      ---------
TATA_BURTA      RSSDSNKA-
TATA_BURPP      ---------
TATA_BURP8      ---------
TATA_RHORT      ---------
TATA_DECAR      ---------
TATA_BURS3      RSD------
TATA_BURPS      SSD------
TATA_BURP6      SSD------
TATA_BURP1      SSD------
TATA_BURP0      SSD------
TATA_BURMS      SSD------
TATA_BURMA      SSD------
TATA_BURM9      SSD------
TATA_BURM7      SSD------
TATA_BURCJ      RSD------
TATA_BURCH      RSD------
TATA_BURCC      RSD------
TATA_BURCA      RSD------
TATA_BORPE      ---------
TATA_BORPD      ---------
TATA_BORPA      ---------
TATA_BORBR      ---------
TATA_BURVG      ---------
TATA_BURCM      ---------
TATA_BURA4      ---------
TATA_POLSQ      ---------
TATA_GLUDA      ---------
TATA_BURXL      ---------
TATA_POLNS      ---------
TATA_PELUB      ---------
TATA_RALEJ      ---------
TATA_POLSJ      ---------
TATA_POLNA      RNTIDVEA-
TATA_RALPJ      ---------
TATA_ERYLH      ---------
TATA_BORA1      ---------
TATA_RALME      ---------
TATA_ACIAC      ---------
TATA_RALSO      ---------
TATA_CAMC1      ---------
TATA_AZOSB      ---------
TATA_MYCVP      R--------
TATA_MYCSS      K--------
TATA_MYCSK      K--------
TATA_MYCSJ      K--------
TATA_BEII9      ---------
TATA_NOVAD      ---------
TATA_MYCS2      ---------
TATA_MYCPA      ---------
TATA_MYCGI      ---------
TATA_MYCA1      ---------
TATA_XANCP      ---------
TATA_XANCB      ---------
TATA_XANC8      ---------
TATA_MYCTU      ---------
TATA_MYCTA      ---------
TATA_MYCBT      ---------
TATA_MYCBP      ---------
TATA_MYCBO      ---------
TATA_CAUSK      ---------
TATA_FLAPJ      ---------
TATA_MYCUA      RID------
TATA_MYCMM      RID------
TATA_XANOP      ---------
TATA_XANOM      ---------
TATA_XANC5      ---------
TATA_XANAC      ---------
TATA_AZOSE      ---------
TATA_THIDA      ---------
TATA_CHRVO      ---------
TATA_VARPS      ---------
TATA_PSEHT      EKNKDNNKV
TATA_METPP      TVDVEAK--
TATA_BARQU      ---------
TATA_BARHE      ---------
TATA_VEREI      ---------
TATA_PSYA2      ---------
TATA_GLUOX      ---------
TATA_RHOSR      ---------
TATA_RHOOB      ---------
TATA_RHOER      ---------
TATA_LARHH      ---------
TATA_RICBR      ---------
TATA_VIBPA      ---------
TATA_NITMU      ---------
TATA_SHIFL      ---------
TATA_ECOLI      ---------
TATA_ECOL6      ---------
TATA_ECO57      ---------
TATA_VIBVU      KKD------
TATA_SHEWM      ET-------
TATA_MAGSM      ---------
TATA_RHOE4      ---------
TATA_VIBVY      KKD------
TATA_SALTY      ---------
TATA_SALTI      ---------
TATA_RICAH      ---------
TATA_ACTSZ      ---------
TATA_ACIBS      ---------
TATA_VIBF1      ---------
TATA_PSEPF      ---------
TATA_PSEFS      ---------
TATA_PSEF5      ---------
TATA_SODGM      ---------
TATA_RICM5      ---------
TATA_RICAE      ---------
TATA_NEIMB      ---------
TATA_NEIMA      ---------
TATA_NEIM0      ---------
TATA_NEIG2      ---------
TATA_NEIG1      ---------
TATA_ALTMD      STETQS---
TATA_WOLTR      ---------
TATA_WOLPP      ---------
TATA_WOLPM      ---------
TATA_RICCN      ---------
TATA_PSEU2      ---------
TATA_PSE14      ---------
TATA_PHOLL      ---------
TATA_MANSM      ---------
TATA_BART1      ---------
TATA_ACIBY      ---------
TATA_ACIBT      ---------
TATA_ACIBC      ---------
TATA_ACIB5      ---------
TATA_ACIB3      ---------
TATA_RICRS      ---------
TATA_RICRO      ---------
TATA_PSESM      ---------
TATA_ACTPJ      ---------
TATA_ACTP7      ---------
TATA_ACTP2      ---------
TATA_SHEFN      QPETESK--
TATA_ROSS1      ---------
TATA_HAEDU      ---------
TATA_VIBFM      ---------
TATA_VIBCH      KKD------
TATA_SYNAS      ---------
TATA_ALISL      ---------
TATA_TRIEI      ---------
TATA_SHEPA      ---------
TATA_SHELP      ---------
TATA_RICFE      ---------
TATA_PHOPR      ---------
TATA_PASMU      ---------
TATA_HERA2      ---------
TATA_SHESH      ---------
TATA_SHEPW      ---------
TATA_PSEST      ---------
TATA_PROMH      ---------
TATA_HAHCH      RNDAKTES-
TATA_SHESW      ---------
TATA_SHEPC      ---------
TATA_SHEHH      ---------
TATA_SHEB9      ---------
TATA_SHEB8      ---------
TATA_SHEB5      ---------
TATA_SHEB2      ---------
TATA_MYCLE      ---------
TATA_HELHP      ---------
TATE_SALTY      ---------
TATE_SALTI      ---------
TATA_HAEIN      ---------
TATA_HAEIE      ---------