[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38253.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c96A.bssp"
#ERROR : Can't open dsspfile "1bgnA.bssp"
#ERROR : Can't open dsspfile "2bryA.bssp"
#ERROR : Can't open dsspfile "2c4cB.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"
#ERROR : Can't open dsspfile "3cgvA.bssp"
#ERROR : Can't open dsspfile "2e4gB.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "1bgjA.bssp"
#ERROR : Can't open dsspfile "3dmeA.bssp"
#ERROR : Can't open dsspfile "1bf3A.bssp"
#ERROR : Can't open dsspfile "1a0eA.bssp"
#ERROR : Can't open dsspfile "1cj2A.bssp"
#ERROR : Can't open dsspfile "1cj3A.bssp"
#ERROR : Can't open dsspfile "1bkwA.bssp"
#ERROR : Can't open dsspfile "2ardA.bssp"
#ERROR : Can't open dsspfile "2c4cA.bssp"
#ERROR : Can't open dsspfile "3bhkA.bssp"
#ERROR : Can't open dsspfile "3da1A.bssp"
#ERROR : Can't open dsspfile "3cuqB.bssp"
#ERROR : Can't open dsspfile "2e4gA.bssp"
#ERROR : Can't open dsspfile "3bhfA.bssp"
#ERROR : Can't open dsspfile "3e1tA.bssp"
#ERROR : Can't open dsspfile "2apgA.bssp"
#ERROR : Can't open dsspfile "3cukA.bssp"
#ERROR : Can't open dsspfile "3c4aA.bssp"
#ERROR : Can't open dsspfile "2bxsA.bssp"
#ERROR : Can't open dsspfile "1an9A.bssp"
#ERROR : Can't open dsspfile "1d4cC.bssp"
#ERROR : Can't open dsspfile "1b3mA.bssp"
#ERROR : Can't open dsspfile "3djeA.bssp"
#ERROR : Can't open dsspfile "3eitA.bssp"
#ERROR : Can't open dsspfile "1d4dA.bssp"
#ERROR : Can't open dsspfile "2dkiA.bssp"
#ERROR : Can't open dsspfile "1d4cA.bssp"

## Summary of PDB Search
:540
    5e-33  14%  3c96A  [x.x.x] FLAVIN-CONTAINING MONOOXYGENASE
    9e-21  15%  1bgnA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    4e-20  14%  2bryA  [x.x.x] NEDD9 INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    8e-20  14%  2c4cB  [x.x.x] NEDD9-INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    2e-19  15%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    2e-17  15%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    1e-16  10%  3cgvA  [x.x.x] GERANYLGERANYL REDUCTASE RELATED PROTEIN
    2e-16  12%  2e4gB  [x.x.x] TRYPTOPHAN HALOGENASE
    2e-16  16%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    3e-16  16%  1bgjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    4e-16  12%  3dmeA  [x.x.x] CONSERVED EXPORTED PROTEIN
    5e-16  15%  1bf3A  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-15   9%  1a0eA  [c.1.15] XYLOSE ISOMERASE
    2e-15  15%  1cj2A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    8e-15  16%  1cj3A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-14  15%  1bkwA  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-14  14%  2ardA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    1e-13  16%  2c4cA  [x.x.x] NEDD9-INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
    5e-13   9%  3bhkA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    6e-13  11%  3da1A  [x.x.x] GLYCEROL-3-PHOSPHATE DEHYDROGENASE
    9e-13   6%  3cuqB  [x.x.x] VACUOLAR PROTEIN-SORTING-ASSOCIATED PROTEIN 36
    3e-12  14%  2e4gA  [x.x.x] TRYPTOPHAN HALOGENASE
    8e-12   8%  3bhfA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    2e-11  15%  3e1tA  [x.x.x] HALOGENASE
    8e-11  13%  2apgA  [x.x.x] TRYPTOPHAN HALOGENASE PRNA
    8e-11   8%  3cukA  [x.x.x] D-AMINO-ACID OXIDASE
    9e-11   7%  3c4aA  [x.x.x] PROBABLE TRYPTOPHAN HYDROXYLASE VIOD
    3e-10  15%  2bxsA  [x.x.x] AMINE OXIDASE [FLAVIN-CONTAINING] A
    1e-07   9%  1an9A  [c.4.1 - d.16.1] D-AMINO ACID OXIDASE
    2e-05  13%  1d4cC  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    4e-05  10%  1b3mA  [x.x.x] MONOMERIC SARCOSINE OXIDASE
    5e-05   9%  3djeA  [x.x.x] FRUCTOSYL AMINE: OXYGEN OXIDOREDUCTASE
    8e-05   7%  3eitA  [x.x.x] PUTATIVE ATP/GTP BINDING PROTEIN
    2e-04  14%  1d4dA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
    3e-04  21%  2dkiA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    4e-04  11%  1d4cA  [a.138.1 - c.3.1 - d.168.1] FLAVOCYTOCHROME C FUMARATE
:540

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
3c96A           ---------------------------------------------QAGIGKVTLLESSSEIRPLGVGINI
1bgnA           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGRIRAG
2bryA           ----------------------------------------------------------------------
2c4cB           -------------------------------------------------------------GAGPCGLRA
1d7lA           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGRIRAG
1cc6A           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGRIRAG
3cgvA           --------------------------------------STAARYAAKYGLKTLIEKRPEIGSPVRCGEGL
2e4gB           ----------------------------------------------------------------------
1cc4A           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGRIRAG
1bgjA           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGRIRAG
3dmeA           --------------------------------------LAIARALAAGGHEVLVAEAAEGIGTGTLKARL
1bf3A           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGKIRAG
1a0eA           ----------------------------------------------------------------------
1cj2A           --------------------------------------LLLGQLLHKAGIDNVILERRTPDYVLGRIRAG
1cj3A           --------------------------------------LLLGQLLHKAGIDNVILERQTPDEVLGRIRAG
1bkwA           --------------------------------------LLLGQLLHKAGIDNVILERQTPDYVLGRIKAG
2ardA           ----------------------------------------------------------------------
2c4cA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
3da1A           ----------------------------------------IALDAQVRGIQTGLVENDFASGTSSRSTKL
3cuqB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
3e1tA           --------------------------------------STLASFVAMRGHRVLLLEREAFPRHQIGESLL
2apgA           ----------------------------------------------------------------------
3cukA           --------------------------------------LSTALCIHERYHSVLQPLDIKVYADRFTPLTT
3c4aA           --------------------------------------LVFASQLKQARPLWAIDIVEKNDEQEVLGWGV
2bxsA           ----------------------------------------------------------------------
1an9A           --------------------------------------LSTALCIHERYHSVLQPLDVKVYADRFTPFTT
1d4cC           --------------------------------------LAAAVSARDAGAKVILLEKEPIPGGNTAAETK
1b3mA           --------------------------------------MAAGYQLAKQGVKTLLVDAFDPPHTDTRIIRH
3djeA           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------EKDVPI
1d4dA           --------------------------------------LAAAVSARDAGAKVILLEKEPIPGGNTAAETK
2dkiA           ----------------------------------------------------------------------
1d4cA           --------------------------------------LAAAVSARDAGAKVILLEKEPIPGGNTKGMNA


                         .         .         *         .         .         .         .:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
3c96A           QPAAVEALAELGLGPALAATAIPTHELRYIDQSGATVWSEPRGVEAGNAYPQYSIHRGELQMILLAAVRE
1bgnA           VLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREAS
2bryA           -----------------------NVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVAL
2c4cB           AVELALLGARVVLVEKRIKFSRHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVAL
1d7lA           VLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRID-LKRLSGGKTVTVYGQTEVTRDLMEAREA
1cc6A           VLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTV-YGQTEVTRDLMEAREA
3cgvA           SKGILNEADIKADRSFIANEVKGARIYGPSEKRPI-----------ILQNEVGYVLERDKFDKHLAALAA
2e4gB           ----------------------------------------------------------------------
1cc4A           VLEQGMVDLLREAG-VDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA
1bgjA           VLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFA-GQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA
3dmeA           CVRGKHLLYEYGVPHQRLGKLIVATSDAEASQLDSIARRALHCTAALVSPSTGIVDSHALMLAYQGDAES
1bf3A           VLEQGMVDLLREAGVDRRMARDGLVHEGVEIAFAG-QRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA
1a0eA           ----------------------------------------------------------------------
1cj2A           VLEQGMVDLLREA-GVDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA
1cj3A           VLEQGMVDLLREAG-VDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA
1bkwA           VLEQGMVDLLREAG-VDRRMARDGLVHEGVEIAFAGQRRRIDLKRLSGGKTVTVYGQTEVTRDLMEAREA
2ardA           ----------------------------------------------------------------------
2c4cA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
3da1A           VHGVGKERAIVYENAPHVTTPEWLLPIFKRYLNEKQTLEKEPLLRKENLKGGGIYVEYRTDDARLTLEIA
3cuqB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3bhfA           ---------------------------------------------AIFEPNSGVLFSENCIRAYRELAEA
3e1tA           PATVHGICAMLGLTDEMKRAGFPIKRGGTFRWGKEPEFGFTRHPDDPYGFAYQVERARFDDMLLRNSERK
2apgA           ----------------------------------------------------------------------
3cukA           TDVAAGLWQPYLPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTP
3c4aA           VLPGRPGQHPANPLSYLDAPERLNPQFLEDFKLVHHNEPSLSTGVLLCGVERRGLVH-------------
2bxsA           --------------------------------------------------------------QVSERIMD
1an9A           TDVAAGLWQPYTSEPSNPQEANWNQQTFNYLLSHIGMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPR
1d4cC           PQAKLGIEDKKQIMIDDTMKGNDPELVKANNSSDSIDWLTMTDVGRMGGASVNRSHRPTGGAGVGAHVAQ
1b3mA           AYGEGREYVPLALRSQELWYELEKETHHKIFTKTGVLESAFVAETMEAAKEHSLTVDLLEGDEINKRWPG
3djeA           --------------------------------------------------------------------QR
3eitA           DPTSIEYLENTSFAEHVNTLDSHKNYVVIVNDGRLGHKFLIDLPARTADLGGGALPAVRVEDWISRRGSD
1d4dA           PQAKLGIEDKKQIMIDDTMKGVLANNSSDSIDWLTSMGADMTDVGRMGGASVNRSHRPTGGAGVGAHVAQ
2dkiA           ----------------------------------------------------------------------
1d4cA           AETKPQAKLGIEDKKQIMIDDTMKGGRNINDPELVKVLANNSSDSIDWLTSMGADMTDVGRAQVLWDNAV


                         +         .         .         .         .         *         .:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
3c96A           RGQQAVRTGLGVERIEERDGRVLIGARDGHKPQALGADVLVGADGIHSAVRAHLHPDQRPLSHGGITMWR
1bgnA           GATTVYQAAEVRLHDLQGERPYVTFERDGER-LRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGW
2bryA           LLGVEIHWGVKFTGLQPPPRKAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFTIREMRGKLITANFVNG
2c4cB           LLGVEIHWGVKFTGLQPPGWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFTIREMRGKLITANFVNG
1d7lA           CGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGW
1cc6A           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISSQSIPAERLKVFERVYPFGW
3cgvA           KAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKVIAADGFESEFGRWAGLKSVILARNDIISAL
2e4gB           -------HVEDRVEHVQRDANGNIESVRTATGRVFDADLFVDCSGFRGLLINAMEEPFLDMSDHLLNDSA
1cc4A           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGAHGISRQSIPAERLKVFERVYPFGW
1bgjA           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFRGISRQSIPAERLKVFERVYPFGW
3dmeA           DGAQ-LVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAGLARRIEGIPRDSIPPEYLCKG
1bf3A           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGW
1a0eA           --------------------------------------------------------------YDFDVATA
1cj2A           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGW
1cj3A           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGW
1bkwA           SGATTVYQAAEVRLHDLQGERPYVTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERLKVFERVYPFGW
2ardA           ------RVVDEVVDVRLNNRGYISNLLTKEGRTL-EADLFIDCSGMRGLLINQALKEPFIDMSDYLLCDS
2c4cA           ----------------------------------------------------------------------
3bhkA           -RGAKVLTHTRVEDFDISPDSVKIETAN----GSYTADKLIVSMGAWNSKLLSKLNLDIPLQPYRQVVGF
3da1A           RGAVALNYKVESFIYDQGKVVGVVAKDRLTDTHTIYAKKVVNAAGPWVDTLREKDRSKHGKYLKLSKGVH
3cuqB           ----------------------------------------------------------------------
2e4gA           ------------------------------------ADLFVDCSGFRGLLINKAMEEPFLDMSDHLLNDS
3bhfA           -RGAKVLTHTRVEDFDISPDSVKIETAN----GSYTADKLIVSMGAWNKLLSKLNLDIPLQPYRQVVGFF
3e1tA           GVDVRERHEVIDVLFEGERAVGVRYRNTEGVELMAHARFIVDASGNRTRVSQAVGERVYSRFFQNVALYG
2apgA           ---------DEVVDVRLNNRGYISNLLTKEGRTL-EADLFIDCSGMRGLLINQALKEPFIDMSDYLLCDS
3cukA           RELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESVIVNCTGVWAGALQRDPLLQPGR
3c4aA           -------ALRDKCRSQGIAIRFESPLLEHGELPLADYDLVVLANGVNHKTAHFTEALVPQVDYGRNKYIW
2bxsA           LLGDQVKLNHPVTHVDQSSDN---IIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQPISITL
1an9A           ELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRKVGADVIINCTGVWAGVLQPDPLLQPGR
1d4cC           VRGTDIRLNSRVVRILEDASGKVTGVLVKGEYYVIKADAVVIAAGGFAKNNERVSKYDNHPGATGDGLDV
1b3mA           ITVPENYNENCIRAYRELTHTRVEDFDISPDSVKIADKLIVSMGAWNSKLLSKLNLDIPQLPYRQVVGFF
3djeA           GVKFVTGTPQGRVVTLIFENNDVKGAVTADGKIWRAERTFLCAGASAGQFLDFKNQLRPTAWTLVHIALK
3eitA           PVS-LDELNQLLSKDFSKPDLLASILQIDKDPHKVDIKKLHLDGKLRFASHEYDFRQFQRN---------
1d4dA           VRGTDIRLNSRVVRILEDGKVTVLVKGEYTGYYVIKADAVVIAAGGFAKNNERVSKYDPKLKGFKATNHP
2dkiA           ----------------------------------------------------------------------
1d4cA           KRGTDIRLNSRVVRILEDASGKVLVKGEYTGYYVIKADAVVIAAGGFAKNNERVSKATNHPGATGDGLDV


                         .         .         .         +         .         .         .:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
3c96A           GVTEFDRFLDGKTMIVANDEHWSRLVAYPISARHAAEGKSLVNDGRLEDVLPFFADWDLGWFDIRDLLTR
1bgnA           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKL
2bryA           RTVEETQVPENQKFFQSLLKATGIDLENIVYYKDETHYFVMTAKKQCLLRLGVLRQDLSETDQLLGKANF
2c4cB           RTVEETQVPENQKFFQSLLKATGIDLENIVYYKDETHYFVMTAKKQCLLRLGVLRQDLSETDQLLGKAAF
1d7lA           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLSEKVEDWSDERFWTELKARLPSEVAEKL
1cc6A           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKG
3cgvA           QYRINVDVDPDYTDFYLGSIAPAGYIWVFPKGEGANVGIGSSINWIH---NRFELKNYLDRFIENHPGLK
2e4gB           VATQVPHDDDANGVEPFTSAIAMKSGWTWKIPMLGRFGTGYVYSSRFATEDEAVREFCEMWHLD-----P
1cc4A           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDELKARLPAEVAEKLVTGPS
1bgjA           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVEKVEDWSDERFWTELKARLPAEVAEKLVTG
3dmeA           SYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYDGA
1bf3A           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKL
1a0eA           YAFLKSHGLDEYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQGDLLLGWDTDQFPTNV-----
1cj2A           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKL
1cj3A           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTERLPAEVAEKLVTG
1bkwA           LGLLADTPPVSHELIYANHPRGFALCSQRSATRSRYYVQVPLTEKVEDWSDERFWTELKARLPAEVAEKL
2ardA           AVASAVPNDDARDGVEPYTSS------IAMNSGWTWKIPMLGRFGSGYVFSSHFTSRDQATADFLKLGLS
2c4cA           ---MTAKKQCLLRLGVLRQDLSETDQLLGKANVVPEALQRFARAAADFATHGKLGKLEFAQDARGRPDVA
3bhkA           FESDESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLKLGYHTFGQKIDPDTINREFGVYPEDESNLRAF
3da1A           LVVDQSRFPLRQAVYFDTESDGRIFAIPREGKTYIGTTDDIASPRTVEDRDYILAAANYFPSLRLTADDV
3cuqB           ------------------------------------------------------SEAFEDLSKLMI--KA
2e4gA           AVATQVPHDDDANGVEPFTSAIA----MKSGWTWKIPMLGRFGTGYVYSSRFATEDEAVREFCEMWHLDP
3bhfA           ESD--ESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLHTFGQKIDPDTINREFGVYPEDESNLRAFLEE
3e1tA           YFENGKRLPAPRQGNILSAAFQDGWFWYIPLSDTLTSVGAVVSREAAEAIKDGHEAALEYLAPATRVTTG
2apgA           AVASAVPNDDARDGVEPYTSSI------AMNSGWTWKIPMLGRFGSGYVFSSHFTSRDQATADFLKLWGS
3cukA           GQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPT
3c4aA           YGTSQLFDQNLVFRTHGKDIFIAHAYKYSDTSTFIVECSEETYARARLGESEEASAEYVAKVFQAELGGH
2bxsA           DDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCY
1an9A           GQIIKVDAPWLKNFIITHDLERGIYNSPYIIPGLQAVTLGGTFQVGNWNEINNIQDHNTIWEGCLKDAKI
1d4cC           ALQAGAATRDLEYIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKESAYL
1b3mA           ESD-ESKYSNDIDFPGFMVEVPNGIYYGFPSFGGCGLKHTFGQKIDPDTINREFGVYPEDESNLRLEEYM
3djeA           PEERALYKNIPVIFNIEEPDEERGEIKICDEHPGYTNVQSADGTSIPFEKTQIPKEAETRVRALLKETPQ
3eitA           ----------------------------------------------------------------------
1d4dA           GATGDGLDVALQAGAATRDLQYIQAHPTYSPAGGVVRGNGAIVVNREGNRFMNEITTRDKASAAILQQKG
2dkiA           ----------------------------------------------------------------------
1d4cA           ALQAGAATRDLEYIQAHPTYSPAGGVMITEAVRGNGAIVVNREGNRFMNEITTRDKASAAIQQKGESAYL


                         .         *         .         .         .         .         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
3c96A           NQLILQYPMVDRDPLPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELANKIILANREREKE-EWAA
1bgnA           VTLEKSIAPLTSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
2bryA           DFTSMMRAESSARVQEKHGALLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMVKRWAEGAGPLEVLAE
2c4cB           DFTSMMRAESSARVQEKHGALLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMVKRWAEGAGPLEVLAE
1d7lA           VTGPSSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
1cc6A           PSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
3cgvA           KGQDIQLVTGGVSVSKVKPITPGLLVGDAARLIDPITGGGIANAIVSGYAAQVTKEAIESND--YSPQQK
2e4gB           ETQPLNRIRFRVGRNRRAWVGNCVSIGTSSCFVEPLESTGIYFVYAALYQLVKHFP---DKSLNPVLTAR
1cc4A           --LEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
1bgjA           PSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
3dmeA           LAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESGLTASLAIAEETL--------------
1bf3A           VTLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
1a0eA           -YDTTLAMYEVIKAGGFTKGGLNFDAKVRRASYKVEDLFIGHIAGMDTFALGFKVAYKLVKDLDKFIEEK
1cj2A           VTGPSSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
1cj3A           PSLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRGE-LLER
1bkwA           VTLEKSIAPLRSFVVEPMQHGRLFLAGDAAHIVPPTGAKGLNLAASDVSTLYRLLLKAYREGRG-ELLER
2ardA           DNQPLNQIKFRVGRNKRAWVNNCVSIGLSSCFLEPLESTGIYFIYAALYQLVKHFP---DTSFDPRLSDA
2c4cA           AFDFTSMMRAESSARVQEKHGARLLVGDCLVEPFW----PLGTGVARGFLAAFDAAWMVKRWAEGAGPLE
3bhkA           LEEANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGSGHGFKFSSGVGEVLSQLALTGKTEHDISI
3da1A           ESSWGLRPLIHEDEIFFSDSGLISIAGGKLTGYRKAERTVDAVAQGLNVNEPCTTAAIRLSGGLAEGAQG
3cuqB           KEMVELSKSIANKDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEEMSLTEVYCL
2e4gA           ETQPLNRIRFRVGRNRRAWVGNCVSIGTSSCFVEPLESTGIYFVYAALYQLVKHFP---DKSLNPVLTAR
3bhfA           YMGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGSGHGFKFSSGVGEVLSQLALTGKTEHDISI
3e1tA           DYGEIRIRKDYSYCNTSFWKNGMALVGDAACFVDPVFSSGVHLATYSALLVARAINTCLAGEMSEQRCFE
2apgA           DNQPLNQIKFRVGRNKRAWVNNCVSIGLSSCFLEPLESTGIYFIYAALYQLVKHFP---DTSFDPRLSDA
3cukA           LKNRIIGERTGFRPVRPQIRLEREQLNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEE---------
3c4aA           GLVSQPGLGNFTLSHDRCHDGKLVLLGDALQSGHFSIGHGTTAVVV----AQLLVKALCTEDGVPAALKR
2bxsA           TAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGA---VEAGERAA-REVLNGLGKVTEKDIWV
1an9A           VGEYTGFRPVRPQVRLEREQLRFGSSNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEERN-------
1d4cC           VFDDSIRKSLKAIEGYVHLN--------------------------------------------------
1b3mA           PGANGELKRGAVCMYTKTLDEHFIIDLHPEHSNVVIAAGFSGHGFKFSSGVGEVLSQLALTGKTEHDISI
3djeA           LADRPFSFARICWC--ADTANREFLIDRHPQYHSLVLGCGASGGFKYLPSIGNLIVAEGKVPQKIHELIK
3eitA           ----------------------------------------------------------------------
1d4dA           ESAYLVFDDSIRKSL-------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
1d4cA           VFDDSIRKSLKAIEGYVHLNIVKEGKT-------------------------------------------


                         .         .         .         .         *         .         .:420
query           YEIERSQAADDNIRHSTRSTDFIAPHSKQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c96A           ASRPE-----------------------------------------------------------------
1bgnA           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
2bryA           RELYQSQTSPENMRYPNLNLRAVTPNQVQ-----------------------------------------
2c4cB           RELYQSQTSPENMRYPNLNLRAVTPNQVQ-----------------------------------------
1d7lA           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
1cc6A           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
3cgvA           YEKLIKERFERKHLRNWVAKEKLA----------------------------------------------
2e4gB           FNREIETMFDDTRDFIQA----------------------------------------------------
1cc4A           YSAICLRRIWKAERFSWWMTSVLHRFP-------------------------------------------
1bgjA           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
3dmeA           ----------------------------------------------------------------------
1bf3A           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
1a0eA           YRSFREGIGRDIVEGKVDFEKLEEYII-------------------------------------------
1cj2A           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
1cj3A           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
1bkwA           YSAICLRRIWKAERFSWWMTSVL-----------------------------------------------
2ardA           FNAEIVHMFDDCRDFVQAHYFTTSRD--------------------------------------------
2c4cA           VLAERSQTSPENMH--------------------------------------------------------
3bhkA           FSINR-----------------------------------------------------------------
3da1A           FPRFLDEASRKGAK--------------------------------------------------------
3cuqB           VNRARGMELLSPEDLVNACKMLEALKL-------------------------------------------
2e4gA           FNREIETMFDDTRDFI------------------------------------------------------
3bhfA           FSINR-----------------------------------------------------------------
3e1tA           EFERRYRREYGNFYQFLVAFYDMNQ---------------------------------------------
2apgA           FNAEIVHMFDDCRDFVQAHYFTTSRD--------------------------------------------
3cukA           ----------------------------------------------------------------------
3c4aA           FEERALPLVQLFRGHADNSRVWFETVE-------------------------------------------
2bxsA           QEPESKDVPAVEITHTFWERN-------------------------------------------------
1an9A           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1b3mA           FSINR-----------------------------------------------------------------
3djeA           WNPDI-----------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
1d4cA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAPAPQGVRSLRIGKDAPLRD
3c96A           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
2bryA           ----------------------------------------------------------------------
2c4cB           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------
3cgvA           ----------------------------------------------------------------------
2e4gB           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
3dmeA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
1bkwA           ----------------------------------------------------------------------
2ardA           ----------------------------------------------------------------------
2c4cA           ----------------------------------------------------------------------
3bhkA           ----------------------------------------------------------------------
3da1A           ----------------------------------------------------------------------
3cuqB           ----------------------------------------------------------------------
2e4gA           ----------------------------------------------------------------------
3bhfA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
2apgA           ----------------------------------------------------------------------
3cukA           ----------------------------------------------------------------------
3c4aA           ----------------------------------------------------------------------
2bxsA           ----------------------------------------------------------------------
1an9A           ----------------------------------------------------------------------
1d4cC           ----------------------------------------------------------------------
1b3mA           ----------------------------------------------------------------------
3djeA           ----------------------------------------------------------------------
3eitA           ----------------------------------------------------------------------
1d4dA           ----------------------------------------------------------------------
2dkiA           --------------------------------------------------PKGQLGMIDYEKVFSPDLKN
1d4cA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEGLFTKRYDATPGAAYLLRPDGYVAARFRHPTxxxxxxxxxxxxxxxxx
3c96A           --------------------------------------------------
1bgnA           --------------------------------------------------
2bryA           --------------------------------------------------
2c4cB           --------------------------------------------------
1d7lA           --------------------------------------------------
1cc6A           --------------------------------------------------
3cgvA           --------------------------------------------------
2e4gB           --------------------------------------------------
1cc4A           --------------------------------------------------
1bgjA           --------------------------------------------------
3dmeA           --------------------------------------------------
1bf3A           --------------------------------------------------
1a0eA           --------------------------------------------------
1cj2A           --------------------------------------------------
1cj3A           --------------------------------------------------
1bkwA           --------------------------------------------------
2ardA           --------------------------------------------------
2c4cA           --------------------------------------------------
3bhkA           --------------------------------------------------
3da1A           --------------------------------------------------
3cuqB           --------------------------------------------------
2e4gA           --------------------------------------------------
3bhfA           --------------------------------------------------
3e1tA           --------------------------------------------------
2apgA           --------------------------------------------------
3cukA           --------------------------------------------------
3c4aA           --------------------------------------------------
2bxsA           --------------------------------------------------
1an9A           --------------------------------------------------
1d4cC           --------------------------------------------------
1b3mA           --------------------------------------------------
3djeA           --------------------------------------------------
3eitA           --------------------------------------------------
1d4dA           --------------------------------------------------
2dkiA           AGQDIFELRDRQQGALVVVRPDQYVAQVLPLGD-----------------
1d4cA           --------------------------------------------------