[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE37597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "3dpuB.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "1c05A.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "3bbnD.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "2cqjA.bssp"
#ERROR : Can't open dsspfile "1dm9B.bssp"

## Summary of PDB Search
:426
    3e-28  17%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    1e-24  15%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    7e-24  16%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    1e-22  13%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    2e-21  13%  3dpuB  [x.x.x] RAB FAMILY PROTEIN
    4e-20  16%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    1e-13  17%  1c05A  [d.66.1] RIBOSOMAL PROTEIN S4 DELTA 41
    4e-12  14%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-09  17%  3bbnD  [x.x.x] RIBOSOMAL PROTEIN S4
    9e-07  13%  1dm9A  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    1e-06  24%  2cqjA  [x.x.x] U3 SMALL NUCLEOLAR RIBONUCLEOPROTEIN PROTEIN
    2e-04  25%  1dm9B  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
:426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxLLEVVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVA
3dh3B           --------------------------------------DSSVRLNKYIS-ESGICSRREADRYIEQGNVF
3dh3A           --------------------------------------DSSVRLNKYIS-ESGICSRREADRYIEQGNVF
3dh3C           ------------------------------------------RLNKYIS-ESGICSRREADRYIEQGNVF
2ab4A           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
1c05A           -------------------------------------ILLESRLDNLVYRLGLARTRRQARQLVTHGHIL
2ausA           ----------------------------------------------------------------------
3bbnD           -----------------------------STGQVLLQLLEM-RLDNILFRLGMAPTIPGARQLVNHRHIL
1dm9A           ------------------------------------------RLDKWLWAARFYKTRALAREMIEGGKVH
2cqjA           ------------------------------------------RLPTVLLKLRMAQHLQAAVAFVEQGHVR
1dm9B           ------------------------------------------RLDKWLWAARFYKTRALAREMIEGGKVH


                         +         .         .         .         .         *         .:210
query           IRGAPVRDPAYHAASGETITIDXXXXXXXXXXXXXXXLXXXXXXXXXXXXXKPRGLVVHPAAGHETGTLV
3dh3B           LNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALN------------KPVGIVSTTEDGERDNIVD
3dh3A           LNGKRATIGDQVKPGDVVKVNGQLIEPREA---------------------EDLVLIALNKPVGIVSTTE
3dh3C           LNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALN------------KPVGIVSTTEDGERDNIVD
2ab4A           ---------------------------------------------------KPKGPTSHDVVDE------
3dpuB           ---------------------------------------------------IPRLMIAMQ------HQIL
2apoA           ---------------------------------------------------KPRGPTSHEVSTW------
1c05A           VDGSRVNIPSYRVKPGQTIAVR-EKSRNLQVIKEALEANNYIPDYLSFDPEKMEGTYTRLPERSELPAEI
2ausA           ---------------------------------------------------KPPGPTSHEVVAW------
3bbnD           VNGRIVDIPSYRCKPQDTIMAR---------------------DEQKSIALIQNSLDLSPREELPKHLTL
1dm9A           YNGQRSKPS-KIVELNATLTLRQGNDERTVIVKAITEQRRPASEAALLYEETAESVEKR-----------
2cqjA           VGPDVVTDPAFLVTRSMEDFVT------------------------------------------------
1dm9B           YNGQRS-KPSKIVELNATLTL-------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
3dh3B           FVNHSKRVF------------PIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKE------YLVTVDK-
3dh3A           DG---ERDNIVDFVNHSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKE------YLVTVDKP
3dh3C           FVNHSK------------RVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKE------YLVTVDKP
2ab4A           ----------VRKKLKTRKVGHGGTLDPFACGVLIIGVNQGTRILEFYK--------DLKKVFWVKMRLG
3dpuB           DRMQW------------RYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPR----CKREYLSIIWYEI
2apoA           ----------VKKILNLDKAGHGGTLDPKVTGVLPVALERATKTIPMWH--------IPPKEYVCLMHLH
1c05A           NEA-------------------------------------------------------------------
2ausA           ----------IKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAG--------KEYVALMHLH
3bbnD           N--------PFPYKGLVNQIIDSKWVGLKINELLV-----------------------------------
1dm9A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
3dh3B           ----------PITEEFIRGMSAGVPLGTVTKKCKVKKEAP----------FVFRITLVQGLNRQIRRMCE
3dh3A           ITEEFIRGMSAGVPILGTV-------------TKKCKVKKEA-------PFVFRITLVQGLNRQIRRMCE
3dh3C           ITEEFIRGMSAGVPILG----------TVTKKCKVKKEAP----------FVFRITLVQGLNRQIRRMCE
2ab4A           LITIREAIFSFVGEYDQVPPAYSAKKKGERLYKLAREGKIINLPPKRVKIRDVSFRVEVSPGTYIRSLCM
3dpuB           KTNLDVKEFIPLPGHPDEKELLGLEKMGRDRYVSGKLEKVFSVS------KMLDSVIS------------
2apoA           RDASEEDILRVF-------KEFTGRIYQRRIRKIHELELLDKD------GKDVLFRVKCQSGTYIRKLCE
1c05A           ----------------------------------------------------------------------
2ausA           GDVPEDKIRAVMKEFEG--------EIIQRKVYYIEI----LEIDGRDVLFRVGVEAGTYIRSLIHHIGL
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLxx
3dh3B           HFGYEVKKLERTR--------------------IMNVSLSGIPLGEWRDLTDDELIDLFKLIENSSSE--
3dh3A           HFGYEVKKLERTRI--------------------MNVSLSGIPLGEWRDLTDDELIDLFKLIENSSS---
3dh3C           HFGYEVKKLERTRI--------------------MNVSLSGIPLGEWRDLTDDELIDLFKLIENS-----
2ab4A           DIGYKLGCGATAV-------------------ELVRESVGPHTIEESLNVFEAAPEEIENRIIPLEKC--
3dpuB           ----------------------------------------------------------------------
2apoA           DIGEALGTSAHMQELRRTKSGCFEEKDAVYLQD-LLDAYVFWKEDGDEEELRRVIKPMEYGLRHLKKV--
1c05A           ----------------------------------------------------------------------
2ausA           ALGVGAHMAELRRTRS------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
1dm9B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxx
3dh3B           ------
3dh3A           ------
3dh3C           ------
2ab4A           ------
3dpuB           ------
2apoA           ------
1c05A           ------
2ausA           ------
3bbnD           ------
1dm9A           ------
2cqjA           ------
1dm9B           ------