[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE37731.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1brmC.bssp"
#ERROR : Can't open dsspfile "1brmB.bssp"
#ERROR : Can't open dsspfile "1brmA.bssp"
#ERROR : Can't open dsspfile "1b7gO.bssp"
#ERROR : Can't open dsspfile "1cf2P.bssp"
#ERROR : Can't open dsspfile "2b4rO.bssp"
#ERROR : Can't open dsspfile "2cvoD.bssp"
#ERROR : Can't open dsspfile "2duuA.bssp"
#ERROR : Can't open dsspfile "3dr3A.bssp"
#ERROR : Can't open dsspfile "3dbvO.bssp"
#ERROR : Can't open dsspfile "1dbvO.bssp"
#ERROR : Can't open dsspfile "2cvoA.bssp"
#ERROR : Can't open dsspfile "2d2iA.bssp"
#ERROR : Can't open dsspfile "3docD.bssp"
#ERROR : Can't open dsspfile "3e1kC.bssp"
#ERROR : Can't open dsspfile "3c1aA.bssp"

## Summary of PDB Search
:344
    3e-48  24%  1brmC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-47  22%  1brmB  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    6e-45  23%  1brmA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-39  13%  1b7gO  [c.2.1 - d.81.1] PROTEIN (GLYCERALDEHYDE 3-PHOSPHATE
    4e-34  18%  1cf2P  [c.2.1 - d.81.1] PROTEIN (GLYCERALDEHYDE-3-PHOSPHATE
    7e-26  18%  2b4rO  [x.x.x] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    2e-25  11%  2cvoD  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    3e-19  21%  2duuA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    1e-16  14%  3dr3A  [x.x.x] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    1e-15  21%  3dbvO  [c.2.1 - d.81.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    2e-15  21%  1dbvO  [c.2.1 - d.81.1] GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
    8e-14  11%  2cvoA  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    2e-12  21%  2d2iA  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    6e-12  15%  3docD  [x.x.x] GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE
    5e-05  14%  3e1kC  [x.x.x] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    7e-04  17%  3c1aA  [x.x.x] PUTATIVE OXIDOREDUCTASE
:344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
1brmC           --KNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQASFGGTTGTLQDAFDLEALKALDIIVT
1brmB           --KNVGFIGWRGMVGSVLMQRMVEE--RDFDAIRPVFFSTSQLGFGGTTGTLQDFDLEALKALDIIVTCQ
1brmA           --KNVGFIGWRGMVGSVLMRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAEALKALDIIVTCQ
1b7gO           ---NVAVNGYGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGIRIYPVAGTVEDLIKTSDIVVD
1cf2P           ---AVAING-YGTVGKRVAKVIGVSKTRPDFEARMALKKGYDLYVAIEKAGIEVAGTVDDMLDEADIVID
2b4rO           -------------------------------------------------------SQIPWGKCQVDVVCE
2cvoD           --VRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADFSNVD
2duuA           MTIRVAINGF-GRIGRNFLRCWFGRQNTDLEVVAINNTSDARTDISYDENSITVNLNLPWKEWDIDLVIE
3dr3A           ---NTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNDAGKLISDLHPQLKGIVELPLQPMSDISEF
3dbvO           -------------------------------------------------------ENLAWGEIGVDIVVE
1dbvO           -------------------------------------------------------ENLAWGEIGVDIVVE
2cvoA           EEVRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVADFSNVDAV
2d2iA           MTIRVAINGF-GRIGRNFLRCWFGRQNTDLEVVAINNLGRFNADISYDENSITVNGKTPWKEWDIDLVIE
3docD           ----------------------------------------------------------PWKEENVDIALE
3e1kC           ---RVGFVGL-TSGKSWVAKTHFLQLSSQFQIVALYNPTLKSSL--QTIEQLQLKHATGFDYKDIDMIVV
3c1aA           ---RLALIG-AGRWGKNYIRTI--AGLPGAALVRLASSNPDNLALVPPGCVIESDWRSVVSAPEVEAVII


                         .         .         *         .         .         .         .:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
1brmC           CQGGDYTNEIYPKLRESGWYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGTFVGGNCTVSLMLMSLG
1brmB           GGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGTFVGGNCTVSLMLMSLG
1brmA           GGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGTFVGGNCTVSLMLMSLG
1b7gO           TTPNGVGAQYKPIYLQLQRNAIFQGGEKAEVADISFSALCNYNE----ALGKKYIRVVSCNTTALLRTIC
1cf2P           CTPEGIGAKNLKMYKEKGIKAIFQGGEKHEDIGLSFNSLSNYEESY----GKDYTRVVSCNTTGLCRTLK
2b4rO           STGVFLTKELASSHLKGGAKKVIMSAPPKDD--TPIYVMGINHHQYDT--KQLIVSNASCTTNCLAPLAK
2cvoD           AVFCLPHGTTQEIIKGLPQKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGLTEVLRNEIRNARL
2duuA           STGVFVTAEGASKHIQAGAKKV-LITAPGKAEGVGTYVIGVNDSEYRHEDFAVIS-NASCTTNCLAPVAK
3dr3A           SPGVDVVFLATAHEVSHDLAPQFLEAGVVFDLSGAFRVNDATFYEKYYGFTHQYPELLEQAAYGLAEWCG
3dbvO           STGRFTKREDAAKHLEAGAKKVIISAPAKNED--ITIVMGVNQDKYDPKAHH-VISNASCTTNCLAPFAK
1dbvO           STGRFTKREDAAKHLEAGAKKVIISAPAKNE--DITIVMGVNQDKYDPK-AHHVISNASCTTNCLAPFAK
2cvoA           FCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVY-GLTEVLRNEIRNAR
2d2iA           STGVFVTAEGASKHIQAGAKKVLITAPGKAEGV-GTYVIGVNDSEYRH-EDFAVISNASCTTNCLAPVAK
3docD           CTGIFTSRDKAALHLEAGAKRVIVSAPADGA--DLTVVYGVNNDKLTKDHL--VISNASCTTNCLAPVAQ
3e1kC           SVKVPEHYEVVKNILEHSSQNLNLRYLYVEWA-LAASVQQAEELYSISQQRANLQICLQGRKSPYIVRAK
3c1aA           ATPPATHAEITLAAIASGKAVLVEKPLTLD-------LAEAEAVAAAAKATGVVWVEHTQLFNPAWEALK


                         +         .         .         .         .         *         .:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
1brmC           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYSAILDIERKVTTLTRSGELVPLAGSLIPWIDK
1brmB           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADEERKVTTLTRSGELPGVPLAGSLIPWI
1brmA           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYLDIERKVTTLTRSGELPVDNFGVPLAGSLIPW
1b7gO           TVNKVSKVEKVRATIVRRAADQKEVKKGPINSLVPDPAT-----VPSHHAKDVNSVIRNLDIATMAVIAP
1cf2P           PLHDSFGIKKVRAVIVRRGADPAQVSKG-------------------------------PINAIIPNPPK
2b4rO           VINDRFGIVEGLMTTVHA-------------------STANQLVVDGPSKGGKDWRAGRCALSNIIPAST
2cvoD           VANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKEANLYTEIAEGIH----AYGIKGHR
2duuA           VLHDNFGIIKGTMTTTHSYARAAAVNIVPTTTGAAKAVALVIPELKGKLNGIALRVPTPNVSVVDLVVQV
3dr3A           NKLKEANLIAVPGCYPTAAQLALKPLIDADLLDLNQWPVINATSGVSGAGRKAAIS-NSFCEVSLQPYGV
3dbvO           VLHEQFGIVRGMMTTVHSYTNDQRILDASHKDLRR------------------ARAAAESIIPTTTGAAK
1dbvO           VLHEQFGIVRGMMTTVHSYTNDQRILDASHKDL-------------RRARAAAESIIPTTTGAAKA----
2cvoA           LVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKANLYTEIAEGIHAYGIKGHRHVPE
2d2iA           VLHDNFGIIKGTMTTTHSYTLDQRILDASHRDL-------------RRARAAAVNIVPTTTGAA------
3docD           VLNDTIGIEKGFMTTIHSYTGDQPTLDTMHKDL------------YRARAAALSMIPTSTGAAKAVGLVL
3e1kC           ELISEGCIGDINSIEISGNGG-------------------------------------------------
3c1aA           ADLTSIGPILAV----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
1brmC           EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAWAKVVPNDREITMRE
1brmB           DEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAWAKVVPNDREITMRE
1brmA           IDWKGQAETNKILSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAPWAKVVPNDREITMRE
1b7gO           TTLMHMHFINITLDKVEKKDILSVLENTPRIVLISSKYDAEATAELVEVARDLKRDRNDIYVKDDEVMLM
1cf2P           LPSHHGPDVKTVLD--INIDTMAVIVPTTLMHQHNVMVEVEETPTVDDIIDVFEDTPRVILISAEDG---
2b4rO           GAAKAVGKVLPELN--GKLTGVAFRVPIGTVSVVDLVCRLQKPAKYEEVALEIKKAAEGPLKGILGYTED
2cvoD           HVPEIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSYEGEEFVKLLNGSSV
2duuA           EKPTITEQVNEVMKGIIKYSDLPLVSSDFRGTDESSIVDSSLTL--------------------------
3dr3A           FTHRHQPEIATHLG--ADVIFTPHLGNFPRGILETITCRLKSGVTQAQVAQALQQAYAHKPLVRLYDKGV
3dbvO           AVALVLPEL------KGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALK----------------
1dbvO           -------VALVLPELKGKLNGMAMRVPTPNVSVVDLVAELEKEVTVEEVNAALK----------------
2cvoA           IEQGLSE----AAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKTYEGEEFVKLLNGSSV
2d2iA           ---KAVALVIPELK--GKLNGIALRVPTPNVSVVDLVVQVEKPTITEQVNEVLQKASQT-----------
3docD           PELK------------GKLDGVAIRVPTPNVSVVDLTFIAKRETTVEEVNNAIREAANGRLKG-------
3e1kC           ----------------------------------------------------------------------
3c1aA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKxxxxxxxxx
1brmC           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL-------------
1brmB           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL-------------
1brmA           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQL-------------
1b7gO           YAVHQESIVVPENIDAIRASMKLMSAEDSMRITNESLGILK-----------------------
1cf2P           LTSTAEIMEYAKELGRSRNDLFEIPVWRESITVVDNEIYYMQAVHQESDIVPEN----------
2b4rO           -EVVSQDFVHDNRSSIFDMKAGLALNLVSWY--DN-----------------------------
2cvoD           PHTRHVVGSNYCFMNVFEDRI--PGRAIIISVIDNLVKGASGQAVQNLNLMM------------
2duuA           ----------------------------------------------------------------
3dr3A           PALKNVVGLPFCDIGFAVQG----EHLIIVATEDNLLKGAAAQAVQCANIR-------------
3dbvO           ----------------------------------------------------------------
1dbvO           ----------------------------------------------------------------
2cvoA           PHTRHVVGSNYCFMNVFEDR--IPGRAIIISVIDNLVKGASGQAVQNLNLMMGLP---------
2d2iA           ----------------------------------------------------------------
3docD           ILGYTDEKLVSHDFNHDSHSSVFHTDQ-TKVMDGTMVRILS-----------------------
3e1kC           ----------------------------------------------------------------
3c1aA           ----------------------------------------------------------------