[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38168.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a1uB.bssp"
#ERROR : Can't open dsspfile "1efvB.bssp"
#ERROR : Can't open dsspfile "1efpB.bssp"
#ERROR : Can't open dsspfile "3cluC.bssp"
#ERROR : Can't open dsspfile "3cltC.bssp"
#ERROR : Can't open dsspfile "3clrC.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "2e77B.bssp"
#ERROR : Can't open dsspfile "2e77C.bssp"
#ERROR : Can't open dsspfile "2du2A.bssp"
#ERROR : Can't open dsspfile "1do8A.bssp"
#ERROR : Can't open dsspfile "3clrD.bssp"
#ERROR : Can't open dsspfile "2cc2A.bssp"
#ERROR : Can't open dsspfile "1al8A.bssp"
#ERROR : Can't open dsspfile "2e77A.bssp"
#ERROR : Can't open dsspfile "1d7kA.bssp"
#ERROR : Can't open dsspfile "3btnB.bssp"
#ERROR : Can't open dsspfile "1d7kB.bssp"
#ERROR : Can't open dsspfile "3cobC.bssp"

## Summary of PDB Search
:249
    7e-66  57%  2a1uB  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    2e-64  58%  1efvB  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN
    3e-62  74%  1efpB  [c.26.2] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    2e-56  31%  3cluC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    1e-55  31%  3cltC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    1e-55  31%  3clrC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    2e-42  58%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    2e-17  13%  2e77B  [x.x.x] LACTATE OXIDASE
    3e-17  13%  2e77C  [x.x.x] LACTATE OXIDASE
    2e-16  13%  2du2A  [x.x.x] LACTATE OXIDASE
    6e-15   8%  1do8A  [c.58.1 - c.2.1] MALIC ENZYME
    1e-11  17%  3clrD  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT ALPHA
    1e-10  10%  2cc2A  [x.x.x] 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
    7e-10  17%  1al8A  [x.x.x] GLYCOLATE OXIDASE
    2e-06  15%  2e77A  [x.x.x] LACTATE OXIDASE
    2e-05  15%  1d7kA  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    9e-05  19%  3btnB  [x.x.x] ANTIZYME INHIBITOR 1
    3e-04  14%  1d7kB  [b.49.2 - c.1.6] HUMAN ORNITHINE DECARBOXYLASE
    8e-04  19%  3cobC  [x.x.x] KINESIN HEAVY CHAIN-LIKE PROTEIN
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
2a1uB           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQE
1efvB           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQE
1efpB           MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAE
3cluC           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTVEVVVVSVGPDRVDE
3cltC           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTVEVVVVSVGPDRVDE
3clrC           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTVEVVVVSVGPDRVDE
2a1tS           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQE
2e77B           SGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGE
2e77C           SGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGE
2du2A           SGLPVFVKGIQHPEDADMAIKRGASGIWVSNHGARQLYEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGE
1do8A           ----------------------------------------------------------------------
3clrD           ----------------------------EHRRNDLRPVSLELIGAANGLKK--SGEDKVVVAVIGSQADA
2cc2A           ----------------------------------------------------------------------
1al8A           ------VKGVITAEDARLAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGT
2e77A           -GLPVFVKGIQHPEDADMAKRGASGIWVSNHGARQL-YEAPGSFDTLPAIAERVNKRVPIVFDSGVRRGE
1d7kA           ------WLKALPRVTPFYAVCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQ
3btnB           ------------------VKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIFTSPCKQVSQ
1d7kB           --------RVTPFYAV--CNDSKAIVKT--LAATGTGFDCASKTEIQLVQSLGVPPERIIY-ANPCKQVS
3cobC           -------------------------------GNQHIPYRNHKLTMLMSLGGNAKTLMFVNISPAESNLDE


                         .         .         *         .         .         .         .:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
2a1uB           TIRTALAMGADRGIHVEVPPRLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
1efvB           TIRTALAMGADRGIHVEVPERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
1efpB           TLRTALAMGADRAILVVAADDIEPLAVAKILAAVARAEGTELIIAGKQAIDNDMNATGQMLAAILGWAQA
3cluC           SLRKCLAKGADRAVRVDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
3cltC           SLRKCLAKGADRAVRVDAAEGSDAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
3clrC           SLRKCLAKGADRAVRVWDDAAEGAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
2a1tS           TIRTALAMGADRGIHVAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
2e77B           HVAKALASGADVVALLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY---
2e77C           HVAKALASGADVVALLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY---
2du2A           HVAKALASGADVVALLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY---
1do8A           --------------------------ALAVILCNTRHISDSVFLEAAKALTSQ--LTDEELAQGRLYPPL
3clrD           FVPALSVNGVDELVVVKSSIDFDPDVFEASVSALIAAHNPSVVLLPHSVDSLG---YASSLASKTGYGFA
2cc2A           -----RAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVSPKVIPEQPEPTFYSRE---MVAIPSAHLAAGFP
1al8A           DVFKALALGAAGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKE---ISRSHIAADW-----
2e77A           HVAKALASGADVVAVLFGLALGGWQGAYSVLDYFQKDLTRVMQLTGSQNVEDLKGLDLFDNPYGYEY---
1d7kA           -----IKYAANNGVQM---MTFDSEVELMKVARAHPKAKLVLRIADSKAVCRLSVKFGATLRTSRLLLER
3btnB           -----IKYAAKVGVNI---MTCDNE---IELKKIARNHPNAKVLL---HIATEDMKFGTTLKNCRHLLEC
1d7kB           QIKYAANNGVQ-------MMTFDSEVELMKVARAHPKAKLVLRIATDDSKCRLSVKFGATLRTSRLLLER
3cobC           THNS-LTYASRRSIVNDPSKNVSSKEVARLKKLVSEELE-------------------------------


                         +         .         .         .         .         *         .:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTADQYGVD
2a1uB           TFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVD
1efvB           TFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVD
1efpB           TFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVD
3cluC           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASKP-IEEVSLADIGLSANDV--GA
3cltC           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASTKPIEEVSLADIGLSANDVGAAQ
3clrC           AVVADLQYKDNKAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASTKPIEEVSLADI-GLSANDVGAA
2a1tS           TFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVD
2e77B           ----------------------------------------------------------------------
2e77C           ----------------------------------------------------------------------
2du2A           ----------------------------------------------------------------------
1do8A           ANIQEVSINIAIKVTEYLYANKAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEW---------------
3clrD           TDVYIVEYQGDELVATRGGYNQKVNVEVDFPGKSTVVLTIRPSVFKPLEGAGSPVVSNVDAPSVQ-----
2cc2A           LSEVGRPLEDHEIRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTD-LEKAGIGYGARLRLTLDGVLPFE
1al8A           ----------------------------------------------------------------------
2e77A           ----------------------------------------------------------------------
1d7kA           AKELNIDVVGVSFHV-------------------------------------------------------
3btnB           AKELDVQIIG------------------------------------------------------------
1d7kB           AKELNIDVVGVSFHVGSGCTD-------------------------------------------------
3cobC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LAPRLEVLKTVEPSGRKAGVKVKDVAELVSKLKNEAGVI
2a1uB           LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI-
1efvB           LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI-
1efpB           VAPRLEVVSVREPEGRKAGIKVGSVDELVGKL-------
3cluC           AQSMSRVRRMYIPEKGRATMIEGTISEQAAKIIQI----
3cltC           S--MSRVRRMYIPEKGRATMIEGTAAKIIQIINEFKG--
3clrC           QSMS-RVRRMYIPEKGRATMIEGTISEQAAKI-------
2a1tS           LTSKLSVISVEDP---------PTTEDLVAKLK------
2e77B           ---------------------------------------
2e77C           ---------------------------------------
2du2A           ---------------------------------------
1do8A           ---------------------------------------
3clrD           ---------------------------------------
2cc2A           APLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPY
1al8A           ---------------------------------------
2e77A           ---------------------------------------
1d7kA           ---------------------------------------
3btnB           ---------------------------------------
1d7kB           ---------------------------------------
3cobC           ---------------------------------------