[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38106.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3btaA.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3cawA.bssp"
#ERROR : Can't open dsspfile "1a8rA.bssp"
#ERROR : Can't open dsspfile "3dqqA.bssp"
#ERROR : Can't open dsspfile "2a8mB.bssp"
#ERROR : Can't open dsspfile "2bjnB.bssp"
#ERROR : Can't open dsspfile "2c0jB.bssp"
#ERROR : Can't open dsspfile "2cfhC.bssp"
#ERROR : Can't open dsspfile "2cfhD.bssp"
#ERROR : Can't open dsspfile "3c8cA.bssp"
#ERROR : Can't open dsspfile "2a8jB.bssp"
#ERROR : Can't open dsspfile "1azsA.bssp"
#ERROR : Can't open dsspfile "2bw7B.bssp"
#ERROR : Can't open dsspfile "1cjtA.bssp"
#ERROR : Can't open dsspfile "2btvA.bssp"
#ERROR : Can't open dsspfile "3e4pB.bssp"
#ERROR : Can't open dsspfile "3by9B.bssp"
#ERROR : Can't open dsspfile "3e4oA.bssp"
#ERROR : Can't open dsspfile "3by9A.bssp"
#ERROR : Can't open dsspfile "3by8A.bssp"
#ERROR : Can't open dsspfile "2ae8E.bssp"

## Summary of PDB Search
:494
    2e-39   8%  3btaA  [d.92.1 - h.4.2 - b.29.1 - b.42.4] PROTEIN (BOTULINUM
    3e-33  43%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    3e-32  44%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    5e-25  15%  3cawA  [x.x.x] O-SUCCINYLBENZOATE SYNTHASE
    3e-23  11%  1a8rA  [d.96.1] GTP CYCLOHYDROLASE I
    2e-22   9%  3dqqA  [x.x.x] PUTATIVE TRNA SYNTHASE
    6e-21   9%  2a8mB  [x.x.x] THREONINE ASPARTASE 1
    1e-20   4%  2bjnB  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    1e-17   6%  2c0jB  [x.x.x] R32611_2
    2e-17   8%  2cfhC  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    3e-17   8%  2cfhD  [x.x.x] TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 6B
    2e-16  11%  3c8cA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN
    3e-16   8%  2a8jB  [x.x.x] THREONINE ASPARTASE 1
    3e-16   8%  1azsA  [d.58.29] VC1
    3e-16  10%  2bw7B  [x.x.x] ADENYLATE CYCLASE
    5e-16   9%  1cjtA  [d.58.29] ADENYLATE CYCLASE, TYPE V
    9e-15   5%  2btvA  [e.28.1] PROTEIN (VP3 CORE PROTEIN)
    4e-13  16%  3e4pB  [x.x.x] C4-DICARBOXYLATE TRANSPORT SENSOR PROTEIN DCTB
    2e-12  11%  3by9B  [x.x.x] SENSOR PROTEIN
    3e-10  13%  3e4oA  [x.x.x] C4-DICARBOXYLATE TRANSPORT SENSOR PROTEIN DCTB
    3e-09  10%  3by9A  [x.x.x] SENSOR PROTEIN
    3e-08  12%  3by8A  [x.x.x] SENSOR PROTEIN DCUS
    1e-04  15%  2ae8E  [x.x.x] IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE
:494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMRGNAQELARQTQENLASTISADINRNIEAYDL
3btaA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
3c8cA           ---------------------------------------------VSDSVDEIVDGVSKTTAEVINGRKS
2a8jB           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3e4pB           ------------------------------------------AGQSRIDASLKASLLRAVVERQRALPLV
3by9B           --------------------------------------YQALLNEHQSQLDRFSSHIVATLDKYAHIPHL
3e4oA           ---------------------------------------------LAGQSRIDASLKASLLRAVVERQRA
3by9A           -------------------------------------QYQALLNEHQSQLDRFSSHIVATLDKYAHIPHL
3by8A           ------------------------------------------------------------TRDGLANKAL
2ae8E           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SLRSVVSNLALPQLAHVDETLRRLILFDHASIARHFGSIQVFDAQGNLTIDSATLTPEKLNRGDEPFVSA
3btaA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
3c8cA           IAQYATSLIENNP----EPDNVRTIISQPLIKNTFLLVGFGLEKDGSINNDPSWNPGPTWDPRVRPWYKD
2a8jB           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3e4pB           DDAAIRGALLSPDRPSLDRINRKL---EALATSAEAAVIYLIDRSGVAVAASNWQEPTSFVGNDYAFRDY
3by9B           ISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSNWRSFIGRNFAWRPYFYL
3e4oA           LPLVLADDAAIRGALPDRPSLDRINKLEALATSAEAAVIYLIDRSGVAVAASNWTSFVGNDYAFRDYFRL
3by9A           ISKDKELVDALLSAQNSAQIDITNRYLEQVNEVIQAADTYLIDRFGNTIASSLDRSFIGRNFAWRPYFYL
3by8A           AVARTLADSPRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHP-EAQRIGQPFKGDDILKA
2ae8E           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HRDDPTVGLYISRPMQHRGTFAIVLSRRISGTDGRFLGVVAGSIRFSYFKQVFSRLRLEPDDTIGVVARD
3btaA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
3c8cA           AKNAGKLVITAPYADSASGEILVSVAPVKDSATGQFLGSIFYDVSLAELAELVNEVKLFDAGYVFIVSED
2a8jB           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3e4pB           FR-LAVRDGMAEHFAMGTVSKRPGISRRVDG-PGGPLGVIVAKLEFDG----VEADWQASGKPAYVTDRR
3by9B           SIAGQKS--QYFALGSTSGQRGYYYAYPVI-YAAEILGVIVVKDLSAIEQGWQ------NKSSYFVATDD
3e4oA           AVRDGA-EHFAG---TVSKRPGLYISRRV-DGPGGPLGVIVAKLEFDGVEA----DWQASGKPAYVTDRR
3by9A           SIAGQK--SQYFALGSTSGQRGYYYAYPVI-YAAEILGVIVVKDLSAIEQGWQ-----------------
3by8A           LNGEENVAINRGF-----LAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIN----------------
2ae8E           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GTLVMRTPFRPDVIGTNVMGAPGVRQVFSQRRGWYSGEGIIDQIPRMMVWADGTRPLVVIVGKSWSDVFR
3btaA           --------------------------------------------GVDIAYIKIPNVGQMQPVKAFKIHNK
3breA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3cawA           ----------------------------------------------------------------------
1a8rA           ----------------------------------------------------------------------
3dqqA           ----------------------------------------------------------------------
2a8mB           ----------------------------------------------------------------------
2bjnB           ----------------------------------------------------------------------
2c0jB           ----------------------------------------------------------------------
2cfhC           ----------------------------------------------------------------------
2cfhD           ----------------------------------------------------------------------
3c8cA           GTTIAHP--KKEFNGKPSEFLGESKINVDTHQVIINGK------PYAVSFSDEGEDWYVGVVIDEEIAYA
2a8jB           ----------------------------------------------------------------------
1azsA           ----------------------------------------------------------------------
2bw7B           ----------------------------------------------------------------------
1cjtA           ----------------------------------------------------------------------
2btvA           ----------------------------------------------------------------------
3e4pB           GIVLITS--LPSWRFMTTKPIAEDRLAPIRESLQFGDAPLLPLPFKIEARPDGSSTLDA-----------
3by9B           HQVVFSS--QPAWLFHSVADLSPAQLNDIRQSQQYLDSPIPSLGWQGDLQAEQSEWRKPEKHWLQDDYIV
3e4oA           GIVLITSLPSWRFTTKPIAEDRLAPIRESLQFGD------------------------------------
3by9A           ----------------------------------------------------------------------
3by8A           ----------------------------------------------------------------------
2ae8E           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MWRHEXXXXXXXXXXXXXXXXGFTVFFXXXXXXXXXXXXXXXXXXTTDSLTGLINRRKFDTLIEREWRRA
3btaA           IWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSI
3breA           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWRRS
3breB           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWRRS
3cawA           ---------------------------------------------RRDALLRKEKKHVFDGGEKIKNLSH
1a8rA           ------------------------------------------------SLSKEAALVHVARGLETPLRPP
3dqqA           ------------------------------------------------RCLSSETREAYAEALAQWVLSQ
2a8mB           -----------------------------------------------GKLSRIPPCFLVGEGAYRWAVDH
2bjnB           ---------------------------------------------------SMADEALFLLLHNEMVSGV
2c0jB           --------------------------------------------------------------------TV
2cfhC           ------------------------------------------------------DEALFL----------
2cfhD           -----------------------------------------------------------------EALFL
3c8cA           ALDE------------------------------------------------------------------
2a8jB           -------------------------------------------------LSRIPPCFLVGEGAYRWAVDH
1azsA           ---------------------------------------------------------------DMFHKIY
2bw7B           ----------------------------------------------------------------------
1cjtA           -----------------------------------------------------------------FHKIY
2btvA           --------------------------------------------------ACSEPIYRIYNRLQGYIEAV
3e4pB           ----------------------------------------------------------------------
3by9B           SSRP------------------------------------------------------------------
3e4oA           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3by8A           ----------------------------------------------------------------------
2ae8E           -----------------------------------------------NHLTLFTFHSGLSLNIEAQDDHH


                         .         .         .         .         *         .         .:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
3btaA           VRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELN--LVIIGPSADIIQFECKSFGHEVLNLTRNG
3breA           LREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3breB           LREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3cawA           FQDLKPGFLDGLKNEGYNTVKVKMGRDEADMLTHIAASGMRMRL-DFNALGSWQTFEKFMVNLPLTVRPL
1a8rA           VHEMDNETRKSLIAGHMTEIMQLLNLDLADDSLMETPHRIAKMY-VDEIFSGLDYANFPKITLIENKMKV
3dqqA           DSELAPMISATASTQALAAIQQQYGATEASHAVEALFSLLAARAEGGITRFIVAGGETSGVVTQSLGITG
2a8mB           GIPSCSVGAVVVDHENVAAAVSSGGLALKHPGRVGQAALYGAHNPYSTAVSTSGCGEHLVRTILARECSH
2bjnB           YK---SAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFK-DELDIMKFICKDFWTTVFKKIDNLR
2c0jB           LFEFLHTEMVAELWKMSLSVLEGMGFRVGQALGERLPRET-LAFREELDVLKFLCKDLWVAVFQKQMDSL
2cfhC           LLHNEMVSGVYKSAEQGEVENGRMGFRVGQGLIERFTKDTARFK-DELDIMKFICKDFWTTVFKKIDNLR
2cfhD           LLHNEMVSGVYKSAEQGEVENGNMGFRVGQGLIERFTKDTARFK-DELDIMKFICKDFWTTVFKKIDNLR
3c8cA           ----------------------------------------------------------------------
2a8jB           GIPSCTVGAV----VVDHEGNVAAAVSSGGLALKHPGRVGQAALPYSTAVSTSGCGEHLVRTILARECSH
1azsA           IQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARA
2bw7B           -PEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMS
1cjtA           IQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARA
2btvA           QLQELRNSIGWLERLGQTYSQEVLTDFRRQDMIWVLALQLPVNPQ-VVWDVPRSSIANLIMNIATCLPTG
3e4pB           ----------------------------------------------------------------------
3by9B           ----------------------------------------------------------------------
3e4oA           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3by8A           ----------------------------------------------------------------------
2ae8E           VTEDIGIVI----GQLLLEIKD------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEXXXXXXXXXXXXGRNCCVVAAxxxxx
3btaA           YGSTQYIRFSPDFTFGFLEVDTNPLLGAGKFATDPAVTL-------------------------------
3breA           ARLLAEKVRRTVEDQPRPGSHLTVSIGVSTLVGGGGQTFRVLIEMADQALYQAKNNGRNQVGLM------
3breB           ARLLAEKVRRTVEDQPRPGSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRNQVGLM------
3cawA           IEYVEDPFPFDFHAWGEWGKIASAPFDVIVIKPA------------------------------------
1a8rA           DEMVTVRDITLTSTCESHFVTIDGKATVA-----------------------------------------
3dqqA           FHIGPCISPGVPWVNALHAPSLALKSGNF-----------------------------------------
2a8mB           ALQAEDAHQALLEPFLASEDGVLGGVIVLRSCRCQTLLVEFLWSHTTESMCVGYMSAQDGKAKTH-----
2bjnB           TNHQGIYVLQDNKFRLLTHASKYLAFTCLIRGGLSNLGIKSIVT--------------------------
2c0jB           TYVLQDNSFPLLLYLEEAPKFLAFTCGLLRGAL-------------------------------------
2cfhC           TNHQGIYVLQDNKYLEHASKYLAFTCGLIRGGLSNLGI--------------------------------
2cfhD           TNHQGIYVLQDNKYLEHASKYLAFTCGLIRGGL-------------------------------------
3c8cA           ----------------------------------------------------------------------
2a8jB           ALQAEDAHQALLEFLASEDGVLGGVIVLRSC-RCQTLLVEFLWSHTTESMCVGYMSAQDGKAKTH-----
1azsA           DHAHCCVEMGMDMIEAISLVRVGIHSGRV-HCGVLGLRKWQFDVWSNDVTLANHMEAGGKA---------
2bw7B           PSEQVRRAIATARQMLVALEKLNQGWQERGLVGRPPVRFRCGIHQGMAVVGLFGSQERSDFTA-------
1cjtA           DHAHCCVEMGMDMIE-------------------------------------------------------
2btvA           EYIAPNPRISSITLT------QRITTTGP-FAILTGSTPTAQQ---------------------------
3e4pB           ----------------------------------------------------------------------
3by9B           ----------------------------------------------------------------------
3e4oA           ----------------------------------------------------------------------
3by9A           ----------------------------------------------------------------------
3by8A           ----------------------------------------------------------------------
2ae8E           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
3btaA           ----
3breA           ----
3breB           ----
3cawA           ----
1a8rA           ----
3dqqA           ----
2a8mB           ----
2bjnB           ----
2c0jB           ----
2cfhC           ----
2cfhD           ----
3c8cA           ----
2a8jB           ----
1azsA           ----
2bw7B           ----
1cjtA           ----
2btvA           ----
3e4pB           ----
3by9B           ----
3e4oA           ----
3by9A           ----
3by8A           ----
2ae8E           ----