[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE40088.1

[Show Plain Result]


## Summary of Sequence Search
    1::217
   32::121     2e-05  32%  202 aa  SLMA_HAEDU RecName: Full=HTH-type protein slmA;
   16::64      4e-05  41%  215 aa  ACRR_SHIFL RecName: Full=HTH-type transcriptional regulator
   16::64      4e-05  41%  215 aa  ACRR_ECOLI RecName: Full=HTH-type transcriptional regulator
   16::64      4e-05  41%  215 aa  ACRR_ECOL6 RecName: Full=HTH-type transcriptional regulator
   17::73      6e-05  32%  202 aa  Y1255_MYCTU RecName: Full=Uncharacterized HTH-type
   33::124     7e-05  30%  202 aa  SLMA_ACTPJ RecName: Full=HTH-type protein slmA;
   33::124     7e-05  30%  202 aa  SLMA_ACTP7 RecName: Full=HTH-type protein slmA;
   33::124     7e-05  30%  202 aa  SLMA_ACTP2 RecName: Full=HTH-type protein slmA;
   15::73      3e-04  32%  210 aa  YCFQ_ECOLI RecName: Full=Uncharacterized HTH-type transcriptional
    4::68      3e-04  28%  196 aa  SLMA_VIBFM RecName: Full=HTH-type protein slmA;
    4::62      5e-04  31%  196 aa  SLMA_VIBF1 RecName: Full=HTH-type protein slmA;
    6::62      5e-04  34%  196 aa  SLMA_VIBCH RecName: Full=HTH-type protein slmA;
    7::99      6e-04  30%  205 aa  YFIR_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    6::62      6e-04  36%  196 aa  SLMA_VIBHB RecName: Full=HTH-type protein slmA;
    6::62      8e-04  36%  196 aa  SLMA_VIBPA RecName: Full=HTH-type protein slmA;
    1::217

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxPRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRA
SLMA_HAEDU      --------------------------------------------------QGMQRVTTERLAKAVGVSEG
ACRR_SHIFL      ---------------------------------------ILDVALRLFSQQGVSSTSLGEIAKAAGVTRG
ACRR_ECOLI      ---------------------------------------ILDVALRLFSQQGVSSTSLGEIAKAAGVTRG
ACRR_ECOL6      ---------------------------------------ILDVALRLFSQQGVSSTSLGEIAKAAGVTRG
Y1255_MYCTU     -------------------------------------DRILDAAERLFTQRDPASIGMNEIAKAAGCSRA
SLMA_ACTPJ      ---------------------------------------------------GMQRVTTERLAKAVGVSEG
SLMA_ACTP7      ---------------------------------------------------GMQRVTTERLAKAVGVSEG
SLMA_ACTP2      ---------------------------------------------------GMQRVTTERLAKAVGVSEG
YCFQ_ECOLI      ------------------------------RPKVFDRDAALDKAMKLFWQHGYEATSLADLVEATGAKAP
SLMA_VIBFM      -----------------------------PRKPNRRDEILQALAEMLESNEGAARITTAKLAKQVGVSEA
SLMA_VIBF1      -----------------------------PRKPNRRDEILQALAEMLESNEGAARITTAKLAKQVGVSEA
SLMA_VIBCH      --------------------------------KINRREEILQAAEMLESNEGASRITTAKLAKQVGVSEA
YFIR_BACSU      --------------------------------KEHKDKEILEAAKTVFKRKGFELTTMKDVVEESGFSRG
SLMA_VIBHB      --------------------------------KTNRREEILQAAQMLESTEGASRITTAKLAKQVGVSEA
SLMA_VIBPA      --------------------------------KSNRREEILQAAQMLESAEGASRITTAKLAKQVGVSEA


                         .         .         *         .         .         .         .:140
query           ALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGDxxx
SLMA_HAEDU      ALYRYFPSKSKMFEALIERIEQTLTSYINASENSTALAVLYTVIEFARKNPGVTRILTGHALMF------
ACRR_SHIFL      AIYWHFKDKSDLFSEIWE----------------------------------------------------
ACRR_ECOLI      AIYWHFKDKSDLFSEIWE----------------------------------------------------
ACRR_ECOL6      AIYWHFKDKSDLFSEIWE----------------------------------------------------
Y1255_MYCTU     TLYRYFDSREALRTAYVHRETRRL----------------------------------------------
SLMA_ACTPJ      ALYRYFPSKTKMFEALIERIEQTLTGYINASTASTVKAILYTVIEFARKNPGVTRILTGHALMFEDD---
SLMA_ACTP7      ALYRYFPSKTKMFEALIERIEQTLTGYINASTASTVKAILYTVIEFARKNPGVTRILTGHALMFEDD---
SLMA_ACTP2      ALYRYFPSKTKMFEALIERIEQTLTGYINASTASTVKAILYTVIEFARKNPGVTRILTGHALMFEDD---
YCFQ_ECOLI      TLYAEFTNKEGLFRAVLDR---------------------------------------------------
SLMA_VIBFM      ALYRHFPSKAKMFEGLIEFIEESI----------------------------------------------
SLMA_VIBF1      ALYRHFPSKAKMFEGLIE----------------------------------------------------
SLMA_VIBCH      ALYRHFPSKARMFEGLIE----------------------------------------------------
YFIR_BACSU      GVYLYFSSTEEMFRRIIETGLDEGLRKLDKSAEHQSVASISSYLDELTEGL-------------------
SLMA_VIBHB      ALYRHFPSKARMFEGLIE----------------------------------------------------
SLMA_VIBPA      ALYRHFPSKARMFEGLIE----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLMA_HAEDU      ----------------------------------------------------------------------
ACRR_SHIFL      ----------------------------------------------------------------------
ACRR_ECOLI      ----------------------------------------------------------------------
ACRR_ECOL6      ----------------------------------------------------------------------
Y1255_MYCTU     ----------------------------------------------------------------------
SLMA_ACTPJ      ----------------------------------------------------------------------
SLMA_ACTP7      ----------------------------------------------------------------------
SLMA_ACTP2      ----------------------------------------------------------------------
YCFQ_ECOLI      ----------------------------------------------------------------------
SLMA_VIBFM      ----------------------------------------------------------------------
SLMA_VIBF1      ----------------------------------------------------------------------
SLMA_VIBCH      ----------------------------------------------------------------------
YFIR_BACSU      ----------------------------------------------------------------------
SLMA_VIBHB      ----------------------------------------------------------------------
SLMA_VIBPA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxx
SLMA_HAEDU      -------
ACRR_SHIFL      -------
ACRR_ECOLI      -------
ACRR_ECOL6      -------
Y1255_MYCTU     -------
SLMA_ACTPJ      -------
SLMA_ACTP7      -------
SLMA_ACTP2      -------
YCFQ_ECOLI      -------
SLMA_VIBFM      -------
SLMA_VIBF1      -------
SLMA_VIBCH      -------
YFIR_BACSU      -------
SLMA_VIBHB      -------
SLMA_VIBPA      -------