[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38119.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhiA.bssp"
#ERROR : Can't open dsspfile "3dhgA.bssp"
#ERROR : Can't open dsspfile "3dhgD.bssp"
#ERROR : Can't open dsspfile "3chhB.bssp"
#ERROR : Can't open dsspfile "3dhhB.bssp"
#ERROR : Can't open dsspfile "3dhiB.bssp"
#ERROR : Can't open dsspfile "3dhgB.bssp"
#ERROR : Can't open dsspfile "2bq1I.bssp"

## Summary of PDB Search
:496
    6e-25  14%  3dhiA  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
    2e-22  13%  3dhgA  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
    1e-15  12%  3dhgD  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE ALPHA
    3e-15  11%  3chhB  [x.x.x] P-AMINOBENZOATE N-OXYGENASE
    8e-13  10%  3dhhB  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
    2e-12  10%  3dhiB  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
    3e-08  10%  3dhgB  [x.x.x] TOLUENE 4-MONOOXYGENASE HYDROXYLASE BETA SUBUNIT
    2e-04  12%  2bq1I  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 2 BETA
:496

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDLASDRQVLKALEGWHPGYIDWWNDMGPEGFQQSLVYLR
3dhiA           ------------------------------MHPRKDWYELTRATNWTPSYVTE-----EQLFPERMSGHM
3dhgA           ------------------------------MHPRKDWYELTRATNWTPSYVTE-----EQLFPE---RMS
3dhgD           -------------------------------------------------WTPSYVTE-EQLFPERMSGHM
3chhB           ----------------------------------------------------------------RAWPRR
3dhhB           ---------------------------------------------WELSPDSPMNLWYKQY-RNASPLKH
3dhiB           --------------------------------------------PWELSPDSPMNLWYKQYRNASPLKHD
3dhgB           ---------------------------------------------WELSPDSPMNLWYKQYRNASPLKHD
2bq1I           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEP
3dhiA           GIPLEKWESYDEPYKTSYPEY---VSIQREKDAGAYSKAALERAKIYENSDPGWISTLKSHYGAIAVGEY
3dhgA           GHMGIPLEKWESY---DEPYKTSYVSIQREKDAGAYSKAALERAKIYENSDPGWISTLKSHYGAIAVGEY
3dhgD           GIPLEKWESYDEPYKTSYPEY---VSIQREKDAGAYSVKAALEAKIYENSDPGWISTLKSHYGAIAVGEY
3chhB           AAVVNKADILDEWADYDTLVPDY----PLEIVPFAEHPLFLAAEPHQRQRVLTGMWIGYNERVIATEQLI
3dhhB           D----NWDAFTDPDQLVYRTYNL--MQDGQESYVQSLFDQFNEREHDQMVREGWEHTMARCYSPLRYLFH
3dhiB           -----NWDAFTDPDQLVYRTYNL--MQDGQESYVQSLFDQFNEREHDQMVREGWEHTMARCYSPLRYLFH
3dhgB           -----NWDAFTDPDQLVYRTYNL--MQDGQESYVQSLFDQFNEREHDQMVREGWEHTMARCYSPLRYLFH
2bq1I           --------------------------------------------PAWQTLSAAEQQLTIRVFTGLTLLDT


                         +         .         .         .         .         *         .:210
query           ASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLG
3dhiA           AAVTGEGRMARFSKAP-GNRNMATFGMDELRHGQLQLFFPHEYCKKDRQFDWAWRAYHSNEWAAIAKHFF
3dhgA           AAVTGEGRMARFSKAP-GNRNMATFGMDELRHGQLQLFFPHEYCKKDRQFDWAWRAYHSNEWAAIAHFFD
3dhgD           AAVTGEGRMARFSKAP-GNRNMATFGMDELRHGQLQLFFP-HEYCKKDRQFDWAWRAYHSNEWAAIAAKH
3chhB           AEPAFDLVMHGVFPGSDDRKSVQQAIVDESFHTYMHMLAIDRTRELRKISERPPQPELVTYRRLRRVLAD
3dhhB           CLQMSSAYVQQMAPAS-TISNCCILQTDSLRWLTHTAYRTHELSLTYPDAGLGEHEREWEKEPGWQGLRE
3dhiB           CLQMSSAYVQQMAPASTISNCCILQTADSLRWLTHTAYRT-HELSLTYPDAGLGEHERELWEKEWQGLRE
3dhgB           CLQMSSAYVQQMAPAS-TISNCCILQTDSLRWLTHTAYRTHELSLTPDAGLGEHERELWEKEPGWQGLRE
2bq1I           IQNIAGPSLMADAITPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKEVDAAYAWSEENPPLQRKAQIIL


                         .         .         .         +         .         .         .:280
query           AFNEATPDWLSFFMFTYFTDRDGKMQLHSLAQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEA
3dhiA           DDIITGRDAISVAIMLTFSFETGFTNMQFLAEAGDYTFANLISSIQTDESRHA-----------------
3dhgA           DIITGRDAISVAIMLTFSFETGFTNMQFDAAEAGDYTFANLISSIQTDESRHA-----------------
3dhgD           FFDDIGRDAISVAIMLTFSFETGFTNMQFLAEAGDYTFANLISSIQTDESRHAQ----------------
3chhB           MPEQWERDIAVLVWGAVAETCINALLALLARDATIQPHSLITTLHLRDETAHGSIVVEVVRELYARMNEQ
3dhhB           LMEKQLTAFDWGLVVKPMIVESIFKPLQQQAWENNDTLPLLIDSQLKDAERHSRWSKALVKHALEN----
3dhiB           LMEKQLTAFDWGLVVKPMIVESIFKPLQQQAWENNDTLPLLIDSQLKDAERHSRWSKALVKHALEN----
3dhgB           LMEKQLTAFDWGLVVKPMIVESIFKPLQQQAWENNDTLLPLLDSQLKDAERHSRWSKALVKHALEN----
2bq1I           AHYVSDEPLKKKFLESFLFYS-GFWLPMYFSSRGKLTNTADIRLIIRDEAVHGYYIGYKYQIALQKLSAI


                         .         *         .         .         .         .         +:350
query           MRDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhiA           ----------------------------------------------------------------------
3dhgA           ----------------------------------------------------------------------
3dhgD           ----------------------------------------------------------------------
3chhB           QRRA------------------------------------------------------------------
3dhhB           ----------------------------------------------------------------------
3dhiB           ----------------------------------------------------------------------
3dhgB           ----------------------------------------------------------------------
2bq1I           EREE------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhiA           ----------------------------------------------------------------------
3dhgA           ----------------------------------------------------------------------
3dhgD           ----------------------------------------------------------------------
3chhB           ----------------------------------------------------------------------
3dhhB           ----------------------------------------------------------------------
3dhiB           ----------------------------------------------------------------------
3dhgB           ----------------------------------------------------------------------
2bq1I           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhiA           ----------------------------------------------------------------------
3dhgA           ----------------------------------------------------------------------
3dhgD           ----------------------------------------------------------------------
3chhB           ----------------------------------------------------------------------
3dhhB           ----------------------------------------------------------------------
3dhiB           ----------------------------------------------------------------------
3dhgB           ----------------------------------------------------------------------
2bq1I           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxx
3dhiA           ------
3dhgA           ------
3dhgD           ------
3chhB           ------
3dhhB           ------
3dhiB           ------
3dhgB           ------
2bq1I           ------