[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2bsqH.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"

## Summary of PDB Search
:219
    2e-32  26%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-30   8%  2bifA  [c.37.1 - c.60.1] PROTEIN
    2e-29   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    3e-29  17%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-29  10%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-29  10%  3cmvH  [x.x.x] PROTEIN RECA
    5e-28   9%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-27   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    4e-27  12%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-26   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    2e-26  11%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    3e-26   8%  3cmvG  [x.x.x] PROTEIN RECA
    1e-25  10%  3cmvC  [x.x.x] PROTEIN RECA
    1e-25   5%  1aroP  [e.8.1] T7 RNA POLYMERASE
    2e-25  23%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-25   4%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-25  10%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-24  14%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    3e-24  15%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-24   5%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-23  10%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    1e-23  11%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    1e-23  10%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    2e-23   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-23  10%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    4e-23  12%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    5e-23   9%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    5e-23   8%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    8e-23  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-22  13%  2akaB  [x.x.x] DYNAMIN-1
    5e-22   7%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    5e-22  32%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    8e-22  11%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-21   5%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-21   8%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    5e-21  10%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-20   8%  421pA  [x.x.x] H-RAS P21 PROTEIN
    3e-20  11%  3cmvA  [x.x.x] PROTEIN RECA
    4e-20  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-20  11%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-20   8%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    7e-20  13%  2ctsA  [x.x.x] CITRATE SYNTHASE
    8e-20   9%  2axzC  [x.x.x] PRGX
    1e-19   9%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-19  10%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    2e-19  21%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-19  13%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    3e-19  25%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-19  10%  4dcgA  [x.x.x] VP39
    4e-19   9%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    8e-19  10%  2c9oC  [x.x.x] RUVB-LIKE 1
    1e-18   8%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    2e-18  11%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  12%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-18  12%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  11%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-18  11%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-18  15%  2bdtA  [x.x.x] BH3686
    3e-18  11%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-18   9%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    4e-18   7%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-18  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    6e-18  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    7e-18   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    7e-18  15%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-17   7%  2c0bL  [x.x.x] RIBONUCLEASE E
    1e-17  10%  1e0jA  [c.37.1] DNA HELICASE
    1e-17  10%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-17   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    2e-17  11%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17  11%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17   9%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-17   9%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    2e-17   5%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    2e-17   8%  1e98A  [c.37.1] THYMIDYLATE KINASE
    2e-17  11%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    2e-17  11%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-17   9%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    2e-17   9%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-17  16%  1e6cA  [c.37.1] SHIKIMATE KINASE
    3e-17  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    4e-17  25%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-17   8%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-17  11%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    4e-17  10%  1e0jB  [c.37.1] DNA HELICASE
    4e-17  11%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    5e-17   8%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    5e-17   9%  2cckA  [x.x.x] THYMIDYLATE KINASE
    6e-17   9%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    6e-17  11%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-17  11%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-17  12%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    7e-17   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    7e-17  14%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    1e-16  26%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-16  11%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    1e-16  11%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-16  11%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-16  11%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16  12%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    2e-16  11%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-16  10%  3da4A  [x.x.x] COLICIN-M
    2e-16   7%  3adkA  [x.x.x] ADENYLATE KINASE
    3e-16  10%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-16   9%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    5e-16  11%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-16  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    6e-16  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    6e-16   9%  3cmxA  [x.x.x] PROTEIN RECA
    7e-16  10%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    7e-16   9%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    7e-16  10%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    9e-16   8%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    1e-15  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-15  14%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-15   7%  2bhvA  [x.x.x] COMB10
    1e-15   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    1e-15   8%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    1e-15  14%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    2e-15  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    2e-15  10%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-15  11%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    2e-15   4%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-15  13%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    3e-15  12%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    3e-15  11%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-15  11%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15  11%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-15  12%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-15   9%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15  18%  2a1fF  [x.x.x] URIDYLATE KINASE
    5e-15   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    5e-15  10%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-15  12%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    6e-15  12%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    7e-15  18%  2d2eA  [x.x.x] SUFC PROTEIN
    8e-15   9%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    9e-15  12%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    9e-15   7%  2bhvD  [x.x.x] COMB10
    1e-14  11%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    1e-14   7%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-14  12%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-14  13%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-14   9%  3cmvE  [x.x.x] PROTEIN RECA
    2e-14   9%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-14  11%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    2e-14  12%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    2e-14  10%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-14   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-14  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-14   7%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-14  13%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-14  28%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    3e-14  10%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-14  10%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-14  11%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    5e-14  10%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    6e-14  11%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    6e-14   7%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    6e-14  12%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    8e-14  12%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    9e-14  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    1e-13  12%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    1e-13   9%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-13  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    1e-13  11%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-13  18%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-13  11%  3cmwC  [x.x.x] PROTEIN RECA
    2e-13   8%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    2e-13  23%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-13  12%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-13   3%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    2e-13  25%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-13  10%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    3e-13  12%  3c8uA  [x.x.x] FRUCTOKINASE
    3e-13  10%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-13  18%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-13   9%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-13   9%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-13  12%  1adoA  [c.1.10] ALDOLASE
    5e-13  10%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    5e-13  11%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    6e-13   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    8e-13   9%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    9e-13  10%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    9e-13   9%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    1e-12  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    2e-12  12%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-12  12%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-12  19%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  10%  3ec1A  [x.x.x] YQEH GTPASE
    3e-12  11%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-12  16%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-12   7%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    3e-12   8%  3be4A  [x.x.x] ADENYLATE KINASE
    4e-12  21%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-12  12%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-12  11%  3cmtD  [x.x.x] PROTEIN RECA
    5e-12  12%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-12  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    5e-12  11%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-12  12%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-12  12%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-12  19%  2d2fA  [x.x.x] SUFC PROTEIN
    7e-12  11%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-12   7%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    8e-12  10%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-12   3%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    9e-12   7%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-11  27%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-11  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    1e-11  10%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-11  10%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-11  14%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-11  17%  2a1fD  [x.x.x] URIDYLATE KINASE
    3e-11  14%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-11  13%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-11  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-11  11%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    4e-11   8%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    6e-11  12%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    6e-11  17%  2a1fC  [x.x.x] URIDYLATE KINASE
    6e-11  17%  2a1fE  [x.x.x] URIDYLATE KINASE
    7e-11  11%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-11  12%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-11   7%  2b8tC  [x.x.x] THYMIDINE KINASE
    9e-11  11%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-10  11%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    1e-10  11%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-10   9%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    1e-10  10%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-10  10%  2dftC  [x.x.x] SHIKIMATE KINASE
    1e-10  11%  2dftA  [x.x.x] SHIKIMATE KINASE
    1e-10   9%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-10  11%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-10  14%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-10  10%  3cmuA  [x.x.x] PROTEIN RECA
    3e-10   9%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    3e-10   8%  1e2nA  [c.37.1] THYMIDINE KINASE
    3e-10   9%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    3e-10   6%  2cckB  [x.x.x] THYMIDYLATE KINASE
    3e-10  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-10  12%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    4e-10  11%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-10   9%  3cmvB  [x.x.x] PROTEIN RECA
    4e-10  11%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-10  12%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    5e-10  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-10  15%  3cm0A  [x.x.x] ADENYLATE KINASE
    8e-10  13%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    9e-10   9%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-09   9%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-09  11%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-09  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    1e-09   8%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-09  12%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-09  14%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    2e-09   8%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-09  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-09  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    2e-09  17%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    4e-09  10%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    6e-09  10%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    7e-09  12%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    8e-09  17%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    9e-09   7%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    9e-09  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-08   5%  2c9gA  [x.x.x] PENTON PROTEIN
    1e-08  13%  3a00A  [x.x.x] GUANYLATE KINASE
    1e-08  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-08   9%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-08  13%  1e2iA  [c.37.1] THYMIDINE KINASE
    2e-08  10%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    3e-08   9%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    3e-08  13%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    3e-08   7%  2bhvC  [x.x.x] COMB10
    4e-08   8%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-08  16%  1e2iB  [c.37.1] THYMIDINE KINASE
    4e-08  12%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    5e-08   8%  3dfdA  [x.x.x] PROTEIN YQBN
    6e-08   8%  3dlbB  [x.x.x] ARGONAUTE
    6e-08  13%  3a00B  [x.x.x] GUANYLATE KINASE
    6e-08  10%  1e2hB  [c.37.1] THYMIDINE KINASE
    8e-08   9%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    9e-08   8%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    1e-07   5%  3bczC  [x.x.x] PROTEIN MEMO1
    1e-07  17%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-07  10%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    2e-07  14%  1chdA  [x.x.x] CHEB METHYLESTERASE
    3e-07  13%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    3e-07   8%  3bm2B  [x.x.x] PROTEIN YDJA
    3e-07  11%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-07  11%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-07  12%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    4e-07  10%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    4e-07   7%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    4e-07  13%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    5e-07  17%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-07   9%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    7e-07  10%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-07  12%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-07  14%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    1e-06  19%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06   9%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-06  13%  3dkvA  [x.x.x] ADENYLATE KINASE
    1e-06  36%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-06  11%  2c5mD  [x.x.x] CTP SYNTHASE
    2e-06   9%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    2e-06   7%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-06  11%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    3e-06  18%  2cdnA  [x.x.x] ADENYLATE KINASE
    4e-06   9%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    5e-06   9%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    5e-06  22%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    6e-06  11%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    6e-06  15%  1e2lB  [c.37.1] THYMIDINE KINASE
    8e-06  15%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    8e-06  12%  1e2mB  [c.37.1] THYMIDINE KINASE
    9e-06   9%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    1e-05  37%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  10%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-05   8%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    3e-05  10%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-05   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    3e-05  18%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-05   8%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    4e-05  15%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-05  13%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    6e-05  11%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    8e-05  12%  1e2lA  [c.37.1] THYMIDINE KINASE
    9e-05  10%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    1e-04  18%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-04  11%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    1e-04   9%  1eamA  [c.66.1] PROTEIN (VP39)
    3e-04  10%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-04  10%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-04  20%  2bsqH  [x.x.x] TRAFFICKING PROTEIN A
    6e-04  14%  2c95B  [x.x.x] ADENYLATE KINASE 1
    7e-04   9%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    0.001  10%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRFENVGLRYGLGPEILRDLNFAIPAHSFQFLTGPSGAGKTXXXXXXXXXXXPTRGLVNLFGNDVSLLT
3b5jA           -ITFRNIRFRYKPDPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALAD
2bifA           --------------------------------MVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQ----
2dwoA           -SRVQKIWVPVD--HRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRRE
2d3wB           MLSIKDLHVSVE-DKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLA
3dmdC           -AVKEAVSEILETSRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGF-------------
3cmvH           -DRSMDVETISTGSLSLIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
2cgtH           LDKSFGAPTITKDGVSVAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAG
2dwpA           ---------------SRVQKIWVPVDHPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRRE
2b8wA           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWM
1bifA           --------------------------------MVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQ----
3c95A           ---PENRNAVIMVDAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNL
3cmvG           EDRSMDVETISTSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
3cmvC           EDRSMDVETISTSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
1aroP           ----------------------------------------------------------------------
3b60A           DLEFRNVTFTYGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT
3eiuA           PYARLPPKDFIQTGI-STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA--AM
3dmdB           -AVKEAVSEILETSRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGF-------------
2c03B           -VILATVYEALK-EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1e69A           ----------------SFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENL---P
2c61B           PYARLPPKDFIQTGI-STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGI
2ccgA           --------------------------------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG
2czvA           ------------VGGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILL
2ccgB           --------------------------------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG
2bc9A           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWM
2ccjB           --------------------------------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG
1d1cA           GRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQ
2a2zD           --------------------------------IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
3b2qA           PYARLPPKDFIQTGI-STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFA---A
2b8tA           --------------------------------ITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRS
2akaB           ----EDLIPLVNRLQDAFSAIGQNALDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL
1e9cA           --------------------------------LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
3dhwC           MIKLSNITKVFHQGTRALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLS
2cjwB           --------------------------------LIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIIL
3eiuB           PYARLPPKDFIQTGI-STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAA--M
1e9fA           --------------------------------LEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
3dm5A           -EHIIKIVYEELTKFLTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPG
421pA           --------------------------------VVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVV
3cmvA           SMDVETISTGSL--SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
3czpB           KDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEER
1e9rA           -GKLKRMTREKA-KQVTVAGVPMPRDAEPRHLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
1e2dA           --------------------------------LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
2ctsA           ---------STNL-KDILADLIPKEQARIKTFQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEGI
2axzC           ----------------------------------------------------------------------
2b92B           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWM
3a1wA           --------------------------------LAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVF
2bbsA           EVVMENVTAFWEEGFGVLKDINFKIERGQLLAVAGSTGAGKTS-----------------LLMMIMGELE
2axpA           ----------------------------TLIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNE
2awnC           ---------QLQ-NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVF-------------
4dcgA           -ESANEVAKKLPYQGQLLGELFFKLQRHGILDTVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHD
2a5gA           --------------------------------MLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYK
2c9oC           -QAASGLVGQENACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVY---
2bhjA           -----------------------------------------------------WGSGEILHDTLHHKATS
1e9sF           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS
2d4hA           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIW--MW
1e9sG           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGD---
2awnD           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMN--D
3bb1B           -SGINTFAPATQKLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSR
1dhjA           ----------------------------------------------------------------------
2bdtA           --------------------------------ITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGY
1e9sD           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
2a30D           --------------------------------IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
3b2qB           PYARLPPKDFIQTGI-STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGI
2c03A           -VILATVYEALK-EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1dg3A           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPK---K
1cjaA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------LNYTCPTFIDKP
2c0bL           ----------------------------------------------------------------------
1e0jA           -HLSSSVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLE----
2d0kA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2c61A           PYARLPPKDFIQTGI-STIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGI
2a30B           --------------------------------IEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQ
2a5jA           --------------------------------IIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGK
1e98A           --------------------------------LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
1aldA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2a2zB           --------------------------------IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
2d4uA           --------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWLL
1e6cA           --------------------------------MVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMT
3bjdB           -----------------------------------------------------LPIEEARIVADALA---
2d62A           -VKLINIWKRFG-DVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEK
1e9dA           --------------------------------LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
3czpA           ----------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTE--E
1e0jB           LSSEESVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEE---
3cbnA           ------------------------------------------------------------VLRYTLRARG
3bpbA           ---FKHIIARTGLTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFPDSVFVEDPVLTSRCAIITR
2cckA           --------------------------------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPG-----
2d4uB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2dr3A           --------VKTG-IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ
3czjA           ----------------------------------------------------------------------
2c7cH           -------------------------------------------------------RGIDKAVTAAVEELK
2awnB           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----
1e3mA           ---------------QLYEELFDLLLPHLEALQQSASLVNLAERAYTLNYTCPTFIDKPGIRITEG----
3dftD           ----------------------------------------------------------------------
3cr7C           --------------------------------LTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
1e9sM           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
6aldA           ----------------------------------------------------------------------
3bh0A           -SADGNITGVPS-GFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLE-----
3da4A           -VLHPGISVYDAYHF----AKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLKI
3adkA           --------------------MEEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSG
3dt2A           ALRIASRLAKEEGWLALILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
3dymA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
2dr3E           ---------RVKTGPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ
3b85A           ---------------LGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAG
3cmxA           --------------------GAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
2cvfA           --------------KSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSP---
1e2fA           --------------------------------LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
3clvA           --------------------------------LLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYVV
1dkiA           LLDSKGIHYNQGNPYNLLTPVIEKVKPGEQSFVGAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNNP
2b8wB           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHT-----
2aunB           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
2c9yA           --------------------------------LLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASG
2a2zA           --------------------------------IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
2ausC           ----------------------------------------------------------------------
2b8tB           -------------------------------FITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSV
3d7wA           --YVSSGSFSNN--IPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQS------
1eilA           ----------------------------------------------------------------------
2c4rL           ----------------GGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIKK
1cr4A           LSSEESVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKST-----------------FVRQQALQWG
1bccF           ---------------------------------------------------------------------S
3dfpC           ----------------------------------------------------------------------
1e9sJ           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
3dfnC           ----------------------------------------------------------------------
2d4hB           MCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSSKGIWMWCVPHPKKPGHILVLLDTEGLG
1e9rE           -GKLKRMTREKA-KQVTVAGVPMPRDAEPHLLVNGATGTGKS------------VLLRELAYTGL-----
2a1fF           ----------------------------------------------------------------------
2eg5G           -YNQLVLAKVKPVLEQLLRANLPNINKCIKVADLGCASGPNTLLTVRDIVQSIDERPTIQIFLNDLFPND
1dhiA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
2c04A           -VILATVYEALK-EALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
2d2eA           QLEIRDLWASID-GETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILE
1bg0A           --------------------------------IYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPKQW
2aunA           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
1cfrA           --------------------------------IISKSGEGNKYTINSAIAFVAYASTEFSKVLSGLRDFI
2bkhA           -GKSLGTMPPHVFAIDKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIV---
2boeX           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3cmvE           EDRSMDVTISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
3cddF           ------------------SGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQ
3d3kA           -----------------SVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVALLCGPHVKGAQGICG
1cr2A           -SSEESVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAML-----
1e9sB           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS
1bglA           ----------------------------------------------------------------------
3cr7A           --------------------------------LTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
3dtbB           IASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
3cddD           --------LKAG-GKIYQGWTKIGITRSDLETYKFNDAQYKAFIEPIKQGQACDIGGERVITGYVDDWVP
3d31A           MIEIESLSRKWK--NFSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVT---
2drcA           ----------------------------------------------------------------------
1d6jB           ----------AS-ALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGDNIRFGL
4atjA           ----------------------------------------------------------------------
3bo6B           ---LHNQMRQMP-MSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAG--D
2akaA           GRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQ
3cioD           -TKNIPFLAVDNPADSAVHFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGY
2dr3B           ---------RVKTGPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH---
3dfnD           ----------------------------------------------------------------------
1cr1A           LSSEESVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA-------
1e59A           -----------------VTKL-VLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDF
3dt4C           ALRIASRLAKEEGWLALILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
2bwjA           ---------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLV-------EKYGFTHLSTGELL
3cr7D           --------------------------------LTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
2d3wA           MLSIKDLHVSVE-DKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLA
3cmwC           -------------------LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
3ch4B           -------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQY
2awoC           ---------QLQ-NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----
1e3aB           ----------------AKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFE
3dyoA           ----------------------------------------------------------------------
2awoA           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTP
3dauA           ----------------------------------------------------------------------
3c8uA           ---------AAL-CQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDG-----
1draA           ----------------------------------------------------------------------
2d3wD           MLSIKDLHVSVE-DKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLA
2ahvA           ----KPPRINGRVPVLSAQEAVNYIPDEATLCVLGAGGGILEATTLITALADKPTGLGDRADRGISPLAQ
3dt4A           ALRIASRLAKEEGWLALILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDA
1adoA           ----------------------------------------------------------------------
2bofX           -----------------------------------------------------PNMSSAEWVRNNPNDP-
1dekB           --------------------------------LSGVKRSGKDTTADFIMSNYSAVKYQL-----------
2ahwD           ----KPPRINGRVPVLSAQEAVNYIPDEATLCVLGAILEATTLITALADKYKQPTGLGDRADRGISPLAQ
2bkiA           -GKSLGTMPPHVFAIDKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEAN
3bgwA           ESADGNITGVPS-GFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLE-----
3dffA           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
3cnlA           KKQGKRVITTHKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDT
3dm9B           -AVKEAVSEILETSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTF---
2bbsB           ----EVVMENVT-AFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRIS----
3ec1A           ----------KGIGMAKVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPG---T
3dfqC           ----------------------------------------------------------------------
2d3wC           MLSIKDLHVSVE-DKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLLA
2a30A           --------------------------------IEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
3be4A           ------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTG--DMLREAIK
2bbtB           -ELFEKAKQNNN-NTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK----------
3dfoC           ----------------------------------------------------------------------
3cmtD           ------------------------LPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
1e4yA           --------------------------------LLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSG
1cr0A           LSSEESVGLLFS-GCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-------------
1dyhA           ----------------------------------------------------------------------
3bb1E           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
1e9rF           -GKLKRMTREKA-KQVTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
2d2fA           QLEIRDLWASID-GETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILE
4dfrA           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
1d6jA           ----------------RSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDG-----
1dp0A           ----------------------------------------------------------------------
1cjtC           --------------------------------LLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEA
1b0uA           KLHVIDLHKRYG-GHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVR
1accA           --SEVLPQIQETTAR-IIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIAFGPNGNLQYQGKDIT---
1bmfC           IIPRISVREPMQTGI-KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKL-----
1e9sH           -GKLKRMTREKA-KQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPN-----
2dflA           VKKERMNVKKISTGQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAV----
2a1fD           ----------------------------------------------------------------------
3cddC           ----------------------------------GKIYQGWTKIGITRSLEASGFQYKAFIEPIKQGQAC
5dfrA           ----------------------------------------------------------------------
1e2kA           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRV-----
2dpyB           PLQRTPIEHVLDTGV-RAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVK
1e2gA           --------------------------------LEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTE
1dw9A           ----------------------------SFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDE
2a1fC           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
3bb1F           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
3bv4A           ----------------------------------------------------------------------
2b8tC           -------------------------------FITGPMFAGKTAELIRRLHRLEYADV--KYLVFKPKIDS
3dt7A           ALRIASRLAKEEGWLALILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWM----
2dr3C           ---------RVKTGIGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ
1ai4B           ---------------------TINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPNW
2bv7A           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
2dftC           -------------------------------VLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRS
2dftA           --------------------------------LVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRS
3di4A           ---------TGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNLHN-----LHDLTERFFSGKTRALH
2czvB           -------GVKFIEMDIRDKEYELAKWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSL---V
3bb1A           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
3cmuA           ----ETISTGS---LSLDILGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHA---
3cueF           --------------------------------LIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGK
1e2nA           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYV-PEPMTYWRV
2bjbA           -LQTLGLRVDGVGSELTVSGRIEPGP--GARVDCGLAG----TVLRFVPPLAALGSVPVTFDGDQARGRP
2cckB           --------------------------------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTG
1e9rD           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLS
3d3qB           --------------------------------IVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGT
3bgwD           -------------GFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLE-----
3cmvB           EDRSMDVETISTGSLSDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAE-----
3d3qA           --------------------------------IVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGT
3d1mB           ----------------------------------------------------------------------
3bb1C           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVS
3cm0A           --------------------------------FLGPPGAGKGTQASRLAQELGFKKLSTGDILRDH----
1d8jA           ----------------------------------------------------------------------
1afrA           -------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGFD
1e9rG           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
2dpyA           ---LQRTPIEHVLDTGVAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVK
2dr3F           ---------RVKTGPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMG--------------
1e9sE           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGD---
3d1mA           ----------------------------------------------------------------------
3dvlD           --------------EGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFE--ET
1e9sL           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
3bk7A           ----------------------------------------------------------------------
2ccjA           --------------------------------FEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGG----
2e85B           ----------------------------------------------------------------------
3cr7B           --------------------------------LTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRF
2ck3C           IIPRISVREPMQTGI-KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYV
2a5vA           ---VRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV-----------
3c85A           -----------------------------------------------------PGHAQVLILGGRIGTGA
1cs4C           --------------------------------LLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEA
2awnA           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRM----
2c9gA           VMVSRSLTKDKQ-VELKYEWVEFTLPEGNYSETMTIDLMNN-----------------------------
3a00A           --------------------------------ISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAG
1ak2A           -------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASG
1av6A           -PESANEVAKKLPYQGQLKLLKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHD
1e2iA           ------------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTT
1c9kC           --------------------------------VTGGARSGKSRHAEALIGDAPQVLYIATSQILHHK---
1dekA           --------------------------------LSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYA
3ed8A           -IELKGTDFKED--GNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNTP
2bhvC           ----------------------------------------------------------------------
1culC           --------------------------ATHRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEA
1e2iB           ------------------------MPTLLRVYIDGPHGMGKTTTT----------QLLVALGSRDDIVYV
3crmA           --------------------------------LMGPTAAGKTDLAMALADALPCELISVDSALIYR---G
3dfdA           -IDAEEVEVPISKRFVEGNVVPFIFKAITTDRELEKENTTKELDSQ-------RFYARIAVETTVYPTFK
3dlbB           ------------------------VEGLAVYRREHARGPGWRVL---------GGAVLDLWVSDSGAFLL
3a00B           --------------------------------ISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAG
1e2hB           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYETIA
3bwdD           --------------------------------TVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGED
1d2zD           FPAEIKKGFKYTAQDVQIDEAANRLPPDQSKSQTSGKLNERPTVGVLLQLLVQAELADFVALDFLNESTP
3bczC           -----------------SHAGSWYTAS-----GPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTY---C
2e85A           ----------------------------------------------------------------------
2dr3D           --------VKTG-IPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVA-------
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e2nB           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPVLGASETIA
3bb1H           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRP---V
2a5vB           -----TAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV-----------
1ek0A           --------------------------------LLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRV
1ckvA           -----MGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGKI
2bkeA           VKKERNVKKIST-GSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGK------
3bb1G           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGKS----------------------------
3cnnA           ----------------KVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTP
1e9sA           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDP-----N
1e9sI           -GKLKRMTREKA-KQVTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
3bjqB           ----------------------------------------------------------------------
2bbtA           -EGFGELFEKAK-GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHS--------
1e1qB           -IPRISVREPMQTGI-KAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYV
3dkvA           -------------------------------VLMGLPGAGKGTQAERIVEKYGIPHISTG----DMFRAA
2awoD           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGK-----------------------------
2c5mD           ----------------------------------------------------------------------
2d7vA           VAALSSCHLVFL-SIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH-
1akeA           --------------------------------LLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSG
2b0lC           ----------------------------------------------------------------------
2cdnA           --------------------------------LLGPPGAGKGTQAVKLAEKLGIPQIST----GELFRRN
2d7vB           -AALSSCHLVFL-SIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKH-
1azsC           ------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN----
2cbzA           -ITVRNATFTWARSDPTLNGITFSIPEGALVAVVGQVGCGK-----------------------------
2axnA           -SRVQKIWVPVD--HRPSLPRSCGPNSPTVIVMVGLPARGK-----------------------------
1e2lB           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY-----VPEPMT
3b9qA           IKDALKESVLEMLAK-SKTELQLGFRKPAVIMIVGVNGGGK-----------------------------
1e2mB           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVT
3c7kA           --------------------------------LLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQ
2bboA           EVVMENVTAFWEEGLGVLKDINFKIERGQLLAVAGSTGAGK-----------------------------
1dvrA           --------------------------------LIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQ----
3bs4A           --------------EELDREIGKIKKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPL--
2ancF           -------------------------------IVSAPSGAGKSSLIQALLKTQPLYDTQEAILATGVDVFL
3brwA           -LECNPTARIYRKGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTY--------------
3dmdA           -AVKEAVSEILETSRIDLIEEIRKAEKPYVIMFVGFNGSGK-----------------------------
3c15C           --------------------------------LLGAGESGKSTIVKQMRILHVNGEKATKVQDIK-----
3e70C           -VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGK-----------------------------
3do6A           -LYPYGHYIAKI-DHRFLKSLENHEDGKLILVTPTPAGEGKTTTSIGLSSLNRIGKK-------------
3cphA           --------------------------------LIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTV
1e2lA           ------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIA
3cqcA           LKQGNAIMRKFLASKKAAKEVFVKIPQDSIAEIYLPAEDDN-----------------------------
3bb1D           -SGINTFAPATQTKLELLGNLKQEDVNSLTILVMGKGGVGK-----------------------------
1d6aA           VKSRSQVQLGIQILDSNIGKIMSFTEKTEAEFLLVAIQMVSE-AARFKYIENQVKTNFNRAFNPNPKVLN
1eamA           ---EPAKKLPYGQLKLLLGELFFLRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHD
3c14C           --------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKE
1e9rB           -GKLKRMTREKA-KQVTVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNG----
2bsqH           ----------------------------------------------------------------------
2c95B           -------------------------------FVVGGPGSGKG----TQCEKIVQKYGYTHLSTGDLLRSE
1cjuC           --------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKN----
3ci2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDEVSALRQRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLKWVGLGERMDALPPVLSG
3b5jA           PNW---LRRQVGVVLQDNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSG
2bifA           ---------------YRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATN
2dwoA           AVK----QYSSYNFFRPDNEEAMKVRKQCALAALR---------------DVKSYLAKEGGQIAVFDATN
2d3wB           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMPEDLLTRSVNVGFSG
3dmdC           -------SVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAG
3cmvH           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIAALTPKAEIEGEIGDSHMGLAARMM
2cgtH           MNPMDLKDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSP
2dwpA           AVK----QYSSYNFFRPDNEEAMKVRKQCALAALR---------------DVKSYLAKEGGQIAVFDATN
2b8wA           WCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTIELTHRIRSKSVSFFPD
1bifA           ---------------YRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATN
3c95A           KILRENPQVRDAQLYNGFFSDADRAAMKIVLETEPRNLPA--LDITFVDKRIEKLLFNYRARNFPGTLDY
3cmvG           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDAL-------ARSGAVDVIALTPKAEIEGLAARMMSQ
3cmvC           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDAL-------ARSGAVDVIALTPKAEIEGLAARMMSQ
1aroP           ------------------------NDFSDIELAAI--PFNTLADHYGERLAREQLALEESYEMGEARFRK
3b60A           LASLRNQVALVSQNVHLFNDTNNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVLLSG
3eiuA           GITNEEAQYFMSDFEKTGALERAVVFLNLAHVLVILTDITNYAEALRQMGPGYMYTDLATLYERAGIVKG
3dmdB           -------SVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAG
2c03B           ARE---QLRLLGEKVGVPVL-----------------EVMDGESPESIRRRVEEKARLEARDLILVDTAG
1e69A           PAGSAYVELVFEENGEEITVQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSG
2c61B           TNEEA--QYFMSDFEKTGALERAVVFLNLADDPAVERIVTYAEALRQMGYPGYMYTDLATLYERAGIVKG
2ccgA           EEI----RKIVLEGNDMDIRTEAMLFAASRREHLVLK-------VIPALKEGKVVLCDRYIDSSLAYQGY
2czvA           SNPVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNP
2ccgB           EEI-----------RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGY
2bc9A           WCVP---HPKKPGHILVLLDTEGL--------------GDVEKGDNQNDSWIFALAVLLSSTFVYNSIGT
2ccjB           EEI-----RKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCD------RYIDSSLAYQGY
1d1cA           ANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSRVVFQSET-ERNYHIFYQLLA
2a2zD           TNVLQMMYERWSFTFQTYACLSRIRAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
3b2qA           MGITNEEAQYFMSDFEKTGALERAVVFLNLADPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNYA
2b8tA           IRN---IQSRTGTSLPSVEVESAPEILNYIMSEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
2akaB           VNSTT--EYAEFLHCKGKKFTDFEEVRLEINKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPD
1e9cA           ------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENF
3dhwC           ESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSG
2cjwB           LDM---WENHDHMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSE
3eiuB           GITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVEALRQMGAAGYPGYMYTDLATLYERAGIVKG
1e9fA           I------GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
3dm5A           AYH---QLRQLLDRYHIEVFGNPQEKD-----------------AIKLAKEGVDYFKSKGVDIIIVDTAG
421pA           IDGETCLLTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCD
3cmvA           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAV----DVIVVDSVAALTPKAEIGLAARMM
3czpB           AQPYLWRFWRHIPAFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDK
1e9rA           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
1e2dA           IG-----KLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFS
2ctsA           RFRGYSIP-ECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRSHVVTMLDNFPTNLHP
2axzC           ---RLTSLQYFSIYLGYISI--AHHYNIEVPTFNKTITSDLKHLYDKRTTFIDYEIVSNLLNVLPYEEVS
2b92B           WCVPHPKKPGHILVLLDKGDNQNDSWIFAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSFVS
3a1wA           TYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAM
2bbsA           PSEGKIKHSGRISF-CSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSG
2axpA           KLFEHFNLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLKRLRVRGDEYIEG
2awnC           ---------------QSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
4dcgA           PILNGLRDVTRFVDEEYLRSIKKQLHPSKILLSNYALQNVMISILNPVASSLKWRCPFPAQWIKDFYIPH
2a5gA           NVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELNDREMRDAIILIFANKQDLPDA
2c9oC           STEIKKTEVLMENFRRAIGLRIKETKKKEIIQDVDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHML
2bhjA           CLGSIMNPKSLTRGPRDKPTPLEELLPHAIEFINQYKEAKIEEHLARLEAVTKEIETTGTYQLTLDELIF
1e9sF           KF-----GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA-------------------LSVVPRGKTD
2d4hA           CVPHPKKPGHILVLLDTEGLGDVENQNDSWVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPD
1e9sG           --MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQR-------------------YALSVVPRGKTD
2awnD           TPPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3bb1B           SRAGFTLNIIDTPGLIEGGYNDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
1dhjA           ---------------------------ISLIAALAVDRVIG--MENAMPWNLPASLAWFKRNTLDKPVIM
2bdtA           RPPWESDEKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDAL
1e9sD           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT-------------------D
2a30D           TNVLQMMYERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
3b2qB           TNEE---AQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMQMGRGYPGYMYTDLATLYERAGIVKG
2c03A           ARE---QLRLLGEKVGVPVL-----------------EVMDGESPESIRRRVEEKARLEARDLILVDTAG
1dg3A           PGHILVLLDTEGLGDVEKGDNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTHRIRSKSDSADFVS
1cjaA           ------EGNLDNIMLSERGATVVPIDSKIIPLDASHPHGERVRELLRTLIAHPGHESSQFH-SIRDIITL
1e3mB           GIRITEGRHPVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVIFTRVG
2c0bL           --------RPAPFLIHQESNVIVRAFRDYLRQDILIDNPKVLELARQHIAALGRPDFSSKIKLYTGEIPL
1e0jA           -ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGN---DTFHLYDSFAEAETDRLLAKL
2d0kA           -------------------ISLIAALAVDRVIG----------NENALPWNLPADLAWFKRNTLNKPVIY
2bx2L           -------ESRPAPFLIHQESNVIVRAFRDYLRQDIEILIDNPKVLELARQHIAALGFSSKIKLYTGEIPL
3dfoD           -------------------------------------------------------------------TPE
3dfpD           -------------------------------------------------------------------TPE
2c61A           TNE---EAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTAAEYLAYEHGMHVLVILTDITNY
2a30B           MMYEK--PERWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSYIFASNLYESECMNETEWTIYQD
2a5jA           QIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDL
1e98A           ------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
1aldA           -------------------------------------------------------------------TPE
3dfqD           -------------------------------------------------------------------TPE
2a2zB           TNVLQMKPERWSFTFQTYACLSRIRAQLASLNGEKVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
2d4uA           QTRNTLNRAGIRYMMDQNNIGSGSTVAELMESSLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHN
1e6cA           VADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPASLQAHQRPTL
3bjdB           ---VHATSRQIDSAASKLAALAAYAAYQQLLYVLSLSDDVA---TAQTRRWLARAIYRVEERFPAADLSR
2d62A           GVFVP--PKERDVAVFQSYALYPHTVYDNIAFPLKLR-KVPKQEIDKRVREVAELGLTELLNRKPRELSG
1e9dA           ------IGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENF
3czpA           ERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEEQLSEYGIIVVKFWLAIDK
1e0jB           -----SVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKL
3cbnA           HPNVTAGHRTTFEVTVDP----EIGETADCIIGVSSSDEKRAIARESLVRVILRTENGEIRGYGHPELTL
3bpbA           PGAESRRGETEIIEETVQRFYPGKVERIEAPGTVEAG-------DIMMVGDHFYIGESARTNAEGARQMI
2cckA           ------------GVPTGEEIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLA
2d4uB           ---NTLNRAGIRYMMDQNNIGSGSTVAELMESSLKQAEKNWADYEALPRDPRQSTAAAAEIKRNYDIYHN
3dfqA           -------------------------------------------------------------------TPE
3dftC           -------------------------------------------------------------------TPE
2dr3A           VRQ---NMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYE---------------------KYIVHDLTDI
3czjA           ---------------TTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGE
2c7cH           ALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSP
2awnB           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
1e3mA           RHPVVEQVLNEPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRV
3dftD           -------------------------------------------------------------------TPE
3cr7C           GLNKDLGFSEDRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFPKGLYKKAREG
1e9sM           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
6aldA           ---------------------------------------------------------------HPALTPE
3bh0A           ---MGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTR
3da4A           SPMKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLTNASTHRGIIGESLTRLGAMFSG
3adkA           SAR--GKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEFERKIGQPTLLLYV
3dt2A           QGN----LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGPLAPGVTITSWKN
3dymA           ----------------------CIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGV
3dfnA           -------------------------------------------------------------------TPE
2dr3E           VRQN---MAQFGWDVKPYEEKGMFAMV---------------------DAFTAGIGKEYEKYIVHDLTDI
3b85A           EKLGFLPGDPYLRPLHDALRDVEPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTRL
3cmxA           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDALARAEARMMSQAMRKLAGNLKQSNTLLIFINQIRN
2cvfA           --ERLVQMAETRGLNPEEALSRFILFTPSDFKEVIGSLKKTVDSNFALVVVDSITAHYRAEENRVLLWIA
1e2fA           IG------KLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
3clvA           NENLCNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWNQLKISSNYIIILVANKI
1dkiA           YF------NHPKNLFAAISTRQYNWNNILPTYSGRESNVQKMAISELMADVGI--SVDMDYGPSSGSAGS
2b8wB           KGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYV
2aunB           ----------------------WQPIDGRVAL-IAPASAIATEVLEATLRQLEVHGVGRHVEARYRYLAG
2bhvA           ---------KLLRTITADKMIPAFLITPISQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKM
2c9yA           SEL----GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVLDDLMEKRKEKLDSVIEF
2a2zA           TNVLQMMYEKP----ERWSFTFQTYACLSRIRAQLASLNGK---EKPVLFFERSVYSDRYFASNLYESEC
2ausC           ---------------------------EVIVKDDKAETNPKWGFPPDKRPIELHIQYGVINLDKPPPTSH
2b8tB           EV-----ESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFG
3d7wA           -------YFLSDAPAGAETQDFSGTTSSSQPFNGSYPDL-----ERYAGHRDQIPLGIDQLIQSVTALRF
1eilA           --------------------------------------------GYLGFAVKDVPAWDHFLTKSVGLMAA
2c4rL           AAE----SRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAALGRPSKIKLYTGEIPL
1cr4A           TAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA
1bccF           RWLEGIRKWYYNAAGNKYGLMRDDTIYENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQILP---KE
3dfpC           -------------------------------------------------------------HSHPALTPE
1e9sJ           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN-----------DYDWQRYALSV--------VPRGKTD
3dfnC           -------------------------------------------------------------HSHPALTPE
2d4hB           QNIFALAVLLSSTFVYNSIGTINQQAMDQLYYVLTHRIRSKSSDSADFVSFFPDFVWTLRDFSLDLEADG
1e9rE           -------LRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTD
2a1fF           --------------------------------------------------------------------SQ
2eg5G           FNSV---FKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHLSQVPSGLVTEIGTNKGSIYS
1dhiA           -------------------ISLIAALAVDRVIGME----------NAMPWNLPASLAWFKRNTLDKPVIM
3ecpA           ------AADWAKSVFSSAALGDRRTARLVNVASGKSITISSEGSKAAQEGAYRFIRN--PNVSAEAIRKA
2c04A           AR--------------------EQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAG
2d2eA           LSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNE
1bg0A           GDINTLVGLDPAGQFIISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTLSSMEDELKGTYYPLTMSK
2aunA           -------------------WQPIDGRVALIAPA----SAIATEVLEATLRQLEVHGVGRHVEARYRYLAG
2bhvD           ---------KLLRTITADKMIPAFLITPISSQAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKM
1cfrA           NDEAIRLGGKIDGSFNKCNWYEWLIGIRAIEFSFDVMSIYKSCLSEFIYDLRSKLSLNN-----VNLITS
2bkhA           ----EANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVEKSRICVQGKEERNYHIFYRLCAG
2boeX           ----------------------NMSSAEWVRNNPNDPRTPVI--RDRIASVPQGTWFAHHN---PGQITG
2aumB           ----------------DQTWQPIDGRVALIAPASAIATEV----LEATLRQLEVHGVGRHVEARYRYLAG
3cmvE           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDALAR--SGAVDVIVVDVAALTPKAEIEGLAARMMSQ
3cddF           RIQIEQHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFSKFTIKAA
3d3kA           RHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVF---LRD
1cr2A           EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFEAETDR---------
1e9sB           KF-----GRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
1bglA           -----------------------------------------------------------TRAPLDNDIGV
3cr7A           GLNKDLGSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPFPKGLYKKAREG
3dtbB           QGNLRAINPENGFF-GVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKN
3cddD           SYDE----STITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIVNTDVGEPFQRIQIEQ
3d31A           --DLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIK---DPKRVLDTARDLKIEHLLDRNPLTLSG
2drcA           -------------------ISLIAALAVDRVIGME----------NAMPFNLPADLAWFKRNTLDKPVIM
1d6jB           NKDLGFSEADRNEN-IRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYV
4atjA           -DCFVNGCDASILLDNTTSFRTEKDAFGNANSARPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAG
3bo6B           KFHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDENSQYSASSLH
2akaA           IL--QANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFISGASLEKSRVVFQSETERNYHIFYQLLAG
3cioD           SHNLFTVSNEHGLYLAGKDELNKVIQHKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDT
2dr3B           PVQVRQNMAQFGWDVKPYEEKGMFAMVDA------------------------FTAGIGEKYIVHDLTDI
3dfnD           -------------------------------------------------------------HSHPALTPE
1cr1A           ----------MLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEA
1e59A           AYTSVLKRAIVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKD
3dt4C           QGN----LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGPLAPGVTITSWKN
2bwjA           REELASESERIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPRKQGEEFGRRIGDPQLVICM
3cr7D           GLNKDLGFSEADRNEEVAKLFADSNSIAITSFISP--YRKDRDTARQLHEVAEETGLRDPKGLYKKAREG
2d3wA           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSG
3cmwC           -----IYARKLGVDIDNLLCSQPDTGEQALEICD----ALA---RSGAVDVIVVDSVAALTPKAEIEGEI
3ch4B           AQEH---GLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKSDTRRVSDIQWFREAYGAVTQTVRVVALEQS
2awoC           -----NDTPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
1e3aB           MNPKVYNPQSGYIANWNNSPQKDYVTEIDRLLEQKPRLTADQAWDVISRQDLNLRLFLPTLQAATSGLTQ
3dyoA           ----------------------ELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSE
2awoA           PA-----ERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
3dauA           -------------------ISLIAALAVDRVIGME----------NAMPWNLPADLAWFKRNTLNKPVIM
3c8uA           -------FHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPL--------FDRARDIAIA
1draA           -------------------ISLIAALAVDRVIGME----------NAMPWNLPAELAWFKRNTLDKPVIM
2d3wD           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFLLKMPEDLLTRSVNVGFSG
2ahvA           EGL---VKWALCGHWGQS-PRISDLAEQNKIIAYNYPQTLRAAAAHQPGIIS-DIGIGTFVDPRQQGGKL
3dt4A           QGN----LRAINPENGFFGVAPGTSVKTNPNAIKTNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKN
1adoA           -------------------------------------------------------------------TPE
2bofX           --RTPVIRDRIASVPQ-------GTWFAHHNPGQITGQVDALMSAAQAAGIPILVVSNAPGRDCGAPSHS
1dekB           ---AGPIKDALAYAWGVFAANTDYPLTRKE--------FEGIDYDRETNLNLTKLEVITIMEQAFCYLNG
2ahwD           EGLV---KWALCGHWGQS-PRISDLAEQNKIIAYNYPGVLTQTLRAAAAHQPGIIGIGTFVDPRQQGGKL
2bkiA           P-------LLEAFGNAKTVRNNNSSRFGKFVEIHSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAG
3bgwA           MGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNIN---------IFDKAGQSVNY
3dffA           ---------NVLVYTVFAGAAQPPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIRK
2aumA           -------------------WQPIDGRVALIAPA----SAIATEVLEATLRQLEVHGVGRHVEARYRYLAG
3cnlA           PGILY--KNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEFFEDFARKRGLLKKG
3dm9B           ---------RAGAIEQLEEHAKRI----GVKVIKHSYGADPAAVAYDAIQ------HAKARGIDVVLIDT
2bbsB           ------------FCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSG
3ec1A           TLDMIEIPLESGATLYDTPGIINHHQMAHFVARDLKIITPKREIHPRVYQLNEGQTLFFGGLARLDYIKG
3dfqC           -------------------------------------------------------------------TPE
2d3wC           LSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFIALLKMPEDLLTRSVNVGFSG
2a30A           TNVLQMMYEKPSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESEWTIYQD
3be4A           NGIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAKILSEIGDSLTSVIS
2bbtB           -------HSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSG
3dfoC           -------------------------------------------------------------------TPE
3cmtD           IY-----ARKLGVDIDNLLCSQPDTGEQALEICDALARKAEMGLAARMMSLAGNLKQSNTLLIFINQIRM
1e4yA           SEL---GKQAKDIMDAGKLVTDELVI---------------------ALVKERIAQEDCRNGFLLDGFPR
1cr0A           --KKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAET
1dyhA           -------------------ISLIAALAVDRVI-----GMEN-----AMPWNLPADLAWFKRNTLDKPVIM
3bb1E           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRNLDKLVAKAITDSFGKGI
1e9rF           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
2d2fA           LSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQEVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSG
4dfrA           -------------------ISLIAALAVDRVI-----GMEN-----AMPWNLPADLAWFKRNTLDKPVIM
3b55A           --------------------------------------------------QIAKWLEAHAKPLKTTNPTA
1d6jA           -------DNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATP
1dp0A           ----------------------ELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSE
1cjtC           IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWED----------------
1b0uA           DKDGQLKVADKNQLRLLRTRLTMMTVLENVMEAPIQVLGLSKHDARERALLAKVGIDERAQGKYPVHLSG
1accA           ---------------EFDFNF-DQQTSQNIKNQLAELNATN---IYTVLDKIKLNAKMNILIRDKRFHYD
1bmfC           ---------YCIYVAIGQKRSTVAQLVKRL-------------TDADAMKYTIVVSATASDAAPLQYLAP
1e9sH           GDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
2dflA           ------------YIDTEGTFRWERIENMAKALGLDIDNVMNNIYYIRAINTD---HQIAIVDDLQELVSK
2a1fD           ----------------------------------------------------------------------
3cddC           TVDIGGERVITGYVDDWVPSYDESTADLVDCSIDYPSGQFNNQTLTQIADVCKPFGIKVIVNTDVGQIEQ
5dfrA           --------------------------------------------RVIGPWNLPADLAWFKRNTLDKPVIM
1e2kA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQ---------------ITMGMPYAVTDAVLAPHIGG
2dpyB           DFIENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIAIG
1e2gA           IG------KLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENF
1dw9A           DSILLLQIPLRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDG
2a1fC           --------------------------------------------------------------------SQ
2a1fE           ----------------------------------------------------------------------
3bb1F           RSGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
3bv4A           ----------------------------------------------------------------PALTPE
2b8tC           RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQRICEVANILAENGFVVIISGLDKNFKGEPFG
3dt7A           KFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGEGIDEPLAPGVTITSWKN
2dr3C           VRQ---NMAQFGWDVKPYEEKGMFAMVDAF----------------------TAGIGEYEKYIVHDLTDI
1ai4B           NNSPQKDYPASDLFAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRLNLRLFLPTLQAATSGLTQ
2bv7A           ----------------------------------------------------------------ALKKYH
1drbA           -------------------ISLIAALAVDRVIGME----------NAMPWNLPACLAWFKRNTLDKPVIM
2dftC           IADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAAHTVVYLEISAAEGVRRTGGDRAE
2dftA           IADIFDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALHTVVYLEISAAEGVRRTGGNDRAE
3di4A           GTH----VTTGERLWSNLPYLRPATIIEDTLGWYGRCDPYTGNLLAGGHYHHCCHSNLTRALADHTGLPL
2czvB           RDTVQKFKSYLIYVESNDLRVIRYSIEKGVDIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLSNP
3bb1A           RSR---AGFTLNIIDTPGLIEGGYINALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFG
3cmuA           --LDPIYARKLGVDIDNLLCSQPDTGEQALEICD----ALARSGAVDVIVVDSVAALTPKAEIEGEIGDS
3cueF           TVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDL
1e2nA           LGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRH
2bjbA           IAPLLDALRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVS--GLLLSAA-----------SFT
2cckB           EEIRKIVLEGDMDIRTEAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFA
1e9rD           KFGRDKDIILNPYDQRTKGWSFFNEIRND------------------------YDWQRYALSVVPRGKTD
3d3qB           AKVTTE-EEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQYNYAFEDKKQVK
3bgwD           ---MGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTR
3cmvB           HALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVI--VVDSVAALTPKAEIGLAARMMSQ
3d3qA           AKVTTE-EEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEISE
3d1mB           --------------------------------------------------KQFIPNVAEKTLGASGRYEG
3bb1C           RSRAGFTLNIIDTPGLIEGGYINDMALIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGI
3cm0A           VARGTPLGERVRPIMERGDLVPDDLILELIREELFDGFPRTLAQAEALDRLLSETGT--RLLGVVLV---
1d8jA           ---------------------------------LSGSSGYKFGVLAKIVNYMKTRHQLDEILDETQHLDI
1afrA           EQVRELASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSG-MDPRTENSPYLGF
1e9rG           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLR---ET
2dpyA           DFIENILGPDGRARSVVIAAPADVSPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIAIG
2dr3F           --------EPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDI
1e9sE           --MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLL---LRET
3d1mA           --------------------------------------------------KQFIPNVAEKTLGASGRYEG
3dvlD           PQDIIKNARSFGWDLAKLVDEGKLFILDASPDP-------------EGQEVVGGFDLSALIERINYAIQK
1e9sL           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
3bk7A           -------------------------------------------------EVVKELELENVLDRELHQLSG
2ccjA           -------VPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGY
2e85B           --------------------------------------------------------CAAAPKGNWVVIDG
3cr7B           GLNKDLGFSEDRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDVPQR
2ck3C           AIG---QKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYL------------------------AP
2a5vA           RDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGSLAIVGVDGRAVLRDHIGNI
3c85A           YDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLGNQTALEQLQRRN
1cs4C           IETIVAAMSNLVPPVELANPENQFRVDYILSVM-------------------------------------
2awnA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3a00A           E------VNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSG---------KTCILD
1ak2A           SELGKKLKATMDAGKLVSDEMVLELIKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEF
1av6A           PIL----NGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVAS
1e2iA           QHRLDQGEIGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLM
1c9kC           ----DGRPAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDPEQWDY---------AAMERA
1dekA           WGVF-AANTDYPLTRKEFTNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDV
3ed8A           IGD-------GPVLLPDNHYLSYQTVLSK-----------------------------------------
2bhvC           ---------KLLRTITADKMIPAFLITPISSQAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKM
1culC           IET---IVAAMSNLVPPVELANPENQFRVD----------------------------------------
1e2iB           PEPMTYWRVLGASET-------IANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIG
3crmA           MDIGTAKPSRELLARYPHRLIDIRDPAESYSAAEFRADALAAMAKATARGRIPLL---VGGTMLYYKALL
3dfdA           AKEL---REAYKTEDPVEVAKRVLSVGGEYANWLNK----------------------------------
3dlbB           EVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELL---RLGEEDPKELPLPGGLSLLDYHASKGR
3a00B           ------EVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKS---------GKTCILD
1e2hB           NIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPLTLIFDRHPIAALLCYPA
3bwdD           YNR----LRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDH
1d2zD           ARPVDGPGALISLELLE-----------------------------------------------------
3bczC           GSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLDEH
2e85A           ------------------------SAVTDVLLCVGNSMMGDDGAGPLLAE-----KCAAAPKGNWVVIDG
2dr3D           ---------------LEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDI
1chdA           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
3bm2B           --------------ALEL-LINRRSASRLAEPAPNILRAGRAPDWHFFVIEGEGRERFSAVLEQGAIAAG
1e2nB           NIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCY
3bb1H           MVSRSRAGFTLNIIDTPGL--IEGGYINDMALNIIKSFLLDKTIDVLLYVDRLD----------AYRVDN
2a5vB           RDVVERVAPSVLLGRRDGLSRVDEFEQRHVHEVAILMARSSAISERIAGGSLAIVGV-------------
1ek0A           TINEHTVKFEIWDTAGQERFASLAPYYRNVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDLQE
1ckvA           EVDCDEISELLGRQFNVYDFLVDVS---------------------------------------------
2bkeA           ---------------AVYIDTEGTFRWERIENAKALGLDIDNVNNIYYIRAINTDHQIAIVDDLQELVSK
3bb1G           ----------------------------------------------------------------------
3cnnA           GILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIGIESSFSEFFE--------DFARKRGLLKKG
1e9sA           GDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
1e9sI           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYA-------------------LSVVPRGKTD
3bjqB           ----------------------------------------------------------------------
2bbtA           --------GRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSG
1e1qB           AIGQ---KRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYAYRQMSLLLRRPPGR
3dkvA           MKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTV------AQAEALEEIL--
2awoD           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
2d7vA           -----HLAHENCFI--------ANSVETEVVTE-------------------------------------
1akeA           SEL----GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVEF
2b0lC           ----------------------------------------------------------------------
2cdnA           IEEGTKLGVEAKRYLDAGDLVPSDLTNELVDNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLE
2d7vB           -----HLAHENCFI--------ANSVETEVVTE-------------------------------------
1azsC           -NLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSV--------------------------------
2cbzA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1e2lB           YWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTD--AVLAPHIGGEAGSPPALT
3b9qA           ----------------------------------------------------------------------
1e2mB           IANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDAALLCYPA
3c7kA           SLAIVRAMDTLGVEYGDKERKTDSKMVCD-----------------------------------------
2bboA           ----------------------------------------------------------------------
1dvrA           IAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQMLKEQGTPLEKAIEL
3bs4A           -QLIIRILSRFGVDVIKYLENHRLAIVDTFGSFHGMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLN
2ancF           DIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDDDFDTAL
3brwA           --------HDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQ
3dmdA           ----------------------------------------------------------------------
3c15C           NNLKEAIETIVAAMSNLVPPVELANPENQ-----------------------------------------
3e70C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3cphA           DINKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSD
1e2lA           NIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTL--IFDRHPIAAL
3cqcA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1d6aA           LQE---TWGKISTAIHDA----------------------------------------------------
1eamA           PILNRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPS-----------TADLLSNYALQNVMISIL
3c14C           AIETIVAASNLVPPVELANPENQF----------------------------------------------
1e9rB           -DMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKK
2bsqH           ---------------------------NAIKFRARAAGRTEAEIRLILDNIAKAQQTGSMLASIGQEIGG
2c95B           VSSGSARGKKLSEIMEKGQLVPLETVMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYV
1cjuC           -NLKEAIETIVAAMSNLVPPVELAN---------------------------------------------
3ci2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GEKQRAAIARAVIGRPQLLLADEPTGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINLMDQYEARRMVL
3b5jA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIII-AHRLSTVKNAD-RIIVM
2bifA           TTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSY
2dwoA           TTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASY
2d3wB           GEKKRNDILQMAVLEPELCILDESDSL-DIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVL
3dmdC           RSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEVKIDGIILTKLDADARGGAALSISY
3cmvH           SQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQ
2cgtH           YFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLIIAEDVEGEALATLVVNTMRGIVKV
2dwpA           TTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASY
2b8wA           FVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLA
1bifA           TTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSY
3c95A           AEQQRWLEHRRQVFTPEFL--QGYADELQMLVQQEKVALLKALWQYADEIV-------------------
3cmvG           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGEVVGSETRVKVVKNKIAAPFKQAEF
3cmvC           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEVGSETRVKVVKNKIAAPFKQAEFQIL
1aroP           MFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQA
3b60A           GQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTIEQAD------
3eiuA           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAREL-----HRKGIYPPINVLPSLSRLMNSGIGA
3dmdB           RSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEVKIDGIILTKLDADARGGAALSISY
2c03B           RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGDARGGAALSARH
1e69A           GEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVI-THNKIVMEAADLHGVTM
2c61B           AKGSVTQIPILSMPGDDITHPIPDLSGYITE-----GQIVVARELHRKGIYPPINVLPSLSRLMNSGIGA
2ccgA           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHN
2czvA           YERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASIS------------
2ccgB           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSLDEDLKFHEKVIEGYQIHNESQRFKSV
2bc9A           INQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKD
2ccjB           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQRFKSV
1d1cA           GATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA--MDIVGFSQEEQMSIFKIIAGILHL
2a2zD           WHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGREYLEKLHYHESWLLHRTLKTNFDYLQEVPILTL
3b2qA           EALRQMGAARN---EVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVT-QIPILSMPGDDITHPIPDLSG
2b8tA           PIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHA------DYNDDIVKIGCQEFYSAV--CRHHHK
2akaB           IEFQIRDMLMQFVTKENCLILAVSPANSDLANSDA-LKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVL
1e9cA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG----HERYENGAFQERALRCFHQLMKDTTLNWKMV
3dhwC           GQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDNRRLGLTILLITHEMDVVKRICDCVAVI
2cjwB           GRAAVVFDCKFIETSAAVQHNVKEL-------------------FEGIVRQVRLRRDSKE-KNERRLAYQ
3eiuB           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR-----ELHRKGIYPPINVLPSLSRLMNSGIGA
1e9fA           SLDWCKQPDVGLPKPDLVLFLQLQLA-----------DAAKRYENGAFQERALRCFHQLMKDTTLNWKMV
3dm5A           RHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKLDGSAKGGGALSAVA
421pA           LAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIR-------------------------
3cmvA           SQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK-IAAPFK
3czpB           QTQER-FKEREKTPYKRYKITEEDWRNRDKW--DQYVDAVGDVDR--TSTEIAPWTVEANDKRFARVKVL
1e9rA           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEAS--------------------------
1e2dA           LDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-----RALRCFHQLMKDTTLNWKMV
2ctsA           MSQLSAAITALNSESNFARAYA------------------------------------------------
2axzC           SIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQIKNISINGYYDLEINYLKQIKNIDS
2b92B           FFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKK----CFVFD
3a1wA           TAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY---------------------------
2bbsA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRIL-VTSKMEHLKKADKILIL
2axpA           KDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKDIIFLVEL---------------------------
2awnC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRHKRLGRTMIYVTHDQVEAMTLADKIVVL
4dcgA           GNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVR-NKVVVNFDYPNQEYDYF
2a5gA           MKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN---------------------------
2c9oC           DIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKI
2bhjA           ATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYTNNGNIRSAITVFPQRSDGKHDFRL
1e9sF           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGSNEASKALTSARFVL
2d4hA           ESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLLPRLCIRKFFPKKKCFVFDRP-VHRRKL
1e9sG           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSARFVL
2awnD           GRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPRQQVWLPVESRDVQVGANMSLGI
3bb1B           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLPNGIAW
1dhjA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDPEIMVIGGGRVYEQFLPKAQKLYLT
2bdtA           RKKGERCLELVEEFESKGI--DERYFYNTSHLQPTNLNDIVKNLKTNPRFI-------------------
1e9sD           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGSNEASKALTSARFVL
2a30D           WHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGHYKHESWLLHRTLKTNFDYLQEVPILTL
3b2qB           AKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK-----GIYPPINVLPSLSRLMNSGIGA
2c03A           RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEVGVTGLVLTKLDGDARGGAALSARH
1dg3A           FFPDFVWTLRDFSLDLQPLTPDEYLTYSLKL-KKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHELD
1cjaA           YTGYDVGTEGSISMQEGFLATVRECASFDLDSWQESLQKCHNLSISPQAIPFILRMLRIF----------
1e3mB           TFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWAENLANKIKALTLFATHYFELTQLPEKEGVAN
2c0bL           FSHYQIESQIESAFQREVRLPSGGSIVIDSTEAEETAFNTNLEAADEIARQLRLRDLGIVIDFIDMTPVR
1e0jA           AYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHEEGRP
2d0kA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAADVPEIFVIGGGRVYEQFLPKAQKLYLT
2bx2L           FSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAF--NTNLEAADEIARQLRLR
3dfoD           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
3dfpD           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2c61A           AEALRQMGARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDIT-HPIPDLSGYIT
2a30B           WHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGHYKHESWLLHRTLKTNFDYLQEVPILTL
2a5jA           ESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIY-------------------------
1e98A           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ----ERALRCFHQLMKDTTLNWKMV
1aldA           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
3dfqD           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2a2zB           WHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLHYKESWLLHRTLKTNFDYLQEVPILTL
2d4uA           ALAELIQLLGAGKINEFF---DQPTQGYQDGFEKQYVAYMEQNDRLHDIAVSDNN---------------
1e6cA           TGRPIAEEMEAVLREREALYQDVAHYVVDATQPMQTMRL-------------------------------
3bjdB           ALEQEIAAQSRERHPSYVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVN-LTDVDEA-AALARYLYG
2d62A           GQRQRVALGRAII-RRPKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHD---QVEATGDRIAV
1e9dA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYE----NGAFQERALRCFHQLMKDTTLNWKMV
3czpA           QTQER-FKEREKTPYKRYKITEEDWRNRDKQYVDAVGDVDRTSTEIAPWTLVEAN-----DKRFARVKVL
1e0jB           AYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGAKSTGVVLVVICHLKNPDKGKAHEEGRP
3cbnA           DHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR--------KGRELKVEIIVEYEGHH-------
3bpbA           AILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEEESYAA----NCIWV
2cckA           YQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAERIIKNSRLDQEDLKFHEKVIEGYQEIIRFKSVN
2d4uB           ALAELIQLLGAGKINEFF---DQPTQGYQDGFEKQYVAYMEQNDR-------------------------
3dfqA           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
3dftC           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2dr3A           REFIEVLRQAIRDINAKRVVVDSVTTLYINKARSIILQLKRVLAGTGCTSIFVSQVSGFGPGVEHGIIRL
3czjA           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWHQGKTLFISRKTYRIDGSGQMAITV
2c7cH           YFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLIIAEDVEGEALATLVVNTMRGIVKV
2awnB           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVEAMTLADKIVVL
1e3mA           GFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENNKIKALTLFATHYFELTQLPEKEGVAN
3dftD           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
3cr7C           VIKEFTGISAPYE-APANPEVHVKNYELPVQ--DAVKQIIDYLDTKGY----------------------
1e9sM           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFS
6aldA           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
3bh0A           QTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLMARELDVVVIALSQLSRQVEQRQDKRPML
3da4A           KEYQILLPGEIHIKES------------------------------------------------------
3adkA           DAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEG-----------
3dt2A           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIFGGRRPAGVPLVYEALSWQHGVFVEATAAAE
3dymA           SEATRIDPNAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHAWHQGKTLFISRKTYRIDGSGQMAITV
3dfnA           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2dr3E           REFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQVSVGPGHGVDGIIRL
3b85A           GFGSKVVTGDGLRLVRHILR-GVDDVHFSELTSSDVVR--------------------------------
3cmxA           PETTTGGNALK-FYASVRLDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQAEFQILYGEGIN
2cvfA           RKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRIT
1e2fA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHER---YENGAFQERALRCFHQLMKDTTLNWKMVD
3clvA           DKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI----------------------
1dkiA           SRVQRALKENFGYNQSVHQINRGDFSKQDWE------AQIDKELSQNQPVYYQGVGKVGGHAFVIDGADG
2b8wB           TELTHRIRSKSSVSFFPDFVWTLRDFSLDLADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFF
2aunB           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLPA
2bhvA           GEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYTSAFGDYLLMQLMRQSGMGINQV-VNQILR
2c9yA           SIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKKIRLQAYH----TQTTP
2a2zA           MNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWL
2ausC           EVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDK-IRAVM
2b8tB           PIAKLFTYADKITKLTAICNECGAEAT-------HSLRKIDGKHADYNDDIVKIGCQEFYSAV-CRHHHK
3d7wA           PGGQTKTQARSILILIQMI--SEAARFNP------ILWRARQYINSGASFLPDVYMLELETSWGQQVQHS
1eilA           GSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGDEAL--MQQRKVMG
2c4rL           FSHYQIESQIESAFQRGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRLRDLGGLIVI
1cr4A           ETLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAK--STGVVLVVICHLKDLRGGALRTIIAL
1bccF           QWTKYEEDVPYLEPYLKEVI--------------------------------------------------
3dfpC           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
1e9sJ           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVL
3dfnC           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2d4hB           QPLTPDEYLTSLKLKKGTSVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYI---FSNSKTGIQVN
1e9rE           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAEAGSNEASKALTSARFVL
2a1fF           PIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGM
2eg5G           SKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDLLEMAINDLVVEGHL
1dhiA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYEQFLPKAQKLYLT
3ecpA           GAMQTVKLAQE----FPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWW-VHSVLLLEATTFRTVGL
2c04A           RLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKLDGDARGGAALSAHV
2d2eA           GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNARGPNFGALVITHYQRILNYIQPDKVHVM
1bg0A           ATQQQLIDDHFLFKEGDRFLQTANACRYWPTDAKTFLVWVNEEDHLRIISMQKGGDLKTVYKRLVTAVDN
2aunA           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLPA
2bhvD           GYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPFGDYLLMQLMRQSGMGINQVVNQIVVI
1cfrA           NPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFDYAELEHIKSFLSVKTTFRPDRRLQLA
2bkhA           ASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMK
2boeX           QVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSHIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQE
2aumB           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSAFHRHGLPA
3cmvE           AMRKLAGNLKQSNTLLIFINQGGNALKFYAVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEF
3cddF           GIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKSNAEYTVTRIPQTGKLWNINTLVPVI
3d3kA           QPWYKAAVAWANQNRAPVLSIDPPVHI-DAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHS
1cr2A           --LLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLK--GFAKSTGVVLVVICHLKSGALRQLSDTIAL
1e9sB           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFSI
1bglA           SEATRINAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAWHQGKTLFISRKTYRIDGSGQMAITV
3cr7A           VIKEFTGISAPYEPANPEVHVKNYELPVQDAVKQIIDYL-------------------------------
3dtbB           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVG-AAMRS
3cddD           GETPHELLARLAK-QRGVLLTSDTFGNLVITKTKAGVSL-----ILGDNVKAARGRFSWRQRF-------
3d31A           GEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVHKKNKLTVLHITHDQTEARIMADRIAVV
2drcA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYEQFLPKAQKLYLT
1d6jB           DVPVEVAEQRAPYEAPANPEVHVKNYELPVDAVKQIIDYLDTKG--------------------------
4atjA           GPSWRVPLGRRDSLQAFLANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNF
3bo6B           NTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQALREEPFYR---------
2akaA           ATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKIT---RQAMDIVGFSQEEQMSIFKIIAGILHL
3cioD           PPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILVIKRASTAYSY-------
2dr3B           REFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGVHG
3dfnD           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
1cr1A           ETDRLLAKLARSGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHGSGALRQLSDTIIAL
1e59A           DERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNS-LRALVKYLDNM
3dt4C           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGRRPAGVPLVYEALSWQHGVFVGA-----
2bwjA           DCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLCTAI
3cr7D           VIKEFTGISAPYE-APANPEVHVKNYELPVQ--DAVKQIIDYLDTKGYLP--------------------
2d3wA           GEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVVL
3cmwC           GDSHMGLAARMMSQAMRKLAGNLKQSNTLL-IFINQIRMKIGFGNPETTTGGNALKFYASVRLDIRRIGA
3ch4B           RQQRGWVFTPGVDDAESECGLDNFG--------------------DFDWVIENHGVEQRLEEQLENLIEF
2awoC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIESRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
1e3aB           SDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDG
3dyoA           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRKTYRIDGSGQMAITV
2awoA           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
3dauA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
3c8uA           GAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIVPADLEARLVQRWLDHGLNHDAAVARAQGNDLA
1draA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRVYEQFLPKAQKLYLT
2d3wD           GEKKRNDILQMAVLEPELCILDESDGLDID-ALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVVL
2ahvA           NEVTKEDLIKLVEFDNKEYLYYKAI---------------------------------------------
3dt4A           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSWQHGVFVEATAAAE
1adoA           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2bofX           AYRSWIDEFAAGLKNRPAYIIVEPDLISLMSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWH
1dekB           KSPIKGVFVFDDE-GKESVNFVAFNKITDVINNIEDQWSVRRLMQLGTDLIVNNFDRMYWVKLFALDYLD
2ahwD           NEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALVIAQAVHNNGGIV--
2bkiA           ASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAM
3bgwA           IWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQARELDVVVIALSQLSRQVEQRQDKRPML
3dffA           LPDGRWLTAHVEGRQKLAVNDHSPDSDHDLV-GEVADDIRSIIDEFDPTLVVTCAA---IGEHPDHEATR
2aumA           TVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSAFHRHGLPA
3cnlA           GVPDIERALMLFFGKAGRVSFERPE---------------------------------------------
3dm9B           AGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAKIDGIILTKLDADARGGAALSISY
2bbsB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
3ec1A           GRRSFVCYMANELTVHR-TKLEKADSLYANQLGELLSP---PSKRYAAEFPPLVPRSLSVKERKTDIVFS
3dfqC           QKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2d3wC           GEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTH-YQRILDYIKPD-YVHVL
2a30A           WHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRPLEYLEKLHYKESWLLHRTLKTNFDYLQEVPILTL
3be4A           GRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVLDVFHKQTAPLVKFYEDLGILKRVN
2bbtB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
3dfoC           QKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
3cmtD           KNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVK----VVKNKIAAP-----FKQAEFQI--
1e4yA           TIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVY--HVKFNPPKVEGKDDVTGEELTTR
1cr0A           DRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKG--FAKSTGVVLVVICHDLRALRQLSDTIIAL
1dyhA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYEQFLPKAQKLYLT
3bb1E           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENS-GRCNKNDSDEKVL
1e9rF           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASK-------------------------
2d2fA           GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARVNAMRGPNFGALVITHYQRILNYIQPDKVHVM
4dfrA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPIMVIGGGRVYEQFLPKAQKLYLT
3b55A           SLNDLKPLKNV--GSASIVGLGEATHGAHEVFTKHRI-VKYLVSEKGFTNLVLEEGWDRALEL-DRYVLT
1d6jA           GEETGLPFVEVYVDVPVEAPYEAPANKNYELPVQDAVKQIIDYLDT-KGYLPA-----------------
1dp0A           ATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLTTAHAWQHQGKTLFISRKTYRIDGSGQMAITV
1cjtC           ----------------------------------------------------------------------
1b0uA           GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFL
1accA           RNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVI--ND----RYDML
1bmfC           YSGCSMGEYFRDNGKHALIIYDDLSKQAVAY-RQMSLLLRRPPGREAYPGDVFYLHSRLLERA-------
1e9sH           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFSI
2dflA           DPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLAEVDIAVIITNQVMHTLYHVPGIRIQL
2a1fD           ------IYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGM
3cddC           GETPHELLARLAK-QRGVLLTSDTFGNLVITRASKTKAGVSLI--LGDNVKAARGRFSWRQRFS-KFTIK
5dfrA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAAACGDVPEIMVIGGGRVYEQFLPKAQKLYLT
1e2kA           EAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPG
2dpyB           EPPATKGYPPSVFAKLPALV--------------------------------------------------
1e2gA           SLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAF--------QERALRCFHQLMKDTTLNWKMV
1dw9A           K---------------------------------------------------------------------
2a1fC           PIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGM
2a1fE           ------IYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGM
3bb1F           WNKAIVALTHAQFSPPDGLPYDEFFSKRSE-ALLQVVRSGASLKKDIPVVLIENSGRCNKNDS-DEKVLP
3bv4A           QKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFH
2b8tC           PIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKHADY------NDDIVK-IGCQEFYSAVCRHHHKV
3dt7A           KEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIFGGRRPAGVPLVYEALSWQHGVFVEATAAAE
2dr3C           REFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVLAGTGCTSIFVSQVSGVEHGVD-GIIRL
1ai4B           SDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDG
2bv7A           GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYEMY------------
1drbA           GRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIMVIGGGRVYEQFLPKAQKLYLT
2dftC           KYRALMAKRAPLYRRVATMRVDTNRRNPGAVV-RHILSR-------------------------------
2dftA           KYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL-------------------------------
3di4A           HEAELVHDVLNVFCTGFQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEA-----SCHPLLVEIF
2czvB           YERANLAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGME---IPQAKASISM-----------
3bb1A           WNKAIVALTHAQFSPPDGLPYDEFFSKRSE-ALLQVVRSGASLKSDIPVVLIENSGRCNKN--DSDEKVL
3cmuA           HMGLAARMMSQAMRKLAGNLKQSNTLLIFIN---------------------------------------
3cueF           KDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESM----------------------
1e2nA           PIAALLCYPAARYLMGSMTPQAVLA---------------------------------------------
2bjbA           DGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRGPVAARRWDIEPDLT-NAVAFLSAAVV
2cckB           INGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIRFKSVNADQPLENVVED-TYQTI-
1e9rD           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSARFVL
3d3qB           LKKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTDTLLIGIESRETLYLRINKRVDIL
3bgwD           QTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISLKKMARELDVVVIALSQLSRQVEQRQDKRPML
3cmvB           AMRKLAGN-LKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGEN--VVGSETRVKVVKNKIAAPFK
3d3qA           DKKYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLKVQQFTENYDTLLIGIESRETLYLRINKRVDIL
3d1mB           KITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRVTEGWDEDGHHSEESLH
3bb1C           WNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSD-IPVVLIENSGRCNKN--DSDEKVL
3cm0A           -EVPEEELVRRILRRAELDDNEETVRRRLEVYREKTEPLVGYYEARVLKRVDGLGTPD------------
1d8jA           GLKQKQWLMEALVNNPKIEVIDGKYAFKPK----------------------------------------
1afrA           IYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAADE------KRHETAYTKIVEKLFEIDPDGTVL
1e9rG           AKKLALIGTPSMRELFHWTTIA------------------------------------------------
2dpyA           EPPATKGYPPSVFAKLPALV--------------------------------------------------
2dr3F           REFIEVLRQAIRDINAKRVVVDSVTTLYINKARSIILQLKRVLAGTGCTSIFVSQVSGGVEHGVDGIIRL
1e9sE           AKKLALIGTPSMRELF------------------------------------------------------
3d1mA           KITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALQWPGVKLRVTEGWDEDGH--HSEESLH
3dvlD           YRARRVSIDS-----VTSVFQQYDA---SSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVEE
1e9sL           LALIGTPSMRELFHWTTIATFDDLRGFLGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSI
3bk7A           GELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYLSDVIHVV
2ccjA           ARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLQEDLKFHEKVIEGYQEIIHRFKSV
2e85B           GSAPENDIVARELRPTRLLIVDATDMGLNPGEIRII-----DPDDIAEMFMMTTHNMPLNY---------
3cr7B           DPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKGY-------------
2ck3C           YSGCSMGEYFRDNGKHALIIYDDLSKQAVAY-RQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAF
2a5vA           G---------------------------------------------------------------------
3c85A           YKGQIAAIAEYPD-QLEGLLESGVDAAFNIYFARHVCK--------------------------------
1cs4C           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
3a00A           IDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYKELKDFIFA-----------------
1ak2A           SIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPRRSDDNKKALKIRLEAYHTQTTPLVEY
1av6A           SLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKI
1e2iA           GSMTPQAVLAFVALIPPTLPGT------------------------------------------------
1c9kC           IDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAAD---------EVWLV
1dekA           INNIEDQWSVRRLMQALGTDLIVN----------------------------------------------
3ed8A           ----------------------------------------------------------------------
2bhvC           EYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRY------GVPLLLST----------------
1culC           ----------------------------------------------------------------------
1e2iB           GEAHAPPPALTLIFDRHPIAACYPAARYLMGAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLD
3crmA           EGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLHAGLPSIRAVGYRQVWDYL--
3dfdA           ----------------------------------------------------------------------
3dlbB           LQGREGGRVAWVADPKDP---RKPIPHLTGLLVPVGSLALSLPWEERRRTREIASWIGRRLGLGTPEAVR
3a00B           IDMQGVKSVKAIPELNARFLFIAPPSGAHDKVIVND--DLDKAYKELKDFIFA-----------------
1e2hB           ARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA----IRRVYGLLANTV
3bwdD           AVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ-------------------------
1d2zD           ----------------------------------------------------------------------
3bczC           SIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSS---------------
2e85A           GSAPENDIVAIRELRPTRLLIVATDMGLNPGEIR-----IIDPDDIAEMFMMTTHNMPLNYLKEDIGEVI
2dr3D           REFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPGEHG
1chdA           ------------LSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSAVIITQHMPPGFTRSFAERLNKL
2aexA           ---------------DELAHRCSSFMAPPVTDLGELELLILETQAVCQALAQVDGGANFSVDRWERKEGG
3bm2B           SDDKAIDKARNAPFRAPLIITVVAVPRWEQESGCAVAQAAVAQGFGGIWRSGALTESPVVR----EAFGC
1e2nB           PAARYLMGSMTPQAVLAFVIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRV-YGLLANTVRYLQ
3bb1H           LDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKDSDIVVLIE
2a5vB           ----------------------------------------------------------------------
1ek0A           GGERKVAR--------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2bkeA           DPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRLEVYDIAVIITNQVVPGIRIQ---LKKS
3bb1G           ----------------------------------------------------------------------
3cnnA           GVPDIERALMLFFGKAGRVSFERPE---------------------------------------------
1e9sA           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKLTSARFVLSDKLPEHVTMPDGDFSI
1e9sI           EAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLLEGTLAESLFAGSNEASKALTSARFVL
3bjqB           --QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAFRLKRNTKRIDFG
2bbtA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
1e1qB           EAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIET-----QAGDVSAYIPTNVISITD---------
3dkvA           -EEMGRPIDYVIN------IQVDKEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADD
2awoD           ----------------------------------------------------------------------
2c5mD           --KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQYVIKGDYLGKTVQVVPHITDAIQEWVMRQALE
2d7vA           ----------------------------------------------------------------------
1akeA           DVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKTAPLIGYYSKEAEAGNTKYAKV
2b0lC           ------------MSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVIVNALRKLESAGVI
2cdnA           FRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPL-LEYYRDQLKTVDAVGTM-------------
2d7vB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2axnA           ----------------------------------------------------------------------
1e2lB           LIFDRHPIAALLCYPAARYLMGS----MTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLA
3b9qA           ----------------------------------------------------------------------
1e2mB           ARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGL---LANTVRY
3c7kA           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
1dvrA           KVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEAQISDDNADALKKRLAAYHAQ-------
3bs4A           LFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWE--------------
2ancF           TDLKTIIRAERLRMSRQKQRHDALISKLL-----------------------------------------
3brwA           KLGATSEEELFST-NEESPAFVEFLEFLGQKVKLQDFKGFRGHGQTGTESVYCNFRNKEIMFHVSTKLPY
3dmdA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3e70C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
3cphA           METRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGN------------
1e2lA           LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAIRRVY
3cqcA           ----------------------------------------------------------------------
3bb1D           ----------------------------------------------------------------------
1d6aA           ----------------------------------------------------------------------
1eamA           NPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSTGENMRLTRVTKSDAVNYAKKMYYL
3c14C           ----------------------------------------------------------------------
1e9rB           LALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKATSARFVLSDKLPEHVTMPDGDFSI
2bsqH           VE--------------------------------------------------------------------
2c95B           DAGPETMTQRLLKRGETSGRVDDNEETIKETYYKATEPVIAFYEKRGIVRKVAEGSV-------------
1cjuC           ----------------------------------------------------------------------
3ci2A           ---------------------------------EEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLF


                         .         .         .         +         .         .         .:280
query           HQGRLHIYE
3b5jA           EKGKI----
2bifA           ESLDEEQD-
2dwoA           QPLDPDKC-
2d3wB           YQGRI----
3dmdC           VIDAP----
3cmvH           AEFQI----
2cgtH           AAVKAP---
2dwpA           QPL------
2b8wA           QLEKL----
1bifA           ESLDEE---
3c95A           ---------
3cmvG           QILYG----
3cmvC           YGEGI----
1aroP           VASAI----
3b60A           ---------
3eiuA           GKTREDHK-
3dmdB           VIDAP----
2c03B           VTGKP----
1e69A           VNGVSAIVP
2c61B           GKTREDHK-
2ccgA           ESQRF----
2czvA           ---------
2ccgB           NADQP----
2bc9A           ETFNLPRL-
2ccjB           NADQP----
1d1cA           GNIKFE---
2a2zD           DVNE-----
3b2qA           YITEGQIV-
2b8tA           VPNRP----
2akaB           ENKLLPLR-
1e9cA           DASKS----
3dhwC           SNGELIEQ-
2cjwB           KRKE-----
3eiuB           GKTRE----
1e9fA           DASK-----
3dm5A           ATGAP----
421pA           ---------
3cmvA           QAEFQILY-
3czpB           RT-------
1e9rA           ---------
1e2dA           DASKS----
2ctsA           ---------
2axzC           YLNAVN---
2b92B           RPVHR----
3a1wA           ---------
2bbsA           HEGSS----
2axpA           ---------
2awnC           DAGRVAQV-
4dcgA           HMYFM----
2a5gA           ---------
2c9oC           RAQT-----
2bhjA           WNSQLIRY-
1e9sF           SD-------
2d4hA           AQLEKLQDE
1e9sG           SDKL-----
2awnD           RPEHL----
3bb1B           IPHLV----
1dhjA           HIDAE----
2bdtA           ---------
1e9sD           SDKLPEHV-
2a30D           DVNEY----
3b2qB           GKTREDHK-
2c03A           VTGKPIYFA
1dg3A           PEFVQQVAD
1cjaA           ---------
1e3mB           VHLDA----
2c0bL           HQRAV----
1e0jA           VSITDLRG-
2d0kA           HIDAE----
2bx2L           DLGGL----
3dfoD           ETLYQKADD
3dfpD           ETLYQKADD
2c61A           EGQIV----
2a30B           DVNEY----
2a5jA           ---------
1e98A           DASKR----
1aldA           ETLYQKADD
3dfqD           ETLYQKADD
2a2zB           DVNE-----
2d4uA           ---------
1e6cA           ---------
3bjdB           ELGEE----
2d62A           NKGELQQV-
1e9dA           DASKS----
3czpA           RT-------
1e0jB           VSITDLRG-
3cbnA           ---------
3bpbA           NERVIMPA-
2cckA           ADQPL----
2d4uB           ---------
3dfqA           ETLYQKADD
3dftC           ETLYQKADD
2dr3A           DLDEI----
3czjA           DVEVASDT-
2c7cH           AAVKA----
2awnB           DAGRV----
1e3mA           VHLDA----
3dftD           ETLYQKADD
3cr7C           ---------
1e9sM           IRSWLEDPN
6aldA           ETLYQKADD
3bh0A           SDLRESGQ-
3da4A           ---------
3adkA           ---------
3dt2A           HKGKV----
3dymA           DVEVASDT-
3dfnA           ETLYQKADD
2dr3E           DLDEI----
3b85A           ---------
3cmxA           FYG------
2cvfA           ERG------
1e2fA           ASKSI----
3clvA           ---------
1dkiA           RNFYH----
2b8wB           PKKKCFVF-
2aunB           IHGP-----
2bhvA           DKS------
2c9yA           LIEYY----
2a2zA           LHRTLKTNF
2ausC           KEFEG----
2b8tB           VPNRPYLNS
3d7wA           TDGVF----
1eilA           LLCLQDPF-
2c4rL           DFIDM----
1cr4A           ERNQL----
1bccF           ---------
3dfpC           ETLYQKAD-
1e9sJ           SDKLPEHV-
3dfnC           ETLYQKAD-
2d4hB           GPRLESLV-
1e9rE           SDKLPE---
2a1fF           NRVVGD---
2eg5G           EEEKLDSFN
1dhiA           HIDAE----
3ecpA           LHQEWWMR-
2c04A           TGKPI----
2d2eA           MDGRV----
1bg0A           IESKLPFS-
2aunA           IHGPV----
2bhvD           REGSR----
1cfrA           H--------
2bkhA           KIGLDDEEK
2boeX           VLETMAYA-
2aumB           IHGP-----
3cmvE           QILYGE---
3cddF           DEIGLD---
3d3kA           PFGCKF---
1cr2A           ERNNLVLVR
1e9sB           RSWLEDPN-
1bglA           DVEVAS---
3cr7A           ---------
3dtbB           EAKVIMHD-
3cddD           ---------
3d31A           MDGKLIQV-
2drcA           HIDAE----
1d6jB           ---------
4atjA           SNT------
3bo6B           ---------
2akaA           GNIKFEKG-
3cioD           ---------
2dr3B           VDGII----
3dfnD           ETLYQ----
1cr1A           ERNQL----
1e59A           SEEEI----
3dt4C           ---------
2bwjA           DSI------
3cr7D           ---------
2d3wA           YQGRI----
3cmwC           VKEGENVV-
3ch4B           IRSRL----
2awoC           DAGRVAQV-
1e3aB           PTGSL----
3dyoA           DVEVASDT-
2awoA           DAGRVAQV-
3dauA           HIDAE----
3c8uA           NARAI----
1draA           HIDAE----
2d3wD           YQGRI----
2ahvA           ---------
3dt4A           HKGKV----
1adoA           ETLYQ----
2bofX           SPA------
1dekB           KFNSGY---
2ahwD           ---------
2bkiA           KKIGLD---
3bgwA           SDLRESGQ-
3dffA           DAALFATH-
2aumA           IHGP-----
3cnlA           ---------
3dm9B           VIDAPILF-
2bbsB           HEGSS----
3ec1A           GLGWV----
3dfqC           ETLYQKAD-
2d3wC           YQGRI----
2a30A           DVNEY----
3be4A           AKLPP----
2bbtB           HEGSS----
3dfoC           ETLYQ----
3cmtD           ---------
1e4yA           KDDQE----
1cr0A           ERNQLVLVR
1dyhA           HIDAE----
3bb1E           PNGIA----
1e9rF           ---------
2d2fA           MDGRV----
4dfrA           HIDAE----
3b55A           GKGN-----
1d6jA           ---------
1dp0A           DVEVASDT-
1cjtC           ---------
1b0uA           HQGKI----
1accA           NISSL----
1bmfC           ---------
1e9sH           RSWLEDPN-
2dflA           KKSRG----
2a1fD           NRVVG----
3cddC           ADSA-----
5dfrA           HIDAE----
1e2kA           ERLDLAMLA
2dpyB           ---------
1e2gA           DASKS----
1dw9A           ---------
2a1fC           NRVVGDHM-
2a1fE           NRVVGDHM-
3bb1F           NGIAWI---
3bv4A           ETLYQ----
2b8tC           PNRPY----
3dt7A           HKGKV----
2dr3C           DLDEI----
1ai4B           PTGSL----
2bv7A           ---------
1drbA           HIDAE----
2dftC           ---------
2dftA           ---------
3di4A           APAEG----
2czvB           ---------
3bb1A           PNGI-----
3cmuA           ---------
3cueF           ---------
1e2nA           ---------
2bjbA           SGGTVRI--
2cckB           -IKYL----
1e9rD           SDKLPEHV-
3d3qB           GHGLF----
3bgwD           SDLRESGQ-
3cmvB           QAEFQILY-
3d3qA           GHGLFNEV-
3d1mB           YEGRA----
3bb1C           PNGI-----
3cm0A           ---------
1d8jA           ---------
1afrA           AFADM----
1e9rG           ---------
2dpyA           ---------
2dr3F           DLDEI----
1e9sE           ---------
3d1mA           YEGRA----
3dvlD           F--------
1e9sL           RSWLEDPN-
3bk7A           YGEPGVYG-
2ccjA           NADQP----
2e85B           ---------
3cr7B           ---------
2ck3C           GGGSLTAL-
2a5vA           ---------
3c85A           ---------
1cs4C           ---------
2awnA           ---------
2c9gA           ---------
3a00A           ---------
1ak2A           YSKRGIHSA
1av6A           VRNK-----
1e2iA           ---------
1c9kC           VSGI-----
1dekA           ---------
3ed8A           ---------
2bhvC           ---------
1culC           ---------
1e2iB           LA-------
3crmA           ---------
3dfdA           ---------
3dlbB           AQAYRLSI-
3a00B           ---------
1e2hB           R--------
3bwdD           ---------
1d2zD           ---------
3bczC           ---------
2e85A           FLGIQ----
2dr3D           VDGII----
1chdA           CQIS-----
2aexA           GGISCVLQ-
3bm2B           REQD-----
1e2nB           CGGSWR---
3bb1H           NSGRC----
2a5vB           ---------
1ek0A           ---------
1ckvA           ---------
2bkeA           RGNRR----
3bb1G           ---------
3cnnA           ---------
1e9sA           RSWLEDPN-
1e9sI           SDKL-----
3bjqB           YEGDP----
2bbtA           HEGSS----
1e1qB           ---------
3dkvA           NEETVT---
2awoD           ---------
2c5mD           PQVCVI---
2d7vA           ---------
1akeA           DGTKP----
2b0lC           ESRSL----
2cdnA           ---------
2d7vB           ---------
1azsC           ---------
2cbzA           ---------
2axnA           ---------
1e2lB           MLAAIR---
3b9qA           ---------
1e2mB           LQCGGSWRE
3c7kA           ---------
2bboA           ---------
1dvrA           ---------
3bs4A           ---------
2ancF           ---------
3brwA           T--------
3dmdA           ---------
3c15C           ---------
3e70C           ---------
3do6A           ---------
3cphA           ---------
1e2lA           GL-------
3cqcA           ---------
3bb1D           ---------
1d6aA           ---------
1eamA           NKIVRNKV-
3c14C           ---------
1e9rB           RSWLEDPN-
2bsqH           ---------
2c95B           ---------
1cjuC           ---------
3ci2A           VDKLD----