[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE40040.1

[Show Plain Result]


## Summary of Sequence Search
    1::344
   12::346     e-142  77%  348 aa  ODPA_RHIME RecName: Full=Pyruvate dehydrogenase E1 component
   36::349     e-104  58%  354 aa  ODPA_ZYMMO RecName: Full=Pyruvate dehydrogenase E1 component
   11::325     3e-99  54%  326 aa  ODPA_RICCN RecName: Full=Pyruvate dehydrogenase E1 component
   18::325     4e-96  54%  326 aa  ODPA_RICFE RecName: Full=Pyruvate dehydrogenase E1 component
   12::325     8e-96  52%  326 aa  ODPA_RICBR RecName: Full=Pyruvate dehydrogenase E1 component
   18::325     5e-95  53%  326 aa  ODPA_RICTY RecName: Full=Pyruvate dehydrogenase E1 component
   18::325     3e-94  53%  326 aa  ODPA_RICPR RecName: Full=Pyruvate dehydrogenase E1 component
   50::370     6e-89  55%  391 aa  ODPAT_RAT RecName: Full=Pyruvate dehydrogenase E1 component subunit
   50::370     7e-87  55%  391 aa  ODPAT_MOUSE RecName: Full=Pyruvate dehydrogenase E1 component
   22::342     8e-86  53%  363 aa  ODPA_SMIMA RecName: Full=Pyruvate dehydrogenase E1 component
   49::369     3e-85  54%  390 aa  ODPA_MOUSE RecName: Full=Pyruvate dehydrogenase E1 component
   48::368     4e-85  54%  389 aa  ODPA_PIG RecName: Full=Pyruvate dehydrogenase E1 component subunit
   49::369     4e-85  54%  390 aa  ODPA_BOVIN RecName: Full=Pyruvate dehydrogenase E1 component
   49::369     5e-85  54%  390 aa  ODPA_HUMAN RecName: Full=Pyruvate dehydrogenase E1 component
   40::360     9e-85  52%  377 aa  ODPA_DICDI RecName: Full=Pyruvate dehydrogenase E1 component
   49::369     2e-84  54%  390 aa  ODPA_RAT RecName: Full=Pyruvate dehydrogenase E1 component subunit
   49::369     3e-84  53%  390 aa  ODPA_PONAB RecName: Full=Pyruvate dehydrogenase E1 component
   49::369     3e-84  53%  390 aa  ODPA_PANTR RecName: Full=Pyruvate dehydrogenase E1 component
   47::367     5e-83  54%  388 aa  ODPAT_HUMAN RecName: Full=Pyruvate dehydrogenase E1 component
   49::369     8e-83  53%  390 aa  ODPA_MACFA RecName: Full=Pyruvate dehydrogenase E1 component
   41::363     1e-82  50%  397 aa  ODPA_CAEEL RecName: Full=Probable pyruvate dehydrogenase E1
   48::360     3e-81  51%  391 aa  ODPT_ASCSU RecName: Full=Pyruvate dehydrogenase E1 component
   46::370     1e-77  49%  391 aa  ODPA_SOLTU RecName: Full=Pyruvate dehydrogenase E1 component
   68::376     7e-77  50%  397 aa  ODPA_PEA RecName: Full=Pyruvate dehydrogenase E1 component subunit
   53::365     3e-76  49%  396 aa  ODPA_ASCSU RecName: Full=Pyruvate dehydrogenase E1 component
   77::391     2e-74  47%  420 aa  ODPA_YEAST RecName: Full=Pyruvate dehydrogenase E1 component
   69::383     7e-74  47%  412 aa  ODPA_KLULA RecName: Full=Pyruvate dehydrogenase E1 component
   49::368     4e-73  46%  389 aa  ODPA1_ARATH RecName: Full=Pyruvate dehydrogenase E1 component
   77::372     1e-71  48%  393 aa  ODPA2_ARATH RecName: Full=Pyruvate dehydrogenase E1 component
   72::388     1e-71  46%  409 aa  ODPA_SCHPO RecName: Full=Pyruvate dehydrogenase E1 component
    2::336     1e-63  40%  344 aa  ODPA_PORPU RecName: Full=Pyruvate dehydrogenase E1 component
   16::330     2e-57  44%  333 aa  ACOA_RALEH RecName: Full=Acetoin:2,6-dichlorophenolindophenol
   20::338     3e-57  38%  346 aa  ODPA_PORYE RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     2e-36  34%  370 aa  ODPA_STAAR RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     7e-36  34%  370 aa  ODPA_STAES RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     7e-36  34%  370 aa  ODPA_STAEQ RecName: Full=Pyruvate dehydrogenase E1 component
   38::303     3e-33  33%  371 aa  ODPA_BACSU RecName: Full=Pyruvate dehydrogenase E1 component
   88::410     3e-32  28%  441 aa  ODBA_RAT RecName: Full=2-oxoisovalerate dehydrogenase subunit
   12::328     4e-32  32%  330 aa  ODBA_BACSU RecName: Full=2-oxoisovalerate dehydrogenase subunit
   40::314     5e-32  34%  370 aa  ODPA_STAAW RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     5e-32  34%  370 aa  ODPA_STAAS RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     5e-32  34%  370 aa  ODPA_STAAN RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     5e-32  34%  370 aa  ODPA_STAAM RecName: Full=Pyruvate dehydrogenase E1 component
   40::314     5e-32  34%  370 aa  ODPA_STAAC RecName: Full=Pyruvate dehydrogenase E1 component
   89::411     1e-31  28%  442 aa  ODBA_MOUSE RecName: Full=2-oxoisovalerate dehydrogenase subunit
   92::414     2e-31  27%  445 aa  ODBA_PANTR RecName: Full=2-oxoisovalerate dehydrogenase subunit
   92::414     3e-31  27%  445 aa  ODBA_HUMAN RecName: Full=2-oxoisovalerate dehydrogenase subunit
   92::414     4e-31  27%  445 aa  ODBA_MACFA RecName: Full=2-oxoisovalerate dehydrogenase subunit
   32::304     7e-31  32%  367 aa  ODBA_THET8 RecName: Full=2-oxoisovalerate dehydrogenase subunit
   32::304     9e-31  32%  367 aa  ODBA_THET2 RecName: Full=2-oxoisovalerate dehydrogenase subunit
  102::424     6e-30  27%  455 aa  ODBA_BOVIN RecName: Full=2-oxoisovalerate dehydrogenase subunit
   33::316     6e-28  31%  358 aa  ODPA_MYCGE RecName: Full=Pyruvate dehydrogenase E1 component
   33::316     2e-27  32%  358 aa  ODPA_MYCPN RecName: Full=Pyruvate dehydrogenase E1 component
    1::260     2e-27  34%  345 aa  ODPA_ACHLA RecName: Full=Pyruvate dehydrogenase E1 component
   39::304     8e-27  32%  369 aa  ODPA_BACST RecName: Full=Pyruvate dehydrogenase E1 component
   83::402     2e-24  24%  441 aa  ODBA_DICDI RecName: Full=2-oxoisovalerate dehydrogenase subunit
   70::394     1e-23  25%  410 aa  ODBA_PSEAE RecName: Full=2-oxoisovalerate dehydrogenase subunit
   38::303     4e-23  28%  371 aa  ODPA_BACCE RecName: Full=Pyruvate dehydrogenase E1 component
  110::395     3e-20  26%  410 aa  ODBA_PSEPU RecName: Full=2-oxoisovalerate dehydrogenase subunit
  638::820     2e-07  26% 1227 aa  KGD_MYCS2 RecName: Full=2-oxoglutarate decarboxylase;       
  125::252     3e-07  31%  627 aa  TKTL2_MOUSE RecName: Full=Transketolase-like protein 2;       
  674::852     4e-07  27% 1257 aa  ODO1_CORGL RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  655::831     4e-07  26% 1238 aa  KGD_MYCUA RecName: Full=2-oxoglutarate decarboxylase;       
  105::214     6e-07  34%  635 aa  DXS2_GEOMG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
  626::832     7e-07  24% 1238 aa  KGD_MYCLE RecName: Full=2-oxoglutarate decarboxylase;       
   79::182     1e-06  30%  629 aa  DXS_THERP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  123::272     2e-06  29%  626 aa  TKTL2_BOVIN RecName: Full=Transketolase-like protein 2;       
  355::535     2e-06  27%  932 aa  ODO1_STAAB RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  395::564     3e-06  23% 1013 aa  ODO1_DICDI RecName: Full=2-oxoglutarate dehydrogenase E1 component,
  642::824     3e-06  25% 1231 aa  KGD_MYCTU RecName: Full=2-oxoglutarate decarboxylase;       
  642::824     3e-06  25% 1231 aa  KGD_MYCTA RecName: Full=2-oxoglutarate decarboxylase;       
  642::824     3e-06  25% 1231 aa  KGD_MYCBP RecName: Full=2-oxoglutarate decarboxylase;       
  642::824     3e-06  25% 1231 aa  KGD_MYCBO RecName: Full=2-oxoglutarate decarboxylase;       
  355::521     4e-06  24%  944 aa  ODO1_BACSU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  107::179     4e-06  30%  618 aa  DXS_HELPJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  100::172     4e-06  30%  601 aa  DXS_ARCB4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  679::861     5e-06  25% 1269 aa  KGD_MYCSS RecName: Full=2-oxoglutarate decarboxylase;       
  679::861     5e-06  25% 1269 aa  KGD_MYCSK RecName: Full=2-oxoglutarate decarboxylase;       
  674::856     5e-06  25% 1264 aa  KGD_MYCSJ RecName: Full=2-oxoglutarate decarboxylase;       
  124::272     6e-06  29%  626 aa  TKTL2_HUMAN RecName: Full=Transketolase-like protein 2;       
  334::488     6e-06  27%  927 aa  DHTK1_XENLA RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
  123::247     8e-06  30%  623 aa  TKT_PONAB RecName: Full=Transketolase;         Short=TK;       
  355::535     1e-05  26%  932 aa  ODO1_STAAU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::535     1e-05  26%  932 aa  ODO1_STAAR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  333::513     1e-05  26%  910 aa  ODO1_STAAN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::535     1e-05  26%  932 aa  ODO1_STAAM RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::535     1e-05  26%  932 aa  ODO1_STAA9 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::535     1e-05  26%  932 aa  ODO1_STAA2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::535     1e-05  26%  932 aa  ODO1_STAA1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::521     1e-05  25%  944 aa  ODO1_BACLD RecName: Full=2-oxoglutarate dehydrogenase E1 component;
   96::174     1e-05  25%  606 aa  DXS_SULDN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  123::247     1e-05  28%  623 aa  TKT_BOVIN RecName: Full=Transketolase;         Short=TK;       
  355::521     1e-05  23%  944 aa  ODO1_BACA2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  123::247     2e-05  30%  623 aa  TKT_PANTR RecName: Full=Transketolase;         Short=TK;       
  123::247     2e-05  30%  623 aa  TKT_HUMAN RecName: Full=Transketolase;         Short=TK;       
  355::516     2e-05  25%  932 aa  ODO1_STAAW RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::516     2e-05  25%  932 aa  ODO1_STAAT RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::516     2e-05  25%  932 aa  ODO1_STAAS RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::516     2e-05  25%  932 aa  ODO1_STAAE RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::516     2e-05  25%  932 aa  ODO1_STAAC RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::516     2e-05  25%  932 aa  ODO1_STAA8 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::516     2e-05  25%  932 aa  ODO1_STAA3 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  355::521     2e-05  23%  944 aa  ODO1_BACP2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  113::212     2e-05  31%  618 aa  DXS_THIDA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   93::220     3e-05  27%  595 aa  TKTL1_MOUSE RecName: Full=Transketolase-like protein 1;       
  351::477     3e-05  32%  936 aa  ODO1_RICPR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  361::535     3e-05  29%  943 aa  ODO1_BACSK RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  664::840     3e-05  24% 1247 aa  KGD_MYCPA RecName: Full=2-oxoglutarate decarboxylase;       
  100::172     3e-05  27%  607 aa  DXS_CAMHC RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  112::209     3e-05  27%  637 aa  DXS1_GEOSL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
  358::515     4e-05  26%  934 aa  ODO1_STAHJ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::535     4e-05  30%  955 aa  ODO1_BACWK RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACHK RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACCZ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACCQ RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACC7 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACC3 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACC0 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACAN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACAC RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     4e-05  32%  955 aa  ODO1_BACAA RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  660::836     4e-05  25% 1243 aa  KGD_MYCVP RecName: Full=2-oxoglutarate decarboxylase;       
  122::298     4e-05  31%  636 aa  DXS_RALPJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  100::172     4e-05  30%  599 aa  DXS_NITSB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  123::247     5e-05  30%  623 aa  TKT_MACFA RecName: Full=Transketolase;         Short=TK;       
   94::244     5e-05  29%  596 aa  TKTL1_HUMAN RecName: Full=Transketolase-like protein 1;       
  352::495     5e-05  29%  933 aa  ODO1_RICTY RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     5e-05  32%  955 aa  ODO1_BACCR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     5e-05  32%  955 aa  ODO1_BACC4 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  349::519     5e-05  32%  955 aa  ODO1_BACC2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  107::179     5e-05  29%  618 aa  DXS_HELPY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  107::179     5e-05  29%  618 aa  DXS_HELPH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  107::179     5e-05  29%  618 aa  DXS_HELPG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRATF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  615 aa  DXS_FRAT1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::194     5e-05  31%  618 aa  DXS_FRAP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::188     5e-05  30%  640 aa  DXS_ERYLH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  349::466     7e-05  30%  955 aa  ODO1_BACC1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  109::182     7e-05  34%  643 aa  DXS_SYNPX RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  349::517     9e-05  28%  927 aa  ODO1_RICBR RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  105::181     9e-05  30%  648 aa  DXS_SYMTH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     9e-05  33%  628 aa  DXS_PROMT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     9e-05  34%  637 aa  DXS_PROMP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     9e-05  33%  629 aa  DXS_PROM9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     9e-05  37%  629 aa  DXS_PROM2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     9e-05  33%  628 aa  DXS_PROM1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     9e-05  37%  629 aa  DXS_PROM0 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  184::247     9e-05  30%  719 aa  DXS_CAPAN RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate
  127::196     9e-05  29%  640 aa  DXS_ACIAD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  327::466     9e-05  31%  920 aa  DHTK1_DANRE RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
  123::247     1e-04  28%  623 aa  TKT_RAT RecName: Full=Transketolase;         Short=TK;       
   94::195     1e-04  29%  596 aa  TKTL1_MACFA RecName: Full=Transketolase-like protein 1;       
  351::519     1e-04  27%  928 aa  ODO1_RICCN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUSU RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUSI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUO2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUME RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUMB RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUC2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUAB RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUA2 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  408::566     1e-04  25% 1004 aa  ODO1_BRUA1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  122::185     1e-04  33%  637 aa  DXS_RALME RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     1e-04  33%  629 aa  DXS_PROMS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  113::219     1e-04  24%  631 aa  DXS_NATTJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  400::565     2e-04  27%  977 aa  ODO1_RICFE RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  398::578     2e-04  20% 1029 aa  ODO1_CAEEL RecName: Full=2-oxoglutarate dehydrogenase E1 component,
  356::540     2e-04  24%  943 aa  ODO1_AZOVI RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  111::184     2e-04  37%  648 aa  DXS_SYNJB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::193     2e-04  28%  642 aa  DXS_SPHAL RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::193     2e-04  26%  641 aa  DXS_RHOPT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::193     2e-04  26%  641 aa  DXS_RHOPA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  122::185     2e-04  30%  636 aa  DXS_RALSO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  123::247     2e-04  28%  623 aa  TKT_MOUSE RecName: Full=Transketolase;         Short=TK;       
  342::487     2e-04  23%  920 aa  ODO1_LEPIN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  342::487     2e-04  23%  920 aa  ODO1_LEPIC RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  396::576     2e-04  20% 1027 aa  ODO1_CAEBR RecName: Full=2-oxoglutarate dehydrogenase E1 component,
  112::209     2e-04  23%  638 aa  DXS_SYNWW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  122::185     2e-04  33%  638 aa  DXS_RALEJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
   73::222     2e-04  24%  680 aa  DXS_PSYCK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  107::179     2e-04  29%  615 aa  DXS_CAMJD RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  145::245     2e-04  24%  661 aa  DXS_BRAJA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  180::248     2e-04  28%  717 aa  DXS_ARATH RecName: Full=Probable 1-deoxy-D-xylulose-5-phosphate
  364::517     3e-04  27%  945 aa  ODO1_BACHD RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  118::193     3e-04  26%  640 aa  DXS_RHOP5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  122::185     3e-04  33%  638 aa  DXS_RALEH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  116::186     3e-04  28%  636 aa  DXS_CYTH3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  122::185     3e-04  33%  638 aa  DXS_CUPTR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  121::189     3e-04  28%  623 aa  DXS_BAUCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  127::196     3e-04  27%  637 aa  DXS_ACIBY RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  127::196     3e-04  27%  637 aa  DXS_ACIBS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::193     3e-04  26%  645 aa  DXS2_RHORT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
  118::193     3e-04  26%  645 aa  DXS1_RHORT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
  353::534     3e-04  22%  935 aa  ODO1_HAEIN RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  109::182     3e-04  32%  643 aa  DXS_SYNS9 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  152::222     3e-04  25%  680 aa  DXS_PSYA2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  105::182     3e-04  30%  631 aa  DXS_PROM5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  128::198     3e-04  27%  643 aa  DXS_HAHCH RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  100::172     3e-04  27%  600 aa  DXS_CAMFF RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  111::184     4e-04  32%  649 aa  DXS_SYNJA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::196     4e-04  25%  631 aa  DXS_PSEPW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::196     4e-04  25%  631 aa  DXS_PSEPK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::196     4e-04  25%  631 aa  DXS_PSEPG RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::196     4e-04  25%  631 aa  DXS_PSEP1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     4e-04  33%  643 aa  DXS_PROM4 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  108::200     4e-04  24%  619 aa  DXS_CLOBA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  116::226     4e-04  25%  635 aa  DXS_BART1 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  313::500     4e-04  26%  920 aa  DHTK1_RAT RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
  322::489     4e-04  32%  911 aa  DHTK1_CAEEL RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
  109::182     6e-04  30%  635 aa  DXS_TRIEI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::193     6e-04  28%  639 aa  DXS_SPHWW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::233     6e-04  29%  638 aa  DXS_RHILW RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::233     6e-04  29%  638 aa  DXS_RHIE6 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     6e-04  32%  644 aa  DXS_PROMM RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     6e-04  32%  644 aa  DXS_PROM3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  123::185     6e-04  29%  637 aa  DXS_PELUB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  115::185     6e-04  24%  618 aa  DXS_DECAR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  108::200     6e-04  24%  619 aa  DXS_CLOBB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  107::179     6e-04  27%  615 aa  DXS_CAMJR RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  107::179     6e-04  27%  615 aa  DXS_CAMJJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  107::179     6e-04  27%  615 aa  DXS_CAMJE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::188     6e-04  25%  650 aa  DXS2_ZYMMO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 2;
  126::188     6e-04  25%  649 aa  DXS1_ZYMMO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase 1;
  109::182     7e-04  32%  640 aa  DXS_SYNR3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  123::190     7e-04  26%  638 aa  DXS_RHOPS RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  109::182     7e-04  32%  643 aa  DXS_PROMA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  114::188     7e-04  28%  640 aa  DXS_HYPNA RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  125::187     7e-04  27%  629 aa  DXS_DIAST RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::193     7e-04  28%  641 aa  DXS_BRASO RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  126::193     7e-04  28%  641 aa  DXS_BRASB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  116::193     7e-04  27%  638 aa  DXS_BARBK RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  125::187     7e-04  27%  629 aa  DXS_ACISJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  349::528     0.001  25%  933 aa  ODO1_STAS1 RecName: Full=2-oxoglutarate dehydrogenase E1 component;
  396::555     0.001  27% 1009 aa  ODO1_SCHPO RecName: Full=2-oxoglutarate dehydrogenase E1 component,
  109::182     0.001  33%  647 aa  DXS_SYNS3 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  117::185     0.001  26%  614 aa  DXS_PASMU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  150::250     0.001  23%  666 aa  DXS_NITWN RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::186     0.001  26%  617 aa  DXS_HAEDU RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  121::189     0.001  26%  608 aa  DXS_BUCAT RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  121::189     0.001  23%  585 aa  DXS_BUCAP RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  121::189     0.001  26%  608 aa  DXS_BUCAI RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  121::189     0.001  26%  608 aa  DXS_BUCA5 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  121::189     0.001  28%  624 aa  DXS_BLOPB RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  116::193     0.001  27%  640 aa  DXS_BARHE RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::186     0.001  26%  617 aa  DXS_ACTPJ RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::186     0.001  26%  617 aa  DXS_ACTP7 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  118::186     0.001  26%  617 aa  DXS_ACTP2 RecName: Full=1-deoxy-D-xylulose-5-phosphate synthase;   
  326::490     0.001  24%  919 aa  DHTK1_HUMAN RecName: Full=Probable 2-oxoglutarate dehydrogenase E1
    1::344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxKKSAAKETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
ODPA_RHIME      ----RKTAAKPAKKDFAGGT----IAEFSKEDDLKAYREMLLIRRFEEKAGQLYGMGFIGGFCHLYIGQE
ODPA_ZYMMO      -----------------------------REELLEFYRRMLMIRRFEERCGQLYGLGLIAGFCHLYIGQE
ODPA_RICCN      ----------------------------TKEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQE
ODPA_RICFE      -----------------------------------SFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQE
ODPA_RICBR      -----------------------------KEEYIKSFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQE
ODPA_RICTY      -----------------------------------SFKDMLLLRRFEEKCGQLYGMGEIGGFCHLYIGQE
ODPA_RICPR      -----------------------------------SFKDMLLLRRFEEKCGQLYGMGKIGGFCHLYIGQE
ODPAT_RAT       ------------------GPPTSTV--LTREEALKYYRNMQVIRRMELKADQLYKQKFIRGFCHLCDGQE
ODPAT_MOUSE     ------------------GPPTSTV--LTRAEALKYYRTMQVIRRMELKADQLYKQKFIRGFCHLCDGQE
ODPA_SMIMA      ------------------GPPTTAV--LTREEGLKYYKIMQTVRRMELKADQLYKQKIIRGFCHLYDGQE
ODPA_MOUSE      ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_PIG        ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_BOVIN      ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_HUMAN      ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_DICDI      ------------------GPSDSTVTN--KDELISFFTEMSRFRRLETVCDGLYKKKLIRGFCHLYTGQE
ODPA_RAT        ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_PONAB      ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_PANTR      ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPAT_HUMAN     ------------------GPPVTTV--LTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQE
ODPA_MACFA      ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
ODPA_CAEEL      ----------------DNGPNTSVT--LNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQE
ODPT_ASCSU      ----------------------------TKEDALRYYTQMQTIRRMETAAGNLYKEKKVRGFCHLYSGQE
ODPA_SOLTU      ----------------NIDPPSRSVETSPKEL-MTFFKDMTEMRRMEIAADSLYKAKLIRGFCHLYDGQE
ODPA_PEA        ---------------------------------LSFFRTMALMRRMEIAADSLYKANLIRGFCHLYDGQE
ODPA_ASCSU      ----------------------------TKEDAVHYYTQMLTIRRMESAAGNLYKEKKVRGFCHLYSGQE
ODPA_YEAST      ----------------------------SKATLLQMYKDMVIIRRMEMACDALYKAKKIRGFCHLSVGQE
ODPA_KLULA      ----------------------------TKSNLLQMYKDMIIVRRMEMACDALYKAKKIRGFCHSSVGQE
ODPA1_ARATH     ----------------------SRSVESSSQELLDFFRTMALMRRMEIAADSLYKAKLIRGFCHLYDGQE
ODPA2_ARATH     ----------------------------------------------EIAADSLYKAKLIRGFCHLYDGQE
ODPA_SCHPO      --------------------------EVTKGELLGLYEKMVTIRRLELACDALYKAKKIRGFCHLSIGQE
ODPA_PORPU      -----------------SYPKKVELPNLTKHKLLVLYEDMLLGRNFEDMCAQMYYKGKMFGFVHLYNGQE
ACOA_RALEH      -----------------------------KETLLTVYRKMRTIRDFEERLHVDFGRGDIPGFVHLYAGEE
ODPA_PORYE      --------------------------NLNKSNLLVLYEDMLLGRNFEDMCAQMYYKGKMFGFVHLYNGQE
ODPA_STAAR      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_STAES      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_STAEQ      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_BACSU      ---------------------EAAMPDLTDDQLKELMRRMVFTRVLDQRSISLNRQGRLGFYAPT-AGQE
ODBA_RAT        ----------------------SEDPHLPQEEVLKLYRSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
ODBA_BACSU      ----------------------------TDQEAVDMYRTMLLARKIDERMWLLNRSGKIP-FVISCQGQE
ODPA_STAAW      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_STAAS      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_STAAN      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_STAAM      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODPA_STAAC      ------------------------VPDLTDEQLVELMERMVWTRILDQRSISLNRQGRLGFYAPT-AGQE
ODBA_MOUSE      ----------------------SEDPHLPQEEVLKFYRSMTLLNTMDRILYESQREGRISFYMTNY-GEE
ODBA_PANTR      ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
ODBA_HUMAN      ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
ODBA_MACFA      ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
ODBA_THET8      --------------------------DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHE
ODBA_THET2      --------------------------DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHE
ODBA_BOVIN      ----------------------SEDPHLPQEKVLKFYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
ODPA_MYCGE      ----------------------------TDEQLKHAYYLMNLSRMMDKKMLVWQRAGKMLNFAP-NLGEE
ODPA_MYCPN      ----------------------------SNEQLKHAFYLMNLSRIMDKKMLVWQRAGKMLNFAP-NLGEE
ODPA_ACHLA      --------------DQNGKVVNEKMPKLPKETLLKMYKTAVLGRNADIKALQYQRQGRMLTYAP-NMGQE
ODPA_BACST      ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
ODBA_DICDI      -------------------------PNFSKEEVIKMYTTMLTLNVMDSILYDVQRQGRIS-FYMTSFGEE
ODBA_PSEAE      -------------------------PQLSNEQLLRGMRAMLKTRLFDARMLTAQRQKKLSFYMQC-LGEE
ODPA_BACCE      ---------------------EAAMPELSDDQLKELMRRMVYTRVLDQRSISLNRQGRLGFYAPT-AGQE
ODBA_PSEPU      ------------------------------------------------------------------LGEE
KGD_MYCS2       ----------------------------------------------------------------------
TKTL2_MOUSE     ----------------------------------------------------------------------
ODO1_CORGL      ----------------------------------------------------------------------
KGD_MYCUA       ----------------------------------------------------------------------
DXS2_GEOMG      ----------------------------------------------------------------------
KGD_MYCLE       ----------------------------------------------------------------------
DXS_THERP       ----------------------------------------------------------------------
TKTL2_BOVIN     ----------------------------------------------------------------------
ODO1_STAAB      ----------------------------------------------------------------------
ODO1_DICDI      ----------------------------------------------------------------------
KGD_MYCTU       ----------------------------------------------------------------------
KGD_MYCTA       ----------------------------------------------------------------------
KGD_MYCBP       ----------------------------------------------------------------------
KGD_MYCBO       ----------------------------------------------------------------------
ODO1_BACSU      ----------------------------------------------------------------------
DXS_HELPJ       ----------------------------------------------------------------------
DXS_ARCB4       ----------------------------------------------------------------------
KGD_MYCSS       ----------------------------------------------------------------------
KGD_MYCSK       ----------------------------------------------------------------------
KGD_MYCSJ       ----------------------------------------------------------------------
TKTL2_HUMAN     ----------------------------------------------------------------------
DHTK1_XENLA     ----------------------------------------------------------------------
TKT_PONAB       ----------------------------------------------------------------------
ODO1_STAAU      ----------------------------------------------------------------------
ODO1_STAAR      ----------------------------------------------------------------------
ODO1_STAAN      ----------------------------------------------------------------------
ODO1_STAAM      ----------------------------------------------------------------------
ODO1_STAA9      ----------------------------------------------------------------------
ODO1_STAA2      ----------------------------------------------------------------------
ODO1_STAA1      ----------------------------------------------------------------------
ODO1_BACLD      ----------------------------------------------------------------------
DXS_SULDN       ----------------------------------------------------------------------
TKT_BOVIN       ----------------------------------------------------------------------
ODO1_BACA2      ----------------------------------------------------------------------
TKT_PANTR       ----------------------------------------------------------------------
TKT_HUMAN       ----------------------------------------------------------------------
ODO1_STAAW      ----------------------------------------------------------------------
ODO1_STAAT      ----------------------------------------------------------------------
ODO1_STAAS      ----------------------------------------------------------------------
ODO1_STAAE      ----------------------------------------------------------------------
ODO1_STAAC      ----------------------------------------------------------------------
ODO1_STAA8      ----------------------------------------------------------------------
ODO1_STAA3      ----------------------------------------------------------------------
ODO1_BACP2      ----------------------------------------------------------------------
DXS_THIDA       ----------------------------------------------------------------------
TKTL1_MOUSE     ----------------------------------------------------------------------
ODO1_RICPR      ----------------------------------------------------------------------
ODO1_BACSK      ----------------------------------------------------------------------
KGD_MYCPA       ----------------------------------------------------------------------
DXS_CAMHC       ----------------------------------------------------------------------
DXS1_GEOSL      ----------------------------------------------------------------------
ODO1_STAHJ      ----------------------------------------------------------------------
ODO1_BACWK      ----------------------------------------------------------------------
ODO1_BACHK      ----------------------------------------------------------------------
ODO1_BACCZ      ----------------------------------------------------------------------
ODO1_BACCQ      ----------------------------------------------------------------------
ODO1_BACC7      ----------------------------------------------------------------------
ODO1_BACC3      ----------------------------------------------------------------------
ODO1_BACC0      ----------------------------------------------------------------------
ODO1_BACAN      ----------------------------------------------------------------------
ODO1_BACAC      ----------------------------------------------------------------------
ODO1_BACAA      ----------------------------------------------------------------------
KGD_MYCVP       ----------------------------------------------------------------------
DXS_RALPJ       ----------------------------------------------------------------------
DXS_NITSB       ----------------------------------------------------------------------
TKT_MACFA       ----------------------------------------------------------------------
TKTL1_HUMAN     ----------------------------------------------------------------------
ODO1_RICTY      ----------------------------------------------------------------------
ODO1_BACCR      ----------------------------------------------------------------------
ODO1_BACC4      ----------------------------------------------------------------------
ODO1_BACC2      ----------------------------------------------------------------------
DXS_HELPY       ----------------------------------------------------------------------
DXS_HELPH       ----------------------------------------------------------------------
DXS_HELPG       ----------------------------------------------------------------------
DXS_FRATW       ----------------------------------------------------------------------
DXS_FRATT       ----------------------------------------------------------------------
DXS_FRATO       ----------------------------------------------------------------------
DXS_FRATN       ----------------------------------------------------------------------
DXS_FRATM       ----------------------------------------------------------------------
DXS_FRATH       ----------------------------------------------------------------------
DXS_FRATF       ----------------------------------------------------------------------
DXS_FRAT1       ----------------------------------------------------------------------
DXS_FRAP2       ----------------------------------------------------------------------
DXS_ERYLH       ----------------------------------------------------------------------
ODO1_BACC1      ----------------------------------------------------------------------
DXS_SYNPX       ----------------------------------------------------------------------
ODO1_RICBR      ----------------------------------------------------------------------
DXS_SYMTH       ----------------------------------------------------------------------
DXS_PROMT       ----------------------------------------------------------------------
DXS_PROMP       ----------------------------------------------------------------------
DXS_PROM9       ----------------------------------------------------------------------
DXS_PROM2       ----------------------------------------------------------------------
DXS_PROM1       ----------------------------------------------------------------------
DXS_PROM0       ----------------------------------------------------------------------
DXS_CAPAN       ----------------------------------------------------------------------
DXS_ACIAD       ----------------------------------------------------------------------
DHTK1_DANRE     ----------------------------------------------------------------------
TKT_RAT         ----------------------------------------------------------------------
TKTL1_MACFA     ----------------------------------------------------------------------
ODO1_RICCN      ----------------------------------------------------------------------
ODO1_BRUSU      ----------------------------------------------------------------------
ODO1_BRUSI      ----------------------------------------------------------------------
ODO1_BRUO2      ----------------------------------------------------------------------
ODO1_BRUME      ----------------------------------------------------------------------
ODO1_BRUMB      ----------------------------------------------------------------------
ODO1_BRUC2      ----------------------------------------------------------------------
ODO1_BRUAB      ----------------------------------------------------------------------
ODO1_BRUA2      ----------------------------------------------------------------------
ODO1_BRUA1      ----------------------------------------------------------------------
DXS_RALME       ----------------------------------------------------------------------
DXS_PROMS       ----------------------------------------------------------------------
DXS_NATTJ       ----------------------------------------------------------------------
ODO1_RICFE      ----------------------------------------------------------------------
ODO1_CAEEL      ----------------------------------------------------------------------
ODO1_AZOVI      ----------------------------------------------------------------------
DXS_SYNJB       ----------------------------------------------------------------------
DXS_SPHAL       ----------------------------------------------------------------------
DXS_RHOPT       ----------------------------------------------------------------------
DXS_RHOPA       ----------------------------------------------------------------------
DXS_RALSO       ----------------------------------------------------------------------
TKT_MOUSE       ----------------------------------------------------------------------
ODO1_LEPIN      ----------------------------------------------------------------------
ODO1_LEPIC      ----------------------------------------------------------------------
ODO1_CAEBR      ----------------------------------------------------------------------
DXS_SYNWW       ----------------------------------------------------------------------
DXS_RALEJ       ----------------------------------------------------------------------
DXS_PSYCK       ----------------------------------------------------LYSAGQSGGHFGANLGVI
DXS_CAMJD       ----------------------------------------------------------------------
DXS_BRAJA       ----------------------------------------------------------------------
DXS_ARATH       ----------------------------------------------------------------------
ODO1_BACHD      ----------------------------------------------------------------------
DXS_RHOP5       ----------------------------------------------------------------------
DXS_RALEH       ----------------------------------------------------------------------
DXS_CYTH3       ----------------------------------------------------------------------
DXS_CUPTR       ----------------------------------------------------------------------
DXS_BAUCH       ----------------------------------------------------------------------
DXS_ACIBY       ----------------------------------------------------------------------
DXS_ACIBS       ----------------------------------------------------------------------
DXS2_RHORT      ----------------------------------------------------------------------
DXS1_RHORT      ----------------------------------------------------------------------
ODO1_HAEIN      ----------------------------------------------------------------------
DXS_SYNS9       ----------------------------------------------------------------------
DXS_PSYA2       ----------------------------------------------------------------------
DXS_PROM5       ----------------------------------------------------------------------
DXS_HAHCH       ----------------------------------------------------------------------
DXS_CAMFF       ----------------------------------------------------------------------
DXS_SYNJA       ----------------------------------------------------------------------
DXS_PSEPW       ----------------------------------------------------------------------
DXS_PSEPK       ----------------------------------------------------------------------
DXS_PSEPG       ----------------------------------------------------------------------
DXS_PSEP1       ----------------------------------------------------------------------
DXS_PROM4       ----------------------------------------------------------------------
DXS_CLOBA       ----------------------------------------------------------------------
DXS_BART1       ----------------------------------------------------------------------
DHTK1_RAT       ----------------------------------------------------------------------
DHTK1_CAEEL     ----------------------------------------------------------------------
DXS_TRIEI       ----------------------------------------------------------------------
DXS_SPHWW       ----------------------------------------------------------------------
DXS_RHILW       ----------------------------------------------------------------------
DXS_RHIE6       ----------------------------------------------------------------------
DXS_PROMM       ----------------------------------------------------------------------
DXS_PROM3       ----------------------------------------------------------------------
DXS_PELUB       ----------------------------------------------------------------------
DXS_DECAR       ----------------------------------------------------------------------
DXS_CLOBB       ----------------------------------------------------------------------
DXS_CAMJR       ----------------------------------------------------------------------
DXS_CAMJJ       ----------------------------------------------------------------------
DXS_CAMJE       ----------------------------------------------------------------------
DXS2_ZYMMO      ----------------------------------------------------------------------
DXS1_ZYMMO      ----------------------------------------------------------------------
DXS_SYNR3       ----------------------------------------------------------------------
DXS_RHOPS       ----------------------------------------------------------------------
DXS_PROMA       ----------------------------------------------------------------------
DXS_HYPNA       ----------------------------------------------------------------------
DXS_DIAST       ----------------------------------------------------------------------
DXS_BRASO       ----------------------------------------------------------------------
DXS_BRASB       ----------------------------------------------------------------------
DXS_BARBK       ----------------------------------------------------------------------
DXS_ACISJ       ----------------------------------------------------------------------
ODO1_STAS1      ----------------------------------------------------------------------
ODO1_SCHPO      ----------------------------------------------------------------------
DXS_SYNS3       ----------------------------------------------------------------------
DXS_PASMU       ----------------------------------------------------------------------
DXS_NITWN       ----------------------------------------------------------------------
DXS_HAEDU       ----------------------------------------------------------------------
DXS_BUCAT       ----------------------------------------------------------------------
DXS_BUCAP       ----------------------------------------------------------------------
DXS_BUCAI       ----------------------------------------------------------------------
DXS_BUCA5       ----------------------------------------------------------------------
DXS_BLOPB       ----------------------------------------------------------------------
DXS_BARHE       ----------------------------------------------------------------------
DXS_ACTPJ       ----------------------------------------------------------------------
DXS_ACTP7       ----------------------------------------------------------------------
DXS_ACTP2       ----------------------------------------------------------------------
DHTK1_HUMAN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGI
ODPA_RHIME      AVVVGMQLALKEGDQVITGYRDHGHMLACGMSARGVMAEXXXXXXXXXXXXXXXMHMFSKEKHFYGGHGI
ODPA_ZYMMO      AVAVGLQAALQPGDSVITGYREHGHMLAYGIDPKIVMAELTGRASGISHGKGGSMHMFSTEHKFFGGNGI
ODPA_RICCN      AVISAIDMVKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFNVPNKFYGGHGI
ODPA_RICFE      AVISAVDTVKQKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFDIPNKFYGGHGI
ODPA_RICBR      AVISAVDMVKQKEDSMVTSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFDVPNKFYGGHGI
ODPA_RICTY      AVISAVELIKKKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFDIPNKFYGGHGI
ODPA_RICPR      AVISAVAMIKKKGDSTITSYRDHAHIILAGTEPKYVLAELMGRATGCSKGKGGSMHLFDIPNKFYGGHGI
ODPAT_RAT       ACNVGLEAGINPTDHIITSYRAHGLCYTRGLSVKSILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPAT_MOUSE     ACCVGLEAGINPTDHVITSYRAHGFCYTRGLSVKSILAELTXXXXXXXXXXXXSMHMYG--KNFYGGNGI
ODPA_SMIMA      ACCMGLEAGINPTDHVITAYRAHGFTYTRGLPVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_MOUSE      ACCVGLEAGINPTDHLITAYRAHGFTFTRGLPVRAILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_PIG        ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_BOVIN      ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_HUMAN      ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_DICDI      AVCAGLESAITKDDHIITAYRDHTYMLSRGATPEEIFAELLMKETGCSKGKGGSMHMFT--KNFYGGNGI
ODPA_RAT        ACCVGLEAGINPTDHLITAYRAHGFTFNRGHAVRAILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_PONAB      ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPA_PANTR      ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
ODPAT_HUMAN     ACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTXXXXXXXXXXXXSMHMYT--KNFYGGNGI
ODPA_MACFA      ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSTHMYA--KNFYRGNGI
ODPA_CAEEL      ACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYT--KNFYGGNGI
ODPT_ASCSU      ACAVGMKAAMEPGDAAITAYRCHGWTYLSGSPVAKVLCELTGRITGNVYGKGGSMHMYG--ENFYGGNGI
ODPA_SOLTU      AVAVGMEAAITKKDCIITAYRDHCIFLGRGGTLVEAFAELMGRRDGCSRGKGGSMHFYKKESGFYGGHGI
ODPA_PEA        AVAVGMEAGTTKKDCIITAYRDHCTFLGRGGTLLRVYAELMGRRDGCSKGKGGSMHFYKKDSGFYGGHGI
ODPA_ASCSU      ACAVXXXXXXXXXXXXXXXYRCHGWTYLSGSSVAKVLCELTGRITGNVYGKGGSMHMYG--ENFYGGNGI
ODPA_YEAST      AIAVGIENAITKLDSIITSYRCHGFTFMRGASVKAVLAELMGRRAGVSYGKGGSMHLYA--PGFYGGNGI
ODPA_KLULA      AIAVGIENAITKRDTVITSYRCHGFTYMRGAAVQAVLAELMGRRTGVSFGKGGSMHLYA--PGFYGGNGI
ODPA1_ARATH     AVAIGMEXXXXXXXXXXXXYRDHCIFLGRGGSLHEVFSELMGRQAGCSKGKGGSMHFYKKESSFYGGHGI
ODPA2_ARATH     ALAVGMEAAITKKDAIITSYRDHCTFIGRGGKLVDAFSELMGRKTGCSHGKGGSMHFYKKDASFYGGHGI
ODPA_SCHPO      AVAAGIEGAITLDDSIITSYRCHGFAYTRGLSIRSIIGELMGRQCGASKGKGGSMHIFA--KNFYGGNGI
ODPA_PORPU      AVSTGVIKLLDSKDYVCSTYRDHVHALSKGVPSQNVMAELFGKETGCSRGRGGSMHIFSAPHNFLGGFAF
ACOA_RALEH      AAGVGILHHLNDGDRIASTHRGHGHCIAKGVDPVAMMKEIYXXXXXXXXXXXXXMHIADLSKGMMGANGI
ODPA_PORYE      AVSTGVIKLLNPTDYVCSTYRDHVHALSKGVPSKNVMAELFGKETGCSKGRGGSMHIFSAPHNFLGGFAF
ODPA_STAAR      ASQLASQYALEKEDYILPGYRDVPQI---------IWHGLPLTEAFLFSRGHFKGNQFPEGVNALSPQII
ODPA_STAES      ASQLASQYALESEDFILPGYRDVPQI---------IWHGLPLTDAFLFSRGHFKGNQFPEGVNALSPQII
ODPA_STAEQ      ASQLASQYALESEDFILPGYRDVPQI---------IWHGLPLTDAFLFSRGHFKGNQFPEGVNALSPQII
ODPA_BACSU      ASQIATHFALEKEDFVLPGYRDVPQLIWHGLPL--YQAFLFSRGHFRGNQMPDDVNALSPQI-------I
ODBA_RAT        GTHVGSAAALERTDLVFGQYREAGVLMYRDYPLELFMAQCYGNVSDPGKGRQMPVHYGCKERHFVTISSP
ODBA_BACSU      AAQVGAAFALREMDYVLPYYRDMGVVLAFGMTAKDLMMSFAKAADPNSGGRQMPGHFGQKKNRIVTGSSP
ODPA_STAAW      ASQLASQYALEKEDYILPGYRDVPQII-------------------WHGLPLTEAFLFS-RGHFKGNQFP
ODPA_STAAS      ASQLASQYALEKEDYILPGYRDVPQII-------------------WHGLPLTEAFLFS-RGHFKGNQFP
ODPA_STAAN      ASQLASQYALEKEDYILPGYRDVPQII-------------------WHGLPLTEAFLFS-RGHFKGNQFP
ODPA_STAAM      ASQLASQYALEKEDYILPGYRDVPQII-------------------WHGLPLTEAFLFS-RGHFKGNQFP
ODPA_STAAC      ASQLASQYALEKEDYILPGYRDVPQII-------------------WHGLPLTEAFLFS-RGHFKGNQFP
ODBA_MOUSE      GTHVGSAAALERTDLVFGQYREAGVLMYRDYPLELFMSQCYGNVNDPGKGRQMPVHYGCKERHFVTISSP
ODBA_PANTR      GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
ODBA_HUMAN      GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
ODBA_MACFA      GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
ODBA_THET8      AAQVAIAHAIRPGDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
ODBA_THET2      AAQVAIAHAIRPGDWVFPYYRDHGLALALGIPLKELFGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
ODBA_BOVIN      GTHVGSAAALDDTDLVFGQYREAGVLMYRDYPLELFMAQCYGNVSDLGKGRQMPVHYGCRERHFVTISSP
ODPA_MYCGE      ALQVGMGLGLNENDWVCPTFRSGALMLY-----RGVKPEQLLLYWNGNEKGS----QIDAKYKTLPINIT
ODPA_MYCPN      ALQVGMGMGLNENDWFCPTFRSGALMLY-----RGVKPEQLLLYWNGNENGSKIEAKYKTLPI----NIT
ODPA_ACHLA      AAQIGMAAAMEPQDWNSPMYRELNTLLYRGDKLENVF-----------------LYWYGNERGSIKPEGI
ODPA_BACST      ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
ODBA_DICDI      AIHIGSAAALEMSDTIFAQYRETGVFMWRGFTINDIINQCCTNEHDLGKGRQMPMHFGSRKINLQTISSP
ODBA_PSEAE      AIATAHTLALRDGDMCFPTYRQQGILITREYPLVDMICQLLSNEADPLKGRQLPIMYSSKEAGFFSISGN
ODPA_BACCE      ASQLASHFALEAEDFILPGYRDVPQL---------VWHGLPLYQAFLFSRGHFMGNQMPENVNXXXXXXX
ODBA_PSEPU      AIGSGQALALNRTDMCFPTYRQQSILMARDVSLVEMICQLLSNERDPLKGRQLPIMYSVREAGFFTISGN
KGD_MYCS2       ----------------------------------------------------------------------
TKTL2_MOUSE     --------------------------------------------------------------------GS
ODO1_CORGL      ----------------------------------------------------------------------
KGD_MYCUA       ----------------------------------------------------------------------
DXS2_GEOMG      ----------------------------------------------------------SESPHDAFGAGH
KGD_MYCLE       --------------------------------------------------------------------GL
DXS_THERP       --------------KLVTGRRDRFHTIRQEGGLSGFLQREE-----------------SPHDHFGAGHA-
TKTL2_BOVIN     --------------------------------------------------------------------GS
ODO1_STAAB      ----------------------------------------------------------------------
ODO1_DICDI      ----------------------------------------------------------------------
KGD_MYCTU       ----------------------------------------------------------------------
KGD_MYCTA       ----------------------------------------------------------------------
KGD_MYCBP       ----------------------------------------------------------------------
KGD_MYCBO       ----------------------------------------------------------------------
ODO1_BACSU      ----------------------------------------------------------------------
DXS_HELPJ       --------------------------------------------------------------YFIAGHS-
DXS_ARCB4       --------------------------------------------------------------YFVAGHS-
KGD_MYCSS       ----------------------------------------------------------------------
KGD_MYCSK       ----------------------------------------------------------------------
KGD_MYCSJ       ----------------------------------------------------------------------
TKTL2_HUMAN     --------------------------------------------------------------------GS
DHTK1_XENLA     ----------------------------------------------------------------------
TKT_PONAB       --------------------------------------------------------------------GS
ODO1_STAAU      ----------------------------------------------------------------------
ODO1_STAAR      ----------------------------------------------------------------------
ODO1_STAAN      ----------------------------------------------------------------------
ODO1_STAAM      ----------------------------------------------------------------------
ODO1_STAA9      ----------------------------------------------------------------------
ODO1_STAA2      ----------------------------------------------------------------------
ODO1_STAA1      ----------------------------------------------------------------------
ODO1_BACLD      ----------------------------------------------------------------------
DXS_SULDN       ----------------------------------------------------------SEHDYFVAGHSS
TKT_BOVIN       --------------------------------------------------------------------GS
ODO1_BACA2      ----------------------------------------------------------------------
TKT_PANTR       --------------------------------------------------------------------GS
TKT_HUMAN       --------------------------------------------------------------------GS
ODO1_STAAW      ----------------------------------------------------------------------
ODO1_STAAT      ----------------------------------------------------------------------
ODO1_STAAS      ----------------------------------------------------------------------
ODO1_STAAE      ----------------------------------------------------------------------
ODO1_STAAC      ----------------------------------------------------------------------
ODO1_STAA8      ----------------------------------------------------------------------
ODO1_STAA3      ----------------------------------------------------------------------
ODO1_BACP2      ----------------------------------------------------------------------
DXS_THIDA       ---------------------------------------------------------------FGTGHSS
TKTL1_MOUSE     --------------------------------------------------------------------GW
ODO1_RICPR      ----------------------------------------------------------------------
ODO1_BACSK      ----------------------------------------------------------------------
KGD_MYCPA       ----------------------------------------------------------------------
DXS_CAMHC       --------------------------------------------------------------YFVAGHS-
DXS1_GEOSL      ---------------------------------------------------------------FDTGHS-
ODO1_STAHJ      ----------------------------------------------------------------------
ODO1_BACWK      ----------------------------------------------------------------------
ODO1_BACHK      ----------------------------------------------------------------------
ODO1_BACCZ      ----------------------------------------------------------------------
ODO1_BACCQ      ----------------------------------------------------------------------
ODO1_BACC7      ----------------------------------------------------------------------
ODO1_BACC3      ----------------------------------------------------------------------
ODO1_BACC0      ----------------------------------------------------------------------
ODO1_BACAN      ----------------------------------------------------------------------
ODO1_BACAC      ----------------------------------------------------------------------
ODO1_BACAA      ----------------------------------------------------------------------
KGD_MYCVP       ----------------------------------------------------------------------
DXS_RALPJ       ----------------------------------------------------------------------
DXS_NITSB       --------------------------------------------------------------YWVAGHS-
TKT_MACFA       --------------------------------------------------------------------GS
TKTL1_HUMAN     --------------------------------------------------------------------GW
ODO1_RICTY      ----------------------------------------------------------------------
ODO1_BACCR      ----------------------------------------------------------------------
ODO1_BACC4      ----------------------------------------------------------------------
ODO1_BACC2      ----------------------------------------------------------------------
DXS_HELPY       --------------------------------------------------------------YFIAGHS-
DXS_HELPH       --------------------------------------------------------------YFIAGHS-
DXS_HELPG       --------------------------------------------------------------YFIAGHS-
DXS_FRATW       ------------------------------------------------------------------GVGH
DXS_FRATT       ------------------------------------------------------------------GVGH
DXS_FRATO       ------------------------------------------------------------------GVGH
DXS_FRATN       ------------------------------------------------------------------GVGH
DXS_FRATM       ------------------------------------------------------------------GVGH
DXS_FRATH       ------------------------------------------------------------------GVGH
DXS_FRATF       ------------------------------------------------------------------GVGH
DXS_FRAT1       ------------------------------------------------------------------GVGH
DXS_FRAP2       ------------------------------------------------------------------GVGH
DXS_ERYLH       ----------------------------------------------------------------------
ODO1_BACC1      ----------------------------------------------------------------------
DXS_SYNPX       --------------------------------------------------------------HFGAGHAS
ODO1_RICBR      ----------------------------------------------------------------------
DXS_SYMTH       ----------------------------------------------------------SVHDHFHWGHA-
DXS_PROMT       --------------------------------------------------------------HFGAGHA-
DXS_PROMP       --------------------------------------------------------------HFGAGHAS
DXS_PROM9       --------------------------------------------------------------HFGAGHA-
DXS_PROM2       --------------------------------------------------------------HFGAGHAS
DXS_PROM1       --------------------------------------------------------------HFGAGHA-
DXS_PROM0       --------------------------------------------------------------HFGAGHAS
DXS_CAPAN       ------------------------------------------------------------------GTGH
DXS_ACIAD       ------------------------------------------------------------------GVGH
DHTK1_DANRE     ----------------------------------------------------------------------
TKT_RAT         --------------------------------------------------------------------GS
TKTL1_MACFA     --------------------------------------------------------------------GW
ODO1_RICCN      ----------------------------------------------------------------------
ODO1_BRUSU      ----------------------------------------------------------------------
ODO1_BRUSI      ----------------------------------------------------------------------
ODO1_BRUO2      ----------------------------------------------------------------------
ODO1_BRUME      ----------------------------------------------------------------------
ODO1_BRUMB      ----------------------------------------------------------------------
ODO1_BRUC2      ----------------------------------------------------------------------
ODO1_BRUAB      ----------------------------------------------------------------------
ODO1_BRUA2      ----------------------------------------------------------------------
ODO1_BRUA1      ----------------------------------------------------------------------
DXS_RALME       ----------------------------------------------------------------------
DXS_PROMS       --------------------------------------------------------------HFGAGHA-
DXS_NATTJ       ------------------------------------------------------------------GTGH
ODO1_RICFE      ----------------------------------------------------------------------
ODO1_CAEEL      ----------------------------------------------------------------------
ODO1_AZOVI      ----------------------------------------------------------------------
DXS_SYNJB       --------------------------------------------------------------HFGAGHAS
DXS_SPHAL       ----------------------------------------------------------------------
DXS_RHOPT       ------------------------------------------------------------------GAGH
DXS_RHOPA       ------------------------------------------------------------------GAGH
DXS_RALSO       ----------------------------------------------------------------------
TKT_MOUSE       --------------------------------------------------------------------GS
ODO1_LEPIN      ----------------------------------------------------------------------
ODO1_LEPIC      ----------------------------------------------------------------------
ODO1_CAEBR      ----------------------------------------------------------------------
DXS_SYNWW       ---------------------------------------------------------------FNTGHS-
DXS_RALEJ       ----------------------------------------------------------------------
DXS_PSYCK       ELTIALHYLLTPQDQIVVGHQAYAHVLTGRRDQLGTIRSKTGLTAFPERAE-------SVYDTFGVGHS-
DXS_CAMJD       --------------------------------------------------------------YFVAGHS-
DXS_BRAJA       ----------------------------------------------------------------------
DXS_ARATH       -------------------------------------------------------------EHDCFGTGH
ODO1_BACHD      ----------------------------------------------------------------------
DXS_RHOP5       ------------------------------------------------------------------GAGH
DXS_RALEH       ----------------------------------------------------------------------
DXS_CYTH3       ------------------------------------------------------------------GVGH
DXS_CUPTR       ----------------------------------------------------------------------
DXS_BAUCH       --------------------------------------------------------------------GH
DXS_ACIBY       ------------------------------------------------------------------GVGH
DXS_ACIBS       ------------------------------------------------------------------GVGH
DXS2_RHORT      ------------------------------------------------------------------GAGH
DXS1_RHORT      ------------------------------------------------------------------GAGH
ODO1_HAEIN      ----------------------------------------------------------------------
DXS_SYNS9       --------------------------------------------------------------HFGAGHA-
DXS_PSYA2       ------------------------------------------------------------------GVGH
DXS_PROM5       ----------------------------------------------------------SIFDHFGAGHA-
DXS_HAHCH       ------------------------------------------------------------------GVGH
DXS_CAMFF       --------------------------------------------------------------YFVAGHS-
DXS_SYNJA       --------------------------------------------------------------HFGAGHA-
DXS_PSEPW       ------------------------------------------------------------------GVGH
DXS_PSEPK       ------------------------------------------------------------------GVGH
DXS_PSEPG       ------------------------------------------------------------------GVGH
DXS_PSEP1       ------------------------------------------------------------------GVGH
DXS_PROM4       --------------------------------------------------------------HFGAGHA-
DXS_CLOBA       -------------------------------------------------------------KYDYFDTGH
DXS_BART1       ---------------------------------------------------------------FGAGHSS
DHTK1_RAT       ----------------------------------------------------------------------
DHTK1_CAEEL     ----------------------------------------------------------------------
DXS_TRIEI       --------------------------------------------------------------HFGAGHA-
DXS_SPHWW       ----------------------------------------------------------------------
DXS_RHILW       ----------------------------------------------------------------------
DXS_RHIE6       ----------------------------------------------------------------------
DXS_PROMM       --------------------------------------------------------------HFGAGHA-
DXS_PROM3       --------------------------------------------------------------HFGAGHA-
DXS_PELUB       ----------------------------------------------------------------------
DXS_DECAR       ------------------------------------------------------------------GVGH
DXS_CLOBB       -------------------------------------------------------------KYDYFDTGH
DXS_CAMJR       --------------------------------------------------------------YFVAGHS-
DXS_CAMJJ       --------------------------------------------------------------YFVAGHS-
DXS_CAMJE       --------------------------------------------------------------YFVAGHS-
DXS2_ZYMMO      ----------------------------------------------------------------------
DXS1_ZYMMO      ----------------------------------------------------------------------
DXS_SYNR3       --------------------------------------------------------------HFGAGHA-
DXS_RHOPS       ----------------------------------------------------------------------
DXS_PROMA       --------------------------------------------------------------HFGAGHA-
DXS_HYPNA       ----------------------------------------------------------------YDPFGA
DXS_DIAST       ----------------------------------------------------------------------
DXS_BRASO       ----------------------------------------------------------------------
DXS_BRASB       ----------------------------------------------------------------------
DXS_BARBK       ---------------------------------------------------------------FGAGHSS
DXS_ACISJ       ----------------------------------------------------------------------
ODO1_STAS1      ----------------------------------------------------------------------
ODO1_SCHPO      ----------------------------------------------------------------------
DXS_SYNS3       --------------------------------------------------------------HFGAGHAS
DXS_PASMU       --------------------------------------------------------------------GH
DXS_NITWN       ----------------------------------------------------------------------
DXS_HAEDU       --------------------------------------------------------------------GH
DXS_BUCAT       ------------------------------------------------------------------GHSS
DXS_BUCAP       ------------------------------------------------------------------GHSS
DXS_BUCAI       ------------------------------------------------------------------GHSS
DXS_BUCA5       ------------------------------------------------------------------GHSS
DXS_BLOPB       ------------------------------------------------------------------GHSS
DXS_BARHE       ---------------------------------------------------------------FGAGHSS
DXS_ACTPJ       --------------------------------------------------------------------GH
DXS_ACTP7       --------------------------------------------------------------------GH
DXS_ACTP2       --------------------------------------------------------------------GH
DHTK1_HUMAN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
ODPA_RHIME      VGAQVSLGTGLAFANRYRGNDNVSLAYFGDGAANQGQVYESFNMAALWKLPVIYIVENNRYAMGTSVSRA
ODPA_ZYMMO      VGAQVPLGAGLAFAHKYRNDGGCSAAYFGDGSANQGQVYEAYNMAALWKLPVIFVIENNGYAMGTSIQRA
ODPA_RICCN      VGAQVPIGTGLAFVEKYNDTHNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIENNEYSMGTSVARS
ODPA_RICFE      VGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIENNEYSMGTSVARS
ODPA_RICBR      VGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEAFNMAALWGLPVVYIIENNEYSMGTSVARS
ODPA_RICTY      VGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEAFNMASLWGLPVVYIIENNEYSMGTSVSRS
ODPA_RICPR      VGAQVPIGTGLAFAEKYNGTNNICFTFLGDGAVNQGQVYEAFNMASLWGLPIVYIIENNEYSMGTSVARS
ODPAT_RAT       VGAQVPLGAGVALACKYLKNGQICLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNRYGMGTAIERS
ODPAT_MOUSE     VGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNLYGMGTSNERS
ODPA_SMIMA      VGAQVPLGVGIALACKYNEKDEICLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_MOUSE      VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_PIG        VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCVFICENNRYGMGTSVERA
ODPA_BOVIN      VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_HUMAN      VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_DICDI      VGAQCPLGAGIAFAQKYNKTGNVCLAMYGDGAANQGQLFEAFNMASLWKLPVIFICENNKYGMGTSQKRS
ODPA_RAT        VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_PONAB      VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFGAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_PANTR      VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPAT_HUMAN     VGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERA
ODPA_MACFA      VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAADQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
ODPA_CAEEL      VGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERS
ODPT_ASCSU      VGAQQPLGTGIAFAMKYKKQKNVCITLFGDGATNQGQLYESMNMAKLWELPVLYVCENNGYGMGTSAARS
ODPA_SOLTU      VGAQVPLGIGLAFAQKYKKEDYVTFAMYGDGAANQGQLFEALNMAALWDLPAILVCENNHYGMGTAEWRA
ODPA_PEA        VGAQVPLGCGLAFGQKYLKDESVTFALYGDGAANQGQLFEALNISALWDLPAILVCENNHYGMGTATWRS
ODPA_ASCSU      VGAQQPLGTGIAFAMKYRKEKNVCITMFGDGATNQGQLFESMNMAKLWDLPVLYVCENNGYGMGTAAARS
ODPA_YEAST      VGAQVPLGAGLAFAHQYKNEDACSFTLYGDGASNQGQVFESFNMAKLWNLPVVFCCENNKYGMGTAASRS
ODPA_KLULA      VGAQVPLGAGLAFAHQYKHEDACSFALYGDGASNQGQVFESFNMAKLWNLPAVFCCENNKYGMGTAAARS
ODPA1_ARATH     VGAQVPLGCGIAFAQKYNKEEAVTFALYGDGAANQGQLFEALNISALWDLPAILVCENNHYGMGTAEWRA
ODPA2_ARATH     VGAQIPLGCGLAFAQKYNKDEAVTFALYGDGAANQGQLFEALNISALWDLPAILVCENNHYGMGTATWRS
ODPA_SCHPO      VGAQIPLGAGIGFAQKYLEKPTTTFALYGDGASNQGQAFEAFNMAKLWGLPVIFACENNKYGMGTSAERS
ODPA_PORPU      IAEGIPVATGAAFQSIYRQQVRVTACFFGDGTTNNGQFFECLNMAVLWKLPIIFVVENNQWAIGMAHHRS
ACOA_RALEH      LGAGAPLICGAALAAKFRGKGEVGITFCGDGASNQGTFLESLNLAAVWNLPVIFVIENNGYAESTSRDYG
ODPA_PORYE      IAEGIPVATGAAFQSIYREDLRVTACFFGDGTTNNGQFFECLNMAVLWKLPIIFVVENNQWAIGMAHHRS
ODPA_STAAR      IGAQYIQTAGVAFALKKRGKNAVAITYTGDGGSSQGDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_STAES      IGAQYIQTAGVAFGLKKRGKNAVAITYTGDGGSSQGDFYEGINFASAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_STAEQ      IGAQYIQTAGVAFGLKKRGKNAVAITYTGDGGSSQGDFYEGINFASAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_BACSU      IGAQYIQTAGVALGLKKRGKKAVAITYTGDGGASQGDFYEGINFAGAYKAPAIFVVQNNRYAISTPVEKQ
ODBA_RAT        LATQIPQXXXXXXXXXXXXXNQIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
ODBA_BACSU      VTTQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAISVPYDKQ
ODPA_STAAW      EGVNAXXXXXXXFALKKRGKNAVAITYTGDGGSSQGDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_STAAS      EGVNAXXXXXXXFALKKRGKNAVAITYTGDGGSSQGDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_STAAN      EGVNAXXXXXXXFALKKRGKNAVAITYTGDGGSSQGDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_STAAM      EGVNAXXXXXXXFALKKRGKNAVAITYTGDGGSSQGDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQ
ODPA_STAAC      EGVNAXXXXXXXFALKKRGKNAVAITYTGDGGSSQGDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQ
ODBA_MOUSE      LATQIPQXXXXXXXXXXXXXNRIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
ODBA_PANTR      LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
ODBA_HUMAN      LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
ODBA_MACFA      LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
ODBA_THET8      IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISVDYRHQ
ODBA_THET2      IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFVCENNFYAISVDYRHQ
ODBA_BOVIN      LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
ODPA_MYCGE      IGAQYSHAAGLGYMLHYKKQPNVAVTMIGDGGTAEGEFYEAMNIASIHKWNTVFCINNNQFAISTRTKLE
ODPA_MYCPN      IGAQYSHAAGLGYMLHYKKLPNVAVTMIGDGGTAEGEFYEAMNIASIHKWNSVFCINNNQFAISTRTKLE
ODPA_ACHLA      IGSQSNIAAGLAMASKIRKTNEVTAFTIGDGGTAHGEFYEGLNFAASFKAPVVAVIQNNQWAISTPVRKA
ODPA_BACST      EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
ODBA_DICDI      LTTQLPQAVGSSYAQKLAGEKNCTIVYFGEGAASEGDFHAAMNFAAALSTPTIFFCRNNKWAISTPSKEQ
ODBA_PSEAE      LATQFIQAVGWGMASAIKGDTRIASAWIGDGATAESDFHTALTFAHVYRAPVILNVVNNQWAISTFQAIA
ODPA_BACCE      XXXXXXXXXXXXLGMKLRGKKSVAITYTGDGGASQGDFYEGMNFAGAFKAPAIFVVQNNRYAISTPVEXX
ODBA_PSEPU      LATQFVQAVGWAMASAIKGDTKIASAWIGDGATAESDFHTALTFAHVYRAPVILNVVNNQWAISTQAIAG
KGD_MYCS2       ----------------------VPLMLHGDAAAGQGVVAETLNLALLRGYRTIHIVVNNQIGFTTAPTDS
TKTL2_MOUSE     LGQGLGAACGMAYTGKYFDKASYCL--MGDGESSEGSVWEALAFASHYNLDLVAIFDVNRLGQSGTAPLE
ODO1_CORGL      ----------------------VPLLLHGDAAAGLGIVPETINLAKLRGYDVIHIVVNNQIGFTTTPDSS
KGD_MYCUA       ----------------------------GDAAAGQGVVAETLNLANLPGYRVIHIIVNNQIGFTTAPEYS
DXS2_GEOMG      SSTSISAGLGMAAAQDLKGSGSRAIAVIGDGSLTGGMAYEALNQAGHLKKNLIVVLNDNEMAFSSFVSRK
KGD_MYCLE       VRAKQDLLNKDTNGNQDEAFSVVPMMLHGDAAAGQGVVAETLNLANLPGYRVIHIIVNNQIGFTTAPEYS
DXS_THERP       -STSISAALGMAVAAKLRGDRYHTIAVIGDGALTGGMAYEALNHAGALQVPLIVVLNDNEMSIAPNV---
TKTL2_BOVIN     LGQGLGAACGMAYTGKYLDKASYCL--LGDGESSEGSVWEALAFASHYGLDLVAVFDVNRLGQSGVAPLK
ODO1_STAAB      ----------------------------GDGAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_DICDI      ---------------------SMAVQLHGDASAGQGVVYETLHLSNLDNYSTVHIVVNNQIGFTTNPKYS
KGD_MYCTU       ----------------------VPLMLHGDAAAGQGVVAETLNLANLPGYRVIHIIVNNQIGFTTAPEYS
KGD_MYCTA       ----------------------VPLMLHGDAAAGQGVVAETLNLANLPGYRVIHIIVNNQIGFTTAPEYS
KGD_MYCBP       ----------------------VPLMLHGDAAAGQGVVAETLNLANLPGYRVIHIIVNNQIGFTTAPEYS
KGD_MYCBO       ----------------------VPLMLHGDAAAGQGVVAETLNLANLPGYRVIHIIVNNQIGFTTAPEYS
ODO1_BACSU      ---------------------SLAILIHGDAAPGEGIVAETLNLSSLKGYQVIHIIANNMIGFTTESAES
DXS_HELPJ       -STSVSIGVGVAKAFRLKQTLGMPIALLGDGSISAGIFYEALNELGDRKYPMIMILNDNEMSISTPI---
DXS_ARCB4       -STSISLAVGAAKSIKLKKENKVPIVMIGDGSMSAGMVYEALNELGDLKLPVVIILNDNEMSIAKPI---
KGD_MYCSS       ----------------------VPLMLHGDAAAGQGVVAETLNLALLRGYRTIHLIVNNQIGFTTSPAAA
KGD_MYCSK       ----------------------VPLMLHGDAAAGQGVVAETLNLALLRGYRTIHLIVNNQIGFTTSPAAA
KGD_MYCSJ       ----------------------VPLMLHGDAAAGQGVVAETLNLALLRGYRTIHLIVNNQIGFTTSPAAA
TKTL2_HUMAN     LGQGLGTACGMAYTGKYLDKASYCL--MGDGESSEGSVWEAFAFASHYNLDLVAVFDVNRLGQSGPAPLE
DHTK1_XENLA     ----------------------VCLQVHGDASSGQGIVTETFTLSNLPHYRIIHLIVNNQLGYTTPAERG
TKT_PONAB       LGQGLGVACGMAYTGKYFDKASYCL--LGDGELSEGSVWEAMAFASIYKLDLVAILDINRLGQSDPAPLQ
ODO1_STAAU      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAR      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAN      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAM      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAA9      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAA2      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAA1      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_BACLD      ---------------------SMAILIHGDAAPGEGIVAETLNLSQLKGYQVIHIIANNMIGFTTESNES
DXS_SULDN       TSISLGVGAAKAIALKGEQNSRIPVIMIGDGSMTAGMVYEALNELGERKYPMVIILNDNEMSISKPI---
TKT_BOVIN       LGQGLGAACGMAYTGKYFDKASYRVCMLGDGELSEGSVWEAMAFASIYKLDLVAILDINRLGQSDPAPLQ
ODO1_BACA2      ---------------------SLAILIHGDAAPGEGIVAETLNLSSLKGYQVIHIIANNMIGFTTESDES
TKT_PANTR       LGQGLGAACGMAYTGKYFDKASYCL--LGDGELSEGSVWEAMAFASIYKLDLVAILDINRLGQSDPAPLQ
TKT_HUMAN       LGQGLGAACGMAYTGKYFDKASYCL--LGDGELSEGSVWEAMAFASIYKLDLVAILDINRLGQSDPAPLQ
ODO1_STAAW      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAT      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAS      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAE      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAAC      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAA8      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_STAA3      ----------------------------GDAAPGQGINFETMNLGNLKGYSTLHIITNNRIGFTTEPIDA
ODO1_BACP2      ---------------------ALAILIHGDAAPGEGIVAETLNLSQLVGYQVIHIIANNMIGFTTESNES
DXS_THIDA       TSISAALGMAEAFHQLGSDQRAV--AVIGDGAMTAGMAFEALNNAGATELPLLVVLNDNDMSISPNV---
TKTL1_MOUSE     PGQGLGAACGMAYTGKYFDQASYCL--LGDEESTEGSVWEAFAFASYYNLDLMAIFDVNRIGHSSSMSVE
ODO1_RICPR      ----------------------------GDAACGQGVVAESLSMSPLTAYNVLHFVINNQFTANAADTRA
ODO1_BACSK      ----------------------------GDAAPGQGVVTETLNLSRLNGYHVLHIIANNNIGYTTEMHDS
KGD_MYCPA       ----------------------------GDAAAGQGVVAETLNLTHLPGYRVIHIIVNNQIGFTTAPEHS
DXS_CAMHC       -STSISLAVGAAKAIKLKGENRIPVALIGDGAMSAGMAYEAMNELGERKYPCIIILNDNEMSISRPI---
DXS1_GEOSL      -STSISAGLGMAMARELRGGSNKVVAVIGDGSMTGGIAFEALNQAGHLKKNLIVVLNDNEMSISPNVGAF
ODO1_STAHJ      ----------------------------GDAAPGQGINFETMNLSNLDGYSTLHIITNNRIGFTTEPVDG
ODO1_BACWK      ---------------------SFVILVHGDAAPGQGVVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACHK      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACCZ      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACCQ      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACC7      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACC3      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACC0      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACAN      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACAC      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACAA      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
KGD_MYCVP       ----------------------------GDAAAGQGVVAETLNLALLRGYRTIHIIVNNQIGFTTSPYDS
DXS_RALPJ       ----ISAALGMALGAKTKGEDRVAIAVIGDGAMSAGMAFEAMNNAGVYKLPLVVVLNDNDMSISPPVTKK
DXS_NITSB       -STSISLAVGAAKAIALKNEDRVPVVLIGDGAMSAGMVYEALNELGDRKYPVVIILNDNEMSIAKPI---
TKT_MACFA       LGQGLGAACGMAYTGKYFDKASYCL--LGDGELSEGSVWEAMAFASIYKLDLVAILDINRLGQSDPAPLQ
TKTL1_HUMAN     LGQGLGVACGMAYTGKYFDRASYCL--MSDGESSEGSVWEAMAFASYYSLDLVAIFDVNRLGHSGALPAE
ODO1_RICTY      ----------------------------GDAACGQGVVAESLSMSPLTAYNVLHFVINNQFTANAADTRA
ODO1_BACCR      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACC4      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
ODO1_BACC2      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
DXS_HELPY       -STSVSIGVGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDRKYPMIMILNDNEMSISTPI---
DXS_HELPH       -STSVSIGVGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDRKYPMIMILNDNEMSISTPI---
DXS_HELPG       -STSVSIGVGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDRKYPMIMILNDNEMSISTPI---
DXS_FRATW       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRATT       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRATO       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRATN       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRATM       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRATH       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRATF       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRAT1       SSTSISAALGMAIADRLQGKSSNTVAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_FRAP2       SSTSISAALGMAIADRLQGKHSSSIAVIGDGAITGGMAFEALNHAGGIKEDILVILNDNEMSISDNVGGL
DXS_ERYLH       ----ISAGLGFAVANKLKGEPGKAIAVIGDGAMSAGMAYEAMNNAEQAGNRLIVILNDNDMSIAPPV---
ODO1_BACC1      ---------------------SFVILVHGDAAPGQGIVSETLNLSRLNAYQTIHVIANNAVGFTTDSYDS
DXS_SYNPX       TSISAALGMAMARDNRGED--FKCVAVIGDGALTGGMALEAINHAHLPETPLLVVLNDNDMSISPPV---
ODO1_RICBR      ----------------------------GDAACGQGVVAESLSMSPLAAYNVLHFVINNQFTANAADTRA
DXS_SYMTH       -STSISAAVGMAKARDLAGDDYEVVAVIGDGALTGGMAYEALDHAGHDKTKVIVVLNDNSMSIAPNV---
DXS_PROMT       -STSISAALGMAIARDRKGEDYKCVAVIGDGALTGGMALEAINHAHLPKTPLLVVLNDNDMSISPPV---
DXS_PROMP       TSISAALGMAIARDRKGEDHK--CVAVIGDGALTGGMALEAINHAHLPNTPLVVVLNDNDMSISPPV---
DXS_PROM9       -STSISAALGMAIARDRKGENHKCVAVIGDGALTGGMALEAINHAHLPNTPLVVVLNDNDMSISPPV---
DXS_PROM2       TSISAALGMAIA-RDRKGDNYK-CVAVIGDGALTGGMALEAINHAHLPNTPLVVVLNDNDMSISPPV---
DXS_PROM1       -STSISAALGMAIARDRKGEDYKCVAVIGDGALTGGMALEAINHAHLPKTPLLVVLNDNDMSISPPV---
DXS_PROM0       TSISAALGMAIA-RDRKGDNYK-CVAVIGDGALTGGMALEAINHAHLPNTPLVVVLNDNDMSISPPV---
DXS_CAPAN       SSTTISAGLGMAVGRDLKGRNNNVIAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNR----------
DXS_ACIAD       SSTAISAGLGMSLARRYQQNPCEVVCIVGDGAMTAGMAFEAMNDAVAHDADLMVVLNDNDMSISCS----
DHTK1_DANRE     ----------------------ICLQVHGDASSGQGIVPETFTLSNLPHYRVIHLIVNNQVGYTTPSERG
TKT_RAT         LGQGLGAACGMAYTGKYFDKASYRVCMLGDGEVSEGSVWEAMAFAGIYKLDLVAIFDINRLGQSDPAPLQ
TKTL1_MACFA     LGQGLGVACGMAYTGKYFDRASYCL--MSDGESSEGSVWEAMAFASYYSLDLVAIFDVNRLGHSGALPAE
ODO1_RICCN      ----------------------------GDAACGQGVVAESLSMSPLAAYDILHFVINNQFTANAADTRA
ODO1_BRUSU      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUSI      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUO2      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUME      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUMB      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUC2      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUAB      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUA2      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
ODO1_BRUA1      ------------------------LLLHGDAAAGQGVVAECLGLSGLKGHRVLHFIINNQIGFTTNPAFS
DXS_RALME       ----ISAALGMALGARTRGEKRVGIAVIGDGAMTAGMAFEAMNNAGVYKLPMLVVLNDNDMSISPPV---
DXS_PROMS       -STSISAALGMAIARDRKGENYKCVAVIGDGALTGGMALEAINHAHLPNTPLVVVLNDNDMSISPPV---
DXS_NATTJ       SSTSISAALGMAKARDLQGSNEEVLAVIGDGAMTGGMAFEAMNHAGHEQANMTVILNDNEMSIGTNVGAL
ODO1_RICFE      ----------------------------GDAACGQGVVAESLSMSPLAAYDILHFVINNQFTANAADTRA
ODO1_CAEEL      ------------YAGDEKCDRTMAILLHGDAAAGQGVVLETFNLDDLPSYTTIHIVVNNQIGFTTDPRSS
ODO1_AZOVI      ----------------------VPISIHGDSAAGQGVVMETFQMSQIRGYKTIHIVVNNQVGFTTSNPVD
DXS_SYNJB       TSISAALGMAIA-RDRRGDNFKV-VAIIGDGALTGGMAYEAINHAHLPKTNLMVVLNDNGMSISPNV---
DXS_SPHAL       ----ISAALGFAIANKLKDEPGRAIAVIGDGSMSAGMAYEAMNNAKQAGNRLIVILNDNDMSIAPPVGGL
DXS_RHOPT       SSTSISAGLGMAVASELAGKKNNVIAVIGDGSISAGMAYEAMNNAGAMNSRLIVILNDNNMSIAPPVGAM
DXS_RHOPA       SSTSISAGLGMAVASELAGKKNNVIAVIGDGSISAGMAYEAMNNAGAMNSRLIVILNDNNMSIAPPVGAM
DXS_RALSO       ----ISAALGMALGAKTQGENRVAIAVIGDGAMSAGMAFEAMNNAGVYRLPLVVVLNDNDMSISPPV---
TKT_MOUSE       LGQGLGAACGMAYTGKYFDKASYRVCMLGDGEVSEGSVWEAMAFAGIYKLDLVAIFDINRLGQSDPAPLQ
ODO1_LEPIN      ----------------------------GDAAAGQGVVAETLNLMNLEGYTTFHIVVNNQIGFTTLPDES
ODO1_LEPIC      ----------------------------GDAAAGQGVVAETLNLMNLEGYTTFHIVVNNQIGFTTLPDES
ODO1_CAEBR      ------------YAGDEKCDRTMAILLHGDAAAGQGVVLETFNLDDLPSYTTIHIVVNNQIGFTTDPRSS
DXS_SYNWW       -STSISAALGMALARDLQGQSNSVVAVIGDGALTAGMAFEALNHAGQEDSDLIVVLNDNEMSISKNVGAM
DXS_RALEJ       ----ISAALGMALGARTLGEQRVSIAVIGDGAMTAGMAFEALNNAGVYKLPLVVVLNDNDMSISPPV---
DXS_PSYCK       -STSISAGLGMSLALRYQGRAQTVACIIGDGAMTGGMAFEAMNDAVQQDADLMVILNDNDMSISCSI---
DXS_CAMJD       -STSISLAVGACKAIALKGEKRIPVALIGDGALSAGMVYEALNELGDSKFPCVILLNDNEMSISKPI---
DXS_BRAJA       ----ISAGLGMAVARDLSGGKNNVIAVIGDGAMSAGMAYEAMNNAGAMNSRLIVILNDNDMSIAPPVGAM
DXS_ARATH       SSTTISAGLGMAVGRDLKGKNNNVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNK----------
ODO1_BACHD      ----------------------------GDAAPGQGVVTETLNLSRLTGYQTLHIIANNNIGFTTETFDS
DXS_RHOP5       SSTSISAGLGMAVASDLAGTKNNVIAVIGDGSISAGMAYEAMNNAGAMNSRLIVILNDNNMSIAPPVGAM
DXS_RALEH       ----ISAALGMALGARTLGEKRVSVAVIGDGAMTAGMAFEALNNAGVYKLPLVVVLNDNDMSISPPV---
DXS_CYTH3       SSTSISAALGMAVASQYQKDNRQHIAVIGDGALTGGMAFEAMNHAGVTNSNLLIVLNDNCMAIDPNV---
DXS_CUPTR       ----ISAALGMALGARTLGQKRVSVAVIGDGAMTAGMAFEALNNAGVYKLPLVVVLNDNDMSISPPV---
DXS_BAUCH       SSTSISAGLGMAVAATYEGIGRKTVCVIGDGAMTAGMAFEALNHAGDIKSDLLVILNDNKMSISRNV---
DXS_ACIBY       SSTAISAGLGMSLARRYQKDPCEVVCIVGDGAMTAGMAFEAMNDAVAHDADLIVVLNDNDMSISCS----
DXS_ACIBS       SSTAISAGLGMSLARRYQKDPCEVVCIVGDGAMTAGMAFEAMNDAVAHDADLIVVLNDNDMSISCS----
DXS2_RHORT      SSTSISAGLGMAIGSALAGDARDVVAVIGDGSMSAGMAYEAMNNAGAAKSRLIVILNDNDMSIAPPVGAM
DXS1_RHORT      SSTSISAGLGMAIGSALAGDARDVVAVIGDGSMSAGMAYEAMNNAGAAKSRLIVILNDNDMSIAPPVGAM
ODO1_HAEIN      ----------------------LAITVHGDSAAGQGVVQETLNMSNTRGYSVIRIVINNQIGFTTSNPND
DXS_SYNS9       -STSISAALGMALGRDNRGENFKCVAVIGDGALTGGMALEAINHAHLPNTPLLVVLNDNDMSISPPV---
DXS_PSYA2       SSTSISAGLGMSLALRYQGRAQTVACIIGDGAMTGGMAFEAMNDAVQQDADLMVILNDNDMSISCSI---
DXS_PROM5       -STSISAALGMAIARDAKGENHKCVAVIGDGALTGGMALEAINHATLPETPFLVILNDNDMSISPPV---
DXS_HAHCH       SSTSISAALGMAIAARLQNQPRKAIAVIGDGAMTAGMAFEALNHAADTKADLLVILNDNDMSISRNV---
DXS_CAMFF       -STSISLVVGACKAIKLKGENRLPVAVIGDGAMSAGMAYEALNELGDRKYPCVIILNDNEMSISKPI---
DXS_SYNJA       -STSISAALGMAIARDRRGENFKVVAIIGDGALTGGMAYEAINHAHLPKTNLMVILNDNGMSISPNV---
DXS_PSEPW       SSTSISAALGMAIAARLQNSARKSIAVIGDGALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNV---
DXS_PSEPK       SSTSISAALGMAIAARLQNSARKSIAVIGDGALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNV---
DXS_PSEPG       SSTSISAALGMAIAARLQNSARKSIAVIGDGALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNV---
DXS_PSEP1       SSTSISAALGMAIAARLQNSARKSIAVIGDGALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNV---
DXS_PROM4       -STSISAALGMAFARDRLGLNHKCVAVIGDGALTGGMALEAINHAHLPNTPFLVVLNDNDMSISPPV---
DXS_CLOBA       SSTSISAGLGMARARDLKGEKYTVVSVIGDGALTGGMALEALNDVGFRKTKMVIILNDNQMSISVNVGGL
DXS_BART1       TSISAGLGMAVASALKEEKKRKV-IAVIGDGAMSAGMAYEAMNNAGALNARLIVILNDNDMSIAPPTGSM
DHTK1_RAT       ----------------YSPNGSICLQVHGDASCGQGIVLETFTLSNLPHFRIIHLIVNNQLGYTTPAERG
DHTK1_CAEEL     ----------------------------GDGATGQGVVWESIALSQAPHFRLVHLVTNNQIAFESSVGRS
DXS_TRIEI       -STSISAGLGMALARDMKGDNFKVVSIIGDGALTGGMALEAINHAHLPKTNILVVLNDNEMSISPNV---
DXS_SPHWW       ----ISAALGFAVANKLANKEGRAIAVIGDGAMSAGMAYEAMNNAKQAGNRLIVILNDNDMSIAPPVGAL
DXS_RHILW       ----ISAGLGMAIAADLDKNDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAM
DXS_RHIE6       ----ISAGLGMAIAADLDKNDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAM
DXS_PROMM       -STSISAALGMAVARERRGESFKCVAVIGDGALTGGIALEAINHAHMPNTPFLVVLNDNDMSISPPV---
DXS_PROM3       -STSISAALGMAVARERRGESFKCVAVIGDGALTGGIALEAINHAHMPNTPFLVVLNDNDMSISPPV---
DXS_PELUB       ----ISSALGMAEANKLSNKLNNIIAVIGDGAISAGMAYEAMNNAGASKTKMIVILNDNDMSIAKPV---
DXS_DECAR       SSTSISAALGMALAAKHKGEDRKAIAIIGDGAMSAGMAFEAMNNAGVADADMLVILNDNEMSISPPV---
DXS_CLOBB       SSTSISAGLGMARARDLKKEKYTVVSVIGDGALTGGMALEALNDVGFRKTKMVIILNDNQMSISLNVGGL
DXS_CAMJR       -STSISLAVGACKAIALKGEKRIPVALIGDGALSAGMAYEALNELGDSKFPCVILLNDNEMSISKPI---
DXS_CAMJJ       -STSISLAVGACKAIALKGEKRIPVALIGDGALSAGMAYEALNELGDSKFPCVILLNDNEMSISKPI---
DXS_CAMJE       -STSISLAVGACKAIALKGEKRIPVALIGDGALSAGMAYEALNELGDSKFPCVILLNDNEMSISKPI---
DXS2_ZYMMO      ----ISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAGKRLIVILNDNEMSISPPV---
DXS1_ZYMMO      ----ISAALGFAMASKLSDSDDKAVAIIGDGSMTAGMAYEAMNNAKAAGKRLIVILNDNEMSISPPV---
DXS_SYNR3       -STSISAALGMAIARDRQGQNHKCVAVIGDGALTGGMALEAINHAHLPKTRLLVVLNDNDMSISPPV---
DXS_RHOPS       ----ISAGLGMAVARDLAGGNNNVIAVIGDGSISAGMAYEAMNNAGAMNSRLIVILNDNNMSIAPPVGAM
DXS_PROMA       -STSISAALGMALARDRQGKDYKCVAVIGDGALTGGMALEAINHAHLPSTPFLVVLNDNDMSISPPV---
DXS_HYPNA       AHASTSISAGLGFAKQNKDNHVICV--IGDGSMSAGMAYEAMNNAGADRSRMIVILNDNDMSIAPPV---
DXS_DIAST       ----ISAALGMALAAKQRGDERRCVAIIGDGAMTAGMAFEALNNAGVADANLLVILNDNDMSISPPV---
DXS_BRASO       ----ISAGLGMAVARDLSGGKNNVIAVIGDGAMSAGMAYEAMNNAGAMNSRLIVILNDNDMSIAPPVGAM
DXS_BRASB       ----ISAGLGMAVARDLSGGKNNVIAVIGDGAMSAGMAYEAMNNAGAMNSRLIVILNDNDMSIAPPVGAM
DXS_BARBK       TSISAGLGMAMASALKAEERRNV-IAVIGDGAMSAGMAYEAMNNAGALDARLIVILNDNDMSIAPPTGAM
DXS_ACISJ       ----ISAALGMALAAKQRGDERRCVAIIGDGAMTAGMAFEALNNAGVADANLLVILNDNDMSISPPV---
ODO1_STAS1      ---------------------SMPILIHGDAAPGQGINFEAMNLGNLEGYSTLHIITNNRIGFTTEPEDG
ODO1_SCHPO      ---------------------SMGILIHGDAAAAQGVVYETFGLHALPGYSTVHIVINNQIGFTTDFARS
DXS_SYNS3       TSISAALGMAIARDRQGLDYK--CVAVIGDGALTGGMALEAINHAHLPSTPLLVVLNDNDMSISPPV---
DXS_PASMU       SSTSISAGLGIAVAAQRENAGRKTVCVIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENV---
DXS_NITWN       ----ISASLGMAVARDLSGGNNNVIAVIGDGAMSAGMAYEAMNNAGAMNSRLIVILNDNDMSIAPPVGAM
DXS_HAEDU       SSTSISAGLGIAVAAQKENAGRKTVCVIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENV---
DXS_BUCAT       TSISAGLGMSIAAEKEGRNRKTICI--IGDGAMTAGMAFEAINHAGEIQSNLLVILNDNQMSISRNV---
DXS_BUCAP       TSISAGLGLSIAAGKEGKNRKTICVV--GDGSMTAGMAFEAMNHAGIIQSDLLVVLNDNQMSISKNI---
DXS_BUCAI       TSISAGLGMSIAAEKEGRNRKTICI--IGDGAMTAGMAFEAINHAGEIQSNLLVILNDNQMSISRNV---
DXS_BUCA5       TSISAGLGMSIAAEKEGRNRKTICI--IGDGAMTAGMAFEAINHAGEIQSNLLVILNDNQMSISRNV---
DXS_BLOPB       TSISAGLGLAIAAEREMLGRRTVCV--IGDGAITAGMAFEAMNHAGFTKSDLLIILNDNEMSISENV---
DXS_BARHE       TSISAGLGMAVASALKAEKRRNI-VAVIGDGAMSAGMAYEAMNNAGALNARLIVVLNDNDMSIAPPTGAM
DXS_ACTPJ       SSTSISAGVGIAVAAEKENAGRKTVCVIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENV---
DXS_ACTP7       SSTSISAGVGIAVAAEKENAGRKTVCVIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENV---
DXS_ACTP2       SSTSISAGVGIAVAAEKENAGRKTVCVIGDGAITAGMAFEAMNHAGALHTDMLVILNDNEMSISENV---
DHTK1_HUMAN     ----------------------ICLQVHGDASCGQGIVPETFTLSNLPHFRIVHLIVNNQLGYTTPAERG


                         .         .         .         +         .         .         .:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
ODPA_RHIME      SAQTDFSQRGASFGIPGYQVDGMDVRAVKAAADEAVEHCRSGKGPIILEMLTYRYRGHSMSDPAKYRSKD
ODPA_ZYMMO      NAHTALSERGAGFGIPALVVDGMDVLEVRGAATVAVDWVQAGKGPIILEMKTYRYRGHSMSDPARYRSRE
ODPA_RICCN      TFMRDLYKKGASFGIKGFQLDGMDFEEMYDGSKQAAEYVRENSFPLILEVKTYRYRGHSMSDPAKYRSKE
ODPA_RICFE      TFMRDLYKKGESFGIKGFQLDGMDFEEMYNGAKQAAEYVRENSFPLILEVKTYRYRGHSMSDPAKYRSKE
ODPA_RICBR      TFMRDLYKKGESFGIKGFQLNGMDFEEMYDGVKQAAEYVRENSMPLILEVKTYRYRGHSMSDPAKYRSKE
ODPA_RICTY      TFMRDLYKKGESFGIRGFQLDGMDFEEMYNGTKQVAEYVRENSFPVILEVKTYRYRGHSMSDPAKYRSKE
ODPA_RICPR      TFMCDLYKKGESFGIRGFQLDGMDFEEMYNGTKQVAEYVRENSFPVILEVKTYRYRGHSMSDPAKYRSKE
ODPAT_RAT       AASTDYHKKG--FVIPGLRVNGMDILSVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGSYRTRE
ODPAT_MOUSE     AASTDYHKKG--FIIPGLRVNGMDILCVREATKFAADHCRSGKGPIVMELQTYRYHGHSMSDPGSYRSRE
ODPA_SMIMA      AASTDYYKRGDF--IPGIMVDGMDVLCVREATKFAAAYCRSGKGPMLMELQTYRYHGHSMSDPVSYRTRE
ODPA_MOUSE      AASTDYYKRGDF--IPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_PIG        AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_BOVIN      AASTDYYKRGDF--IPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_HUMAN      AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_DICDI      TAGHDFYTRG--HYVAGLKVDGMDVFAVKEAGKYAAEWCRAGNGPIILEMDTYRYVGHSMSDPGTYRTRE
ODPA_RAT        AASTDYYKRGDF--IPGLRVDGMDILCVREATKFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_PONAB      AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_PANTR      AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSGPVSYRTRE
ODPAT_HUMAN     AASPDYYKRG-NF-IPGLKVDGMDVLCVREATKFAANYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_MACFA      AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
ODPA_CAEEL      SASTEYYTRG--DYVPGIWVDGMDILAVREATKWAKEYCDSGKGPLMMEMATYRYHGHSMSDPTSYRTRE
ODPT_ASCSU      SASTDYYTRG--DYVPGFWVDGMDVLAVRQAIRWGKEWCNAGKGPLMIEMATYRYGGHSMSDPTSYRTRE
ODPA_SOLTU      AKSPAYYKRG--DYVPGLRVDGMDVFAVKQACTFAKQHA-LKNGPIILEMDTYRYHGHSMSDPSTYRTRD
ODPA_PEA        AKSPAYFKRG--DYVPGLKVDGMDALAVKQACKFAKEHA-LKNGPIILEMDTYRYHGHSMSDPSTYRTRD
ODPA_ASCSU      SASTDYYTRG--DYVPGIWVDGMDVLAVRQAVRWAKEWCNAGKGPLMIEMATYRYSGHSMSDPTSYRTRE
ODPA_YEAST      SAMTEYFKRGQ--YIPGLKVNGMDILAVYQASKFAKDWCLSGKGPLVLEYETYRYGGHSMSDPTTYRTRD
ODPA_KLULA      SAMTEYFKRGQ--YIPGLKVNGMDILAVYQASKFAKDWTVSGNGPIVLEYETYRYGGHSMSDPTTYRTRD
ODPA1_ARATH     AKSPSYYKRG--DYVPGLKVDGMDAFAVKQACKFAKQHA-LEKGPIILEMDTYRYHGHSMSDPSTYRTRD
ODPA2_ARATH     AKSPAYFKRG--DYVPGLKVDGMDALAVKQACKFAKEHA-LKNGPIILEMDTYRYHGHSMSDPSTYRTRD
ODPA_SCHPO      SAMTEFYKRGQ--YIPGLLVNGMDVLAVLQASKFAKKYTVENSQPLLMEFVTYRYGGHSMSDPTTYRSRE
ODPA_PORPU      SSIPEIHKKAEAFGLPGIEVDGMDVLAVRQVAEKAVERARQGQGPTLIEALTYRFRGHSLADPDELRSRQ
ACOA_RALEH      TAVDSYVDRAAGFGIPGVTVDGTDFFAVHEAAGEVIRRAREGGGPSLLECKMVRFYGHFEGDAQTYRAAG
ODPA_PORYE      SSIPEIHKKAEAFGLPGIEVDGMDXXXXXXXXXXXXXXXXXGDGPTLIEALTYRFRGHSLADPDELRSRQ
ODPA_STAAR      TAAETLAQKAIAVGIPGIQVDGMDALAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMADPTRYRTSD
ODPA_STAES      TAAETLAQKAISVGIPGIQVDGMDALAVYQATLEARERAVAGEGPTVIETLTYRYGPHTMADPTRYRTSD
ODPA_STAEQ      TAAETLAQKAISVGIPGIQVDGMDALAVYQATLEARERAVAGEGPTVIETLTYRYGPHTMADPTRYRTSD
ODPA_BACSU      SAAETIAQKAVAAGIVGVQVDGMDPLAVYAATAEARERAINGEGPTLIETLTFRYGPHTMADPTKYRTK-
ODBA_RAT        YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYRSVD
ODBA_BACSU      VACENISDRAIGYGMPGVTVNGNDPLEVYQAVKXXXXXXXXXXXPTLIETISYRLTPHXXXXXXXYRGRE
ODPA_STAAW      TAAETLAQKAIAVGIPGIQVDGMDALAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMADPTRYRTSD
ODPA_STAAS      TAAETLAQKAIAVGIPGIQVDGMDALAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMADPTRYRTSD
ODPA_STAAN      TAAETLAQKAIAVGIPGIQVDGMDALAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMADPTRYRTSD
ODPA_STAAM      TAAETLAQKAIAVGIPGIQVDGMDALAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMADPTRYRTSD
ODPA_STAAC      TAAETLAQKAIAVGIPGIQVDGMDALAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMADPTRYRTSD
ODBA_MOUSE      YRGDGIAARGPGYGIKSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYRSVD
ODBA_PANTR      YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYRSVD
ODBA_HUMAN      YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYRSVD
ODBA_MACFA      YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYRSVD
ODBA_THET8      THSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDSRYRPKE
ODBA_THET2      THSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDSRYRPKE
ODBA_BOVIN      YRGDGIAARGPGYGILSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYRSVD
ODPA_MYCGE      SAVSDLSVKAIACGIPRVRVDGNDLIASYEAMQDAANYARGGNGPVLIEFFSYRQGPHTTSDPSIYRTKQ
ODPA_MYCPN      SAVSDLSTKAIAVNIPRIRVDGNDLIASYEAMHEAANYARSGNGPVLIEFFSWRQGPHTTSDPSIYRTKE
ODPA_ACHLA      SNSETLAQKGVAFGIPYIQVDGNDMLAMYVASKEAMDRARKGDGPTLIEAFTYRMGPHTTSDDSIYRTKE
ODPA_BACST      TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSDPTRYRSK-
ODBA_DICDI      YKGDGIAGRGPNYGMKTIRVDGNDIWAVYNVTKLARKIAVEEQVPVLIEAMTYRVGHHSTSDSSRYRTVE
ODBA_PSEAE      GGETTFANRGVGCGIASLRVDGNDFLXXXXXXXXXXXXXXXNLGPSLIEWVTYRAGPHSTSDPSKYRPAD
ODPA_BACCE      XXXXXXXXXXXXXGIYGIQVDGMDPLAVYAATAFARERAVNGEGPTLIETLTFRYGPHTMADPTRYRTK-
ODBA_PSEPU      GESTTFAGRGVGCGIASLRVDGNDFVXXXXXXXXXXXXXXXGLGPSLIEWVTYRAGPHSTSDPSKYRPAD
KGD_MYCS2       RSSEYCTDVAKMIGAPIFHVNGDDPEACAWVARLAVDFRQAFKKDVVIDMLCYRRRGHNEGDDPSMTQPY
TKTL2_MOUSE     HCTAVYEKRCQAFGWNTYVVDGHDVEALCQAFWKA---AQVKNKPTALIAKTFKGRG-------------
ODO1_CORGL      RSMTDYAK---AFGCPVFHVNGDDPEAVVWVGQLATEYRRRFGKDVFIDLVCYRLRGHNEADDPSMTQPK
KGD_MYCUA       RSTEYCTDVAKTIGAPIFHVNGDDPEACVWVARLAVDFRQRFNKDVIIDMLCYRRRGHNEGDDPSMTNPR
DXS2_GEOMG      MTGSDFRKQGLLENIP------------------------------------------------------
KGD_MYCLE       RSSEYCTDVAKMIGAPIFHVNGDDPEACVWVAKLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPY
DXS_THERP       ----------------------------------------------------------------------
TKTL2_BOVIN     HCTDIYRNRCEAFGWNTYLVDGHDVEALCQAFSQA---AQGKNKPTAIIAKTYKGRGIPNVEDAENWHGK
ODO1_STAAB      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_DICDI      RSSKYCTDVAKTIDIPVFHVNGDNVEAVVKVCKIAAEWRQKFKRDVFVDIVCYRKHGHNETDQPKFTQPI
KGD_MYCTU       RSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPY
KGD_MYCTA       RSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPY
KGD_MYCBP       RSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPY
KGD_MYCBO       RSSEYCTDVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPY
ODO1_BACSU      RSTKYASDLAKGYEIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPM
DXS_HELPJ       ----------------------------------------------------------------------
DXS_ARCB4       ----------------------------------------------------------------------
KGD_MYCSS       KSSEYCTDVAKMIGAPIFHVNGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQPS
KGD_MYCSK       KSSEYCTDVAKMIGAPIFHVNGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQPS
KGD_MYCSJ       KSSEYCTDVAKMIGAPIFHVNGDDPEAAVWVSRLAVDFRQKFKKDVVIDLLCYRRRGHNEGDDPSMTQPS
TKTL2_HUMAN     HGADIYQNCCEAFGWNTYLVDGHDVEALCQAFWQA---SQVKNKPTAIVAKTFKGRGIPNIEDAENWHGK
DHTK1_XENLA     RSSLYSSDVGKIVGCAVIHVNGDDPEEVLRATRLAVEYQRCFRKDVIIDLLCYRQWGHNELDEPFFTNPS
TKT_PONAB       HQMDIYQKRCEAFGWHAVIVDGHSVEELKAFG-------QAKHQPTAIIAKTFKGRG-------------
ODO1_STAAU      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAR      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAN      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAM      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAA9      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAA2      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAA1      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_BACLD      RSTKYASDLAKGFEIPIVHVNADDPEACLSAVQLAVEYRMTFNKDFLIDLIGYRRFGHNEMDEPSATQPM
DXS_SULDN       ----------------------------------------------------------------------
TKT_BOVIN       HQMDIYQKRCEAFGWNAVIVDGHSVEELKAFG-------QVKNQPTAIIAKTFKGRG-------------
ODO1_BACA2      RSTKYASDLAKGYEIPIVHVNADDPEACLSAVKFAVEYRKRFNKDFLIDLIGYRRYGHNEMDEPSTTQPM
TKT_PANTR       HQMDIYQKRCEAFGWHAIIVDGHSVEELKAFG-------QAKHQPTAIIAKTFKGRG-------------
TKT_HUMAN       HQMDIYQKRCEAFGWHAIIVDGHSVEELKAFG-------QAKHQPTAIIAKTFKGRG-------------
ODO1_STAAW      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAT      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAS      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAE      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAAC      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAA8      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_STAA3      RSTTYSTDVAKGYDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPV
ODO1_BACP2      RSTKYASDLAKGFEIPIVHVNADDPEACLAAVQLAVEYRKRFKKDFLIDLIGYRRYGHNEMDEPSTTQPM
DXS_THIDA       ---------GALNNYLARLMSGRFYAAARRAGDKVLS---------------------------------
TKTL1_MOUSE     HCIAIYQKRCEAFGWNTYVVDGRDVKTLCHVFSQA---AQVRGKPTAVVAKTFKARG-------------
ODO1_RICPR      SRSTEFAK---IISAPILHVNGDDIEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEGDEPMYTQSK
ODO1_BACSK      RSTTYASDPAKGFEIPIVHVNADDAEACVRAIKFAVEYRRKFQKDFLIDLIGYRRFGHNEGDEAQIRKHP
KGD_MYCPA       RSSEYCTDVAKMIGAPIFHVNGDDPEACAWVAKLAVDFRQKFKKDVVIDMLCYRKRGHNEGDDPSMTNPA
DXS_CAMHC       ----------------------------------------------------------------------
DXS1_GEOSL      SSFVSRKLTGSYFRELKKEVQGL-----------------------------------------------
ODO1_STAHJ      RSTTYSTDIAKGYDVPILHVNADDVEATIEAIDIAMEFRKEFHKDFVIDLVGYRRYGHSITNPLPYRKHD
ODO1_BACWK      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRTLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACHK      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACCZ      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACCQ      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACC7      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACC3      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACC0      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACAN      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACAC      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACAA      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
KGD_MYCVP       RSSEYCTDVAKMIGAPIFHVNGDDPEACVWVAKLAVDFRQKFKKDVVIDMLCYRRRGHNEGDDPSMTQPT
DXS_RALPJ       GVELEFAKREFGFNYIG-PIDGHDLESLVPTLQNIRQRAREGGGPQFLHVVTKKGQGYKLADPILY----
DXS_NITSB       ----------------------------------------------------------------------
TKT_MACFA       HQMDIHQKRCEAFGWHAIIVDGHSVEELKAFG-------QAKHQPTAIIAKTFKGRG-------------
TKTL1_HUMAN     HCINIYQRRCEAFGWNTYVVDGRDVEALCQVFWQA---SQVKHKPTAVVAKTFKGRGPSIEDAAKPMPRE
ODO1_RICTY      SRSTEFAK---IIAAPILHVNGDDIEAVLKATDIAVEYRQKFSKDVVVEIICYRKYGHNEGDEPMYTQSK
ODO1_BACCR      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACC4      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
ODO1_BACC2      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPAKIKNHP
DXS_HELPY       ----------------------------------------------------------------------
DXS_HELPH       ----------------------------------------------------------------------
DXS_HELPG       ----------------------------------------------------------------------
DXS_FRATW       SAH--FSK--------------------------------------------------------------
DXS_FRATT       SAH--FSK--------------------------------------------------------------
DXS_FRATO       SAH--FSK--------------------------------------------------------------
DXS_FRATN       SAH--FSK--------------------------------------------------------------
DXS_FRATM       SAH--FSK--------------------------------------------------------------
DXS_FRATH       SAH--FSK--------------------------------------------------------------
DXS_FRATF       SAH--FSK--------------------------------------------------------------
DXS_FRAT1       SAH--FSK--------------------------------------------------------------
DXS_FRAP2       SAH--FSK--------------------------------------------------------------
DXS_ERYLH       ----------------------------------------------------------------------
ODO1_BACC1      RSTKYSSDLAKGFDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNMDDPA------
DXS_SYNPX       ----------------------------------------------------------------------
ODO1_RICBR      SRSTEFAK---IIAVPILHVNGDDIEAVLKATNIAVEYRQKFGKDVIVEIICYRKYGHNEGDEPMYTQGK
DXS_SYMTH       ----------------------------------------------------------------------
DXS_PROMT       ----------------------------------------------------------------------
DXS_PROMP       ----------------------------------------------------------------------
DXS_PROM9       ----------------------------------------------------------------------
DXS_PROM2       ----------------------------------------------------------------------
DXS_PROM1       ----------------------------------------------------------------------
DXS_PROM0       ----------------------------------------------------------------------
DXS_CAPAN       ----------------------------------------------------------------------
DXS_ACIAD       ----------------------------------------------------------------------
DHTK1_DANRE     RSSLYCSDVGKMVGCAIIHVNGDDAEEVLRATRLAVEYQRRFRKDVIVDLLCYRQWGHNFTNPAMYRSRK
TKT_RAT         HQVDVYQKRCEAFGWHAIIVDGHSVEELKAFG-------QAKHQPTAIIAKTFKGRG-------------
TKTL1_MACFA     HCIDIYQRRCEAFGWNTYVVDGRDVEAL------------------------------------------
ODO1_RICCN      SRSTEFAK---IIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGDEPMYTQGK
ODO1_BRUSU      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUSI      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUO2      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUME      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUMB      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUC2      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUAB      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUA2      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
ODO1_BRUA1      RSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPL
DXS_RALME       ----------------------------------------------------------------------
DXS_PROMS       ----------------------------------------------------------------------
DXS_NATTJ       SSYLSRLRTDPKYHRIKEDVEFL-LKRIPAIGGK------------------------------------
ODO1_RICFE      SRSTEFAK---IIAAPILHVNGDDIEAVLKATNIAVEYRQKFGKDVVVEIICYRKYGHNEGDEPMYTQGK
ODO1_CAEEL      RSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPL
ODO1_AZOVI      TRSTEYTDPAKMIQAPVLHVNGDDPEAVLFVTQLAVDYRMQFKRDVVIDLVCYRRRGHNEADEPSGTQPL
DXS_SYNJB       ----------------------------------------------------------------------
DXS_SPHAL       SA--------------------------------------------------------------------
DXS_RHOPT       SA--------------------------------------------------------------------
DXS_RHOPA       SA--------------------------------------------------------------------
DXS_RALSO       ----------------------------------------------------------------------
TKT_MOUSE       HQVDIYQKRCEAFGWHTIIVDGHSVEELKAFG-------QAKHQPTAIIAKTFKGRG-------------
ODO1_LEPIN      RSTLYATDLAKGFQIPIIHVNGDDPEAVYRVVKLGMEYRQKFKKDFIIDLVCYRRLGHNETDEPAFTQPK
ODO1_LEPIC      RSTLYATDLAKGFQIPIIHVNGDDPEAVYRVVKLGMEYRQKFKKDFIIDLVCYRRLGHNETDEPAFTQPK
ODO1_CAEBR      RSSPYCTDVGRVVGCPIFHVNVDDPEAVMHVCNVAADWRKTFKKDVIVDLVCYRRHGHNELDEPMFTQPL
DXS_SYNWW       SAYLNRLRTDPSYSRTKEEIESV-----------------------------------------------
DXS_RALEJ       ----------------------------------------------------------------------
DXS_PSYCK       ----------------------------------------------------------------------
DXS_CAMJD       ----------------------------------------------------------------------
DXS_BRAJA       SAYLSRLYSGKTYRTLREAAKQINKRLPKIIANRA-----------------------------------
DXS_ARATH       ----------------------------------------------------------------------
ODO1_BACHD      RSTLYSSDPAKGFEIPIVHVNADDPEACLAAVHLAFQYRKRFKKDFLIDLIGYRRFGHNMDEPAV--TQP
DXS_RHOP5       SA--------------------------------------------------------------------
DXS_RALEH       ----------------------------------------------------------------------
DXS_CYTH3       ----------------------------------------------------------------------
DXS_CUPTR       ----------------------------------------------------------------------
DXS_BAUCH       ----------------------------------------------------------------------
DXS_ACIBY       ----------------------------------------------------------------------
DXS_ACIBS       ----------------------------------------------------------------------
DXS2_RHORT      SA--------------------------------------------------------------------
DXS1_RHORT      SA--------------------------------------------------------------------
ODO1_HAEIN      TRSTEYTDIAKMIQAPIIHVNGDDPEAVAFAARMAVEYRNLFKRDIFIDLISYRRHGHNEADEPLATQPM
DXS_SYNS9       ----------------------------------------------------------------------
DXS_PSYA2       ----------------------------------------------------------------------
DXS_PROM5       ----------------------------------------------------------------------
DXS_HAHCH       ----------------------------------------------------------------------
DXS_CAMFF       ----------------------------------------------------------------------
DXS_SYNJA       ----------------------------------------------------------------------
DXS_PSEPW       ----------------------------------------------------------------------
DXS_PSEPK       ----------------------------------------------------------------------
DXS_PSEPG       ----------------------------------------------------------------------
DXS_PSEP1       ----------------------------------------------------------------------
DXS_PROM4       ----------------------------------------------------------------------
DXS_CLOBA       SRYLNKLRMGETYN--------------------------------------------------------
DXS_BART1       SAHLARLVSRPSYRHLRERVKMLSEKLPKFFWDKA-----------------------------------
DHTK1_RAT       RSSLYSSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFRKDVIIDLLCYRQWGHNELDEPFFTNPV
DHTK1_CAEEL     STHTDIAK---AFEYPVIHVNGDHPEEVVKATRLALAYRERFRKDVFINLVCFRRWGHNELDPVMYKARE
DXS_TRIEI       ----------------------------------------------------------------------
DXS_SPHWW       SA--------------------------------------------------------------------
DXS_RHILW       SAYRDFGKKLTAY--LGKNIDRAITRAVEHA---------------------------------------
DXS_RHIE6       SAYRDFGKKLTAY--LGKNIDRAITRAVEHA---------------------------------------
DXS_PROMM       ----------------------------------------------------------------------
DXS_PROM3       ----------------------------------------------------------------------
DXS_PELUB       ----------------------------------------------------------------------
DXS_DECAR       ----------------------------------------------------------------------
DXS_CLOBB       SRYLNKLRMGETYN--------------------------------------------------------
DXS_CAMJR       ----------------------------------------------------------------------
DXS_CAMJJ       ----------------------------------------------------------------------
DXS_CAMJE       ----------------------------------------------------------------------
DXS2_ZYMMO      ----------------------------------------------------------------------
DXS1_ZYMMO      ----------------------------------------------------------------------
DXS_SYNR3       ----------------------------------------------------------------------
DXS_RHOPS       SA--------------------------------------------------------------------
DXS_PROMA       ----------------------------------------------------------------------
DXS_HYPNA       ----------------------------------------------------------------------
DXS_DIAST       ----------------------------------------------------------------------
DXS_BRASO       SA--------------------------------------------------------------------
DXS_BRASB       SA--------------------------------------------------------------------
DXS_BARBK       SA--------------------------------------------------------------------
DXS_ACISJ       ----------------------------------------------------------------------
ODO1_STAS1      RSTTYSSDVAKGYDVPIMHVNADNVXXXXXXXXXXMAFRKEFNKDVVIDLVGYRRYGHSITNPLQYRKHE
ODO1_SCHPO      TPYTDIAK---SMEAPIFHVNGDDVEAVTFICQLAADWRKAFKTDVVVDIVCYRRHGHNETDQPSFTQPR
DXS_SYNS3       ----------------------------------------------------------------------
DXS_PASMU       ----------------------------------------------------------------------
DXS_NITWN       SAYLSRLYSGKTYRSLREAAKQLGKHLPKMIADRA-----------------------------------
DXS_HAEDU       ----------------------------------------------------------------------
DXS_BUCAT       ----------------------------------------------------------------------
DXS_BUCAP       ----------------------------------------------------------------------
DXS_BUCAI       ----------------------------------------------------------------------
DXS_BUCA5       ----------------------------------------------------------------------
DXS_BLOPB       ----------------------------------------------------------------------
DXS_BARHE       SA--------------------------------------------------------------------
DXS_ACTPJ       ----------------------------------------------------------------------
DXS_ACTP7       ----------------------------------------------------------------------
DXS_ACTP2       ----------------------------------------------------------------------
DHTK1_HUMAN     RSSLYCSDIGKLVGCAIIHVNGDSPEEVVRATRLAFEYQRQFRKDVIIDLLCYRQWGHNELDEPFYTNPI


                         .         *         .         .         .         .         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYR
ODPA_RHIME      EVQKMRSEHDPIEQVKARLTDKGATEDELKQIDKEVRDIVADSADFAQSDPEPDVSELYTDI--
ODPA_ZYMMO      EVNDMKENHDPLDNLKKDLFAAGVPEAELVKLDEDIRQQVKEAADFAEKAPLPADEELYTNI--
ODPA_RICCN      EVEQYK-ERDPLVIIRKTILDNKVTEADLKAIEQSVKEIVKEAVEFSENSPLPDEGELYTQVY-
ODPA_RICFE      EVEQYK-ERDPLVIIRKTILDNKATEADLKEIEQSVKEIVKEAVKFSENSPLPDEGELYTEVY-
ODPA_RICBR      EVETYK-ERDPITEIRKIILENNASEADLKEIEQSVKEIVKEAVEFSENSPLPNEEELYTQIY-
ODPA_RICTY      EVAKYK-ERDTLVRIRQIILDNKATEEDLKAIERSVQEVIKVAVEFSENSPLPSEDELYTDIY-
ODPA_RICPR      EVEKYK-ERDTLVRIREIILDNKATEADLKAIEQSVREIIKVAVEFSENSPLPAEDELYTEIY-
ODPAT_RAT       EVQNVRSKSDPIMLLRERMISNNLSSEELKEIDADVKKEVEEAAQFATTDPEPPLEDLANYLY-
ODPAT_MOUSE     EVHNVRSKSDPIMLLRERIISNNLSNEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLY-
ODPA_SMIMA      EIQEVRSKSDPIMLLKDRMVNNNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_MOUSE      EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_PIG        EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_BOVIN      EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_HUMAN      EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_DICDI      EVNHVRQTRDPIENIRQIILDNKITEDQLAAIEETVRDEMEKASEKAIAAPLPQARELFTNVY-
ODPA_RAT        EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_PONAB      EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_PANTR      EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPAT_HUMAN     EIQEVRSKRDPIIILQDRMVNSKLTVEELKEIGAEVRKEIDDAAQFATTDPEPHLEELGHHIY-
ODPA_MACFA      EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
ODPA_CAEEL      EIQEVRKTRDPITGFKDRIITSSLTEEELKAIDKEVRKEVDEALKIATSDGVLPPEALYADIY-
ODPT_ASCSU      EIQEVRKTRDPITGFKDKIVTAGLTEDELKEVDKEIRKEVDAAVKQAHTDKEAPVEMLLTDIY-
ODPA_SOLTU      EISGVRQERDPVERIRSLILAHNITEAELKDIEKENRKVVDEAIAKAKESPMPDPSELFTNVY-
ODPA_PEA        EISGVRQERDPIERVRKLLLSHDITEKELKDTEKEVRKEVDEAIAKAKDSPMPDPSDLFSNVY-
ODPA_ASCSU      EVQEVRKTRDPITGFKDKIVTAGLTEDEIKEIDKQVRKEIDAAVKQAHTDKESPVELMLTDIY-
ODPA_YEAST      EIQHMRSKNDPIAGLKMHLIDLGITEAEVKAYDKSARKYVDEQVELADAAPPPEASILFEDVY-
ODPA_KLULA      EIQHMRSKNDPIAGLKMHLLELGITEDEIKAYDKAARKYVDEQVELADAAPAPEASILFEDVY-
ODPA1_ARATH     EISGVRQERDPIERIKKLVLSHDLTEKELKDMEKEIRKEVDDAIAKAKDCPMPEPSELFTNVY-
ODPA2_ARATH     EISGVRQVRDPIERVRKLLLTHDITEKELKDMEKEIRKEVDDAVAQAKESPIPDASELFTNMY-
ODPA_SCHPO      EVQKVRAARDPIEGLKKHIMEWGVANNELKNIEKRIRGMVDEEVRIAEESPFPDPIELFSDVY-
ODPA_PORPU      E-KEAWVARDPIKKLKKHILDNQISSDELNDIQSSVKIDLEQSVEFAMSSPEPNISEL------
ACOA_RALEH      ELDDIRANKDCL-----KLFGRAVTQEELDTIDREVAALIEHAVQEAKAAPQPGPEDLLTDVY-
ODPA_PORYE      E-KEAWVARDPIKKLKKYILDNEIANGELNEIQNAVKTELEQAVKFAISSPEPNMSEL------
ODPA_STAAR      E-DAEWEKKDPLVRFRKFLENKGLWNED------------------------------------
ODPA_STAES      E-DAEWEKKDPLVRFRKYLEAKGLWNED------------------------------------
ODPA_STAEQ      E-DAEWEKKDPLVRFRKYLEAKGLWNED------------------------------------
ODPA_BACSU      EIENEWEQKDPLVRFR------------------------------------------------
ODBA_RAT        EVNYWDKQDHPISRLRQYLLNQGWWDEEQEKARKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQ
ODBA_BACSU      EVEEAKK-SDPLLTYQAYLKETGLLSDEIEQMLDEIMAIVNEATDEAENAPYAAPESALDYVY-
ODPA_STAAW      E-DAEWEKKDPLVRFRKFLENKGLWNED------------------------------------
ODPA_STAAS      E-DAEWEKKDPLVRFRKFLENKGLWNED------------------------------------
ODPA_STAAN      E-DAEWEKKDPLVRFRKFLENKGLWNED------------------------------------
ODPA_STAAM      E-DAEWEKKDPLVRFRKFLENKGLWNED------------------------------------
ODPA_STAAC      E-DAEWEKKDPLVRFRKFLENKGLWNED------------------------------------
ODBA_MOUSE      EVNYWDKQDHPISRLRQYLLNQGWWDEEQEKARKQSRKKVMEAFEQAERKLKPNPSLLFSDVYQ
ODBA_PANTR      EVNYWDKQDHPVSRLRHYLLSQGWWDEEQEKARKQSRKKVMEAFEQAERKPKPNPNLLFSDVYQ
ODBA_HUMAN      EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
ODBA_MACFA      EVNYWDKQDHPISRLRHYLLSQGWWDEEQEKARKQSRKKVMKAFEQAERKPKPNPNLLFSDVYQ
ODBA_THET8      EVAFWRK-KDPIPRFRRFL---------------------------------------------
ODBA_THET2      EVAFWRK-KDPIPRFRRFL---------------------------------------------
ODBA_BOVIN      EVNYWDKQDHPISRLRHHLQSRGWWDDEQEKARKQSRKKVMEAFEQAERKLKPNPSLIFSDVYQ
ODPA_MYCGE      EEEE-GMKSDPVKRLRRSILNQAQEEEMFSKIEQEIQ---------------------------
ODPA_MYCPN      EEAEAMK-SDPVKRLRRGILTPQQEEEMVAKIEQEVQ---------------------------
ODPA_ACHLA      E---------------------------------------------------------------
ODPA_BACST      ELENEWAKKDPLVRFRKFL---------------------------------------------
ODBA_DICDI      EINAWKEGKNPISRLRNYMNHKGWWSDQEKETIANARTTVRESLVNAEKQYKPSINEIFTDVY-
ODBA_PSEAE      DWTNFPLG-DPIARLKRHMIGEEQHEATHKALEAEVLAAQKQAESHGTDGRVPSAASMFEDVY-
ODPA_BACCE      DIENEWEQKDPIVRFR------------------------------------------------
ODBA_PSEPU      DWSHFPLG-DPIARLKQHLIKGHWSEEEHQATTAEFEAAVIAAQKEAENGHIPSAASMFEDVYK
KGD_MYCS2       MYDVIDTKRGSRKAYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHEIEPSES--------
TKTL2_MOUSE     ----------------------------------------------------------------
ODO1_CORGL      MYELITGRETVRAQYTEDLLGGDLSNEDVRDFHDQMESVFNEVKEGGKKQAE------------
KGD_MYCUA       MYDVVDTKRGVRKSYTEALIGGDISEDALRDYQGQLEQVFNEVRELEKHGAQPSES--------
DXS2_GEOMG      ----------------------------------------------------------------
KGD_MYCLE       MYDVVDTKRGARKSYTEALIGGDISEDALRDYQGQLERVFNEVRDLEKHGVQPSES--------
DXS_THERP       ----------------------------------------------------------------
TKTL2_BOVIN     PLPKERADE-------------------------------------------------------
ODO1_STAAB      PYQNIRKN-DSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_DICDI      MYDKIGKQQPIIEKYSNKLIAEKVITQEQY---LQMKNIIHESYEKGYQD--------------
KGD_MYCTU       VYDVVDTKRGARKSYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHGVQPSES--------
KGD_MYCTA       VYDVVDTKRGARKSYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHGVQPSES--------
KGD_MYCBP       MYDVVDTKRGARKSYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHGVQPSES--------
KGD_MYCBO       MYDVVDTKRGARKSYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHGVQPSES--------
ODO1_BACSU      LYDAVRKHPTVKQIFAEKLVKEGVTEEVVQNIEKSVTKRIEDA---------------------
DXS_HELPJ       ----------------------------------------------------------------
DXS_ARCB4       ----------------------------------------------------------------
KGD_MYCSS       MYDVIDTKRGVRKSYTEALIGGDISEDALRDYQGQLEQVFNEVRELEKHEIEPSES--------
KGD_MYCSK       MYDVIDTKRGVRKSYTEALIGGDISEDALRDYQGQLEQVFNEVRELEKHEIEPSES--------
KGD_MYCSJ       MYDVIDTKRGVRKSYTEALIGGDISEDALRDYQGQLEQVFNEVRELEKHEIEPSES--------
TKTL2_HUMAN     PVPKERAD--------------------------------------------------------
DHTK1_XENLA     MYKIIRSRKSIPDVYSERLIAEGMTEEEATEI--------------------------------
TKT_PONAB       ----------------------------------------------------------------
ODO1_STAAU      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_STAAR      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_STAAN      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_STAAM      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_STAA9      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_STAA2      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_STAA1      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAADKMDNPDMEKPAEL------
ODO1_BACLD      LYDAVRKHPTVKNIFAEKLIHKGIVDETVGKIKDAVQKRLEEA---------------------
DXS_SULDN       ----------------------------------------------------------------
TKT_BOVIN       ----------------------------------------------------------------
ODO1_BACA2      LYDAVRKHPTVKRIFAEKLVSEGLSEEKAQNIETAVTKRIEDA---------------------
TKT_PANTR       ----------------------------------------------------------------
TKT_HUMAN       ----------------------------------------------------------------
ODO1_STAAW      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_STAAT      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_STAAS      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_STAAE      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_STAAC      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_STAA8      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_STAA3      PYQNIRK-HDSVEYVFGKKLVNEISEDEMHSFIEQVQKELRQAHD-------------------
ODO1_BACP2      LYDAVRKHKTVKNIFADKLVSEGLTKEQREEIEQAVATRIEEA---------------------
DXS_THIDA       ----------------------------------------------------------------
TKTL1_MOUSE     ----------------------------------------------------------------
ODO1_RICPR      MYNIIKSKPTP-----------------------------------------------------
ODO1_BACSK      TVRAIYAKQLEAEQV--------ITAKEAQKLDTDMYNYLLEEYNKVNSDKSEKKYEL------
KGD_MYCPA       MYDVVDIKRGVRKSYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHGVGPSES--------
DXS_CAMHC       ----------------------------------------------------------------
DXS1_GEOSL      ----------------------------------------------------------------
ODO1_STAHJ      SVEIIYGN----KLVEDGVISKEQMEDVMDKVQKEMR---------------------------
ODO1_BACWK      TVRAIYADQDEVETITQ------FMQEELKAEYAQVPPADTSAATIHVKVPE------------
ODO1_BACHK      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACCZ      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACCQ      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACC7      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACC3      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACC0      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACAN      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACAC      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACAA      TVRAIYADQDEIETITQ------FTQEQLKSDYAQV----------------------------
KGD_MYCVP       MYDVIDTKRGVRKSYTEALIGGDISEDALRDYQGQLERVFNEVRELEKHAIAPSSS--------
DXS_RALPJ       ----------------------------------------------------------------
DXS_NITSB       ----------------------------------------------------------------
TKT_MACFA       ----------------------------------------------------------------
TKTL1_HUMAN     RADAI-----------------------------------------------------------
ODO1_RICTY      MYNIIKSKPTPGNIYANELVKSGIIDNN------------------------------------
ODO1_BACCR      TVRAIYADQDEVETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACC4      TVRAIYADQDEVETITQ------FTQEQLKSDYAQV----------------------------
ODO1_BACC2      TVRAIYADQDEVETITQ------FTQEQLKSDYAQV----------------------------
DXS_HELPY       ----------------------------------------------------------------
DXS_HELPH       ----------------------------------------------------------------
DXS_HELPG       ----------------------------------------------------------------
DXS_FRATW       ----------------------------------------------------------------
DXS_FRATT       ----------------------------------------------------------------
DXS_FRATO       ----------------------------------------------------------------
DXS_FRATN       ----------------------------------------------------------------
DXS_FRATM       ----------------------------------------------------------------
DXS_FRATH       ----------------------------------------------------------------
DXS_FRATF       ----------------------------------------------------------------
DXS_FRAT1       ----------------------------------------------------------------
DXS_FRAP2       ----------------------------------------------------------------
DXS_ERYLH       ----------------------------------------------------------------
ODO1_BACC1      ----------------------------------------------------------------
DXS_SYNPX       ----------------------------------------------------------------
ODO1_RICBR      MYNIIKSKLTPGNIYANELVKSGVIDNNYEQFKAKLDKEYEQAKNYKQ----------------
DXS_SYMTH       ----------------------------------------------------------------
DXS_PROMT       ----------------------------------------------------------------
DXS_PROMP       ----------------------------------------------------------------
DXS_PROM9       ----------------------------------------------------------------
DXS_PROM2       ----------------------------------------------------------------
DXS_PROM1       ----------------------------------------------------------------
DXS_PROM0       ----------------------------------------------------------------
DXS_CAPAN       ----------------------------------------------------------------
DXS_ACIAD       ----------------------------------------------------------------
DHTK1_DANRE     SIPDSYADQ-------------------------------------------------------
TKT_RAT         ----------------------------------------------------------------
TKTL1_MACFA     ----------------------------------------------------------------
ODO1_RICCN      MYNIIKNKLTPGNIYANELVKSGVIDNNYEEFKAKLDKEYEQAKSYKQ----------------
ODO1_BRUSU      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUSI      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUO2      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUME      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUMB      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUC2      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUAB      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUA2      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
ODO1_BRUA1      MYKAIRAHKTTVQLYGEKLIAEGLTQDDIDRMKADWRQ--------------------------
DXS_RALME       ----------------------------------------------------------------
DXS_PROMS       ----------------------------------------------------------------
DXS_NATTJ       ----------------------------------------------------------------
ODO1_RICFE      MYNIIKSKPTPGNIYANELVKSGIIDNNFAKLKEEFKAKLDKEFEQAKN---------------
ODO1_CAEEL      MYQRIKQTKTALEKYQEKILNEGVANEQYVKEETKYGSILEDAYENAQ----------------
ODO1_AZOVI      MYQKIAKQPTTRELYADALVGSLSQEEVQAKVD-EYRTALDNGQHVLKSLVKEPNTELFVD---
DXS_SYNJB       ----------------------------------------------------------------
DXS_SPHAL       ----------------------------------------------------------------
DXS_RHOPT       ----------------------------------------------------------------
DXS_RHOPA       ----------------------------------------------------------------
DXS_RALSO       ----------------------------------------------------------------
TKT_MOUSE       ----------------------------------------------------------------
ODO1_LEPIN      MYAIIKNHPPTVKLYEKRLVEGDIPQEDI-----------------------------------
ODO1_LEPIC      MYAIIKNHPPTVKLYEKRLVEGDIPQEDI-----------------------------------
ODO1_CAEBR      MYQRIKQTKTALEKYQEKILNEGVANEQYVKEETKYGAILEDAYENAQ----------------
DXS_SYNWW       ----------------------------------------------------------------
DXS_RALEJ       ----------------------------------------------------------------
DXS_PSYCK       ----------------------------------------------------------------
DXS_CAMJD       ----------------------------------------------------------------
DXS_BRAJA       ----------------------------------------------------------------
DXS_ARATH       ----------------------------------------------------------------
ODO1_BACHD      GVYQIIRKHPTVRELKQLVKKGLIDEQTVKQLDDEVQ---------------------------
DXS_RHOP5       ----------------------------------------------------------------
DXS_RALEH       ----------------------------------------------------------------
DXS_CYTH3       ----------------------------------------------------------------
DXS_CUPTR       ----------------------------------------------------------------
DXS_BAUCH       ----------------------------------------------------------------
DXS_ACIBY       ----------------------------------------------------------------
DXS_ACIBS       ----------------------------------------------------------------
DXS2_RHORT      ----------------------------------------------------------------
DXS1_RHORT      ----------------------------------------------------------------
ODO1_HAEIN      MYSIIKKHPTPRKVYADRLVSEGMTEEQVTEMANDYRDALDNGDRVVSEWREMDTAKM------
DXS_SYNS9       ----------------------------------------------------------------
DXS_PSYA2       ----------------------------------------------------------------
DXS_PROM5       ----------------------------------------------------------------
DXS_HAHCH       ----------------------------------------------------------------
DXS_CAMFF       ----------------------------------------------------------------
DXS_SYNJA       ----------------------------------------------------------------
DXS_PSEPW       ----------------------------------------------------------------
DXS_PSEPK       ----------------------------------------------------------------
DXS_PSEPG       ----------------------------------------------------------------
DXS_PSEP1       ----------------------------------------------------------------
DXS_PROM4       ----------------------------------------------------------------
DXS_CLOBA       ----------------------------------------------------------------
DXS_BART1       ----------------------------------------------------------------
DHTK1_RAT       MYKIIRARKSIPDTYAEHLIASGMTQEEVSDIKASYAKLNGHLANVAHYSP-------------
DHTK1_CAEEL     SVPRLFLDRTTEEAVKEQLKHTEQLNNELKKVDSTV----------------------------
DXS_TRIEI       ----------------------------------------------------------------
DXS_SPHWW       ----------------------------------------------------------------
DXS_RHILW       ----------------------------------------------------------------
DXS_RHIE6       ----------------------------------------------------------------
DXS_PROMM       ----------------------------------------------------------------
DXS_PROM3       ----------------------------------------------------------------
DXS_PELUB       ----------------------------------------------------------------
DXS_DECAR       ----------------------------------------------------------------
DXS_CLOBB       ----------------------------------------------------------------
DXS_CAMJR       ----------------------------------------------------------------
DXS_CAMJJ       ----------------------------------------------------------------
DXS_CAMJE       ----------------------------------------------------------------
DXS2_ZYMMO      ----------------------------------------------------------------
DXS1_ZYMMO      ----------------------------------------------------------------
DXS_SYNR3       ----------------------------------------------------------------
DXS_RHOPS       ----------------------------------------------------------------
DXS_PROMA       ----------------------------------------------------------------
DXS_HYPNA       ----------------------------------------------------------------
DXS_DIAST       ----------------------------------------------------------------
DXS_BRASO       ----------------------------------------------------------------
DXS_BRASB       ----------------------------------------------------------------
DXS_BARBK       ----------------------------------------------------------------
DXS_ACISJ       ----------------------------------------------------------------
ODO1_STAS1      SVDILYGKQLVNENI--------ISENQMNQIFDDVQNTLRAAHDIDKNDKMDNP---------
ODO1_SCHPO      MYKAIAKHPPTFKIYTQQLLQEKTVSK--AEVDAQEKRV-------------------------
DXS_SYNS3       ----------------------------------------------------------------
DXS_PASMU       ----------------------------------------------------------------
DXS_NITWN       ----------------------------------------------------------------
DXS_HAEDU       ----------------------------------------------------------------
DXS_BUCAT       ----------------------------------------------------------------
DXS_BUCAP       ----------------------------------------------------------------
DXS_BUCAI       ----------------------------------------------------------------
DXS_BUCA5       ----------------------------------------------------------------
DXS_BLOPB       ----------------------------------------------------------------
DXS_BARHE       ----------------------------------------------------------------
DXS_ACTPJ       ----------------------------------------------------------------
DXS_ACTP7       ----------------------------------------------------------------
DXS_ACTP2       ----------------------------------------------------------------
DHTK1_HUMAN     MYKIIRARKSPDTYAEHLIAGGLMTQEEVSEIKSSYYAKLND----------------------