[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE37468.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbnO.bssp"
#ERROR : Can't open dsspfile "1a32A.bssp"
#ERROR : Can't open dsspfile "1dk1A.bssp"

## Summary of PDB Search
:89
    3e-23  37%  3bbnO  [x.x.x] RIBOSOMAL PROTEIN S15
    2e-22  54%  1a32A  [x.x.x] RIBOSOMAL PROTEIN S15
    4e-16  51%  1dk1A  [a.16.1] 30S RIBOSOMAL PROTEIN S15
:89

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
3bbnO           -----KNSFISVISDEKKEENKGSVEFQVFCFTNKIRRLTLHLELHKKDYSSQRGLRKTLGKRQRLLAYL
1a32A           --LTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRRLLAYL
1dk1A           -----KEEKQKVQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGL--LVGQRRRLLRYL


                         .         .         *         .         .         .         .:140
query           KKKDEARYKALLEKHNIRx
3bbnO           LKINGVRYKELISKLNIR-
1a32A           RNKDVARYREIVEKLGL--
1dk1A           QREDPERYR-LIEKLGI--