[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE37710.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ar1A.bssp"

## Summary of PDB Search
:137
    7e-39  38%  2ar1A  [x.x.x] HYPOTHETICAL PROTEIN
:137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNXXXXXXXXXXXXXXX
2ar1A           IHYWLLKSEPHKFSIDDLAKQKT--SPWDGVRNYAARNNMRAMSVGDKVLFYHSNTKEPGVAGLAEVVRL


                         .         .         *         .         .         .         .:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGx
2ar1A           YDDFTKEKNPWKMVDVKFVARWDTVLTLHELKSRRELQKMALFTQRRLSVQPVSASEYAYILRMNE-