[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38261.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b9jC.bssp"
#ERROR : Can't open dsspfile "3b9jK.bssp"
#ERROR : Can't open dsspfile "3bdjA.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "2ckjB.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "1dgjA.bssp"
#ERROR : Can't open dsspfile "3dsnB.bssp"
#ERROR : Can't open dsspfile "3dosB.bssp"

## Summary of PDB Search
:781
    e-177  24%  3b9jC  [x.x.x] XANTHINE OXIDASE
    e-159  24%  3b9jK  [x.x.x] XANTHINE OXIDASE
    e-144  24%  3bdjA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    e-141  23%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    e-136  22%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    e-132  23%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    e-129  23%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    e-127  23%  2ckjB  [x.x.x] XANTHINE OXIDOREDUCTASE
    e-127  23%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    e-124  23%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    e-116  23%  1dgjA  [d.15.4 - a.56.1 - d.41.1 - d.133.1] ALDEHYDE OXIDOREDUCTASE
    1e-16  12%  3dsnB  [x.x.x] F1 CAPSULE ANTIGEN
    4e-16  12%  3dosB  [x.x.x] F1 CAPSULE ANTIGEN
:781

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
3b9jC           -----VGRPLPHLAAAMQASGEAVYCDDIPRYNELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3b9jK           -----VGRPLPHLAAAMQASGEAVYCDDIPRYNELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3bdjA           ------GRPLPHLAAAMQASGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
2ckjA           -----VGRPLPHLAADMQASGEAVYCDDIPRYNELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2ckjC           -------RPLPHLAADMQASGEAVYCDDIPRYNELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2ckjD           -----VGRPLPHLAADMQASGEAVYCDDIPRYNELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2e3tB           -----VGRPLPHLAANMQASGEAVYCDDIPRYNELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAE
2ckjB           -----VGRPLPHLAADMQASGEAVYCDDIPRYNELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2e1qA           ---------LPHLAADMQASGEAVYCDDIPRYENESLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2e3tA           ---------------------------------ELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAE
1dgjA           ----------------------------------------------------------------------
3dsnB           -----IGKDSRDFDISPKVNGENLVGDDVVLAGSQDFFVRSIGSKGGKLAKYTDAVTVTVS---------
3dosB           -----IGKDSRDFDISPKVNGENLVGDDVVLAGSQDFFVRSIGSKGGKLAKYTDAVTVTVS---------


                         .         .         *         .         .         .         .:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDXXXXXXXXXXXXX
3b9jC           DIPGSNETGLFND---------------ETVFAKDTVTCVGHIIGAVVADTPEHAERAAHVVKVTYEDLP
3b9jK           DIPGSNETGLFND---------------ETVFAKDTVTCVGHIIGAVVADTPEHAERAAHVVKVTYEDLP
3bdjA           DIPGSNETGLFNDETV---------------FAKDTVTCVGHIIGAVVADTPEHAERAAHVVKVTYEDLP
2ckjA           DVPGSNITGICND---------------ETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELP
2ckjC           DVPGS---------------NITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELP
2ckjD           DVPG---------------SNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQR-------AAQGVK
2e3tB           DVPNSNATGLFNDE---------------TVFAKDEVTCVGHIIGAVVADTPEHAQRAARGVKITYEDLP
2ckjB           DVPGSNITGI---------------CNDETVFAKDKVTCVGHIIGAVVADTPEHTQR-------AAQGVK
2e1qA           DVPGSNIT---------------GICNDETVFAKDKVTCVGHIIGAVVADTPEHTQR-------AAQGVK
2e3tA           DVPNSNATGLFNDE---------------TVFAKDEVTCVGHIIGAVVADTPEHAQRAARGVKITYEDLP
1dgjA           ----------------------------------------------------------------------
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXQLHPEAPGNIVYDWEIGDQKAVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
3b9jC           AIITIEDA-------IKNNSFYGSELKIEKGD---LKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3b9jK           AIITIEDA-------IKNNSFYGSELKIEKGD---LKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3bdjA           AIITIEDA-------IKNNSFYGSELKIEKGD---LKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
2ckjA           AIITIEDA-------IKNNSFYGPELKIEKGD---LKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2ckjC           AIITIEDAIKNNSFYGPE-------LKIEKGD---LKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2ckjD           ITYEELPAIITIEDAIKNNSFYGPELKIEKGD---LKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2e3tB           AIITIQD-------AINNNSFYGSEIKIEKGD---LKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVP
2ckjB           ITYEELPAIITIEDAIKNNSFYGPELKIEKGD---LKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2e1qA           ITYEELPAIITIEDAIKNNSFYGPELKIEKGD---LKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2e3tA           AIITIQDA-------INNNSFYGSEIKIEKGD---LKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVP
1dgjA           ---------------IHPGTPNVYYDQLEEKGEDTVPFFNDPANVVAEGSYYTQRQPHLPIEPDVGYGYI
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
3b9jC           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKERSTLVSVAVALAAYKTGHPV
3b9jK           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKERSTLVSVAVALAAYKTGHPV
3bdjA           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKERSTLVSVAVALAAYKTGHPV
2ckjA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGK--ETRSTVVSTLAAYKTGRPV
2ckjC           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKE--TRSTVVSTLAAYKTGRPV
2ckjD           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGK--ETRSTVVSTLAAYKTGRPV
2e3tB           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PDNRIVVRVKRMGGGFGGKETRTVVSTALALAAHKTGRPV
2ckjB           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGK--ETRSTVVSTLAAYKTGRPV
2e1qA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKVTTVVSTAVAL-AAYKTGRPV
2e3tA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PDNRIVVRVKRMGGGFGGKETRTVVSTALALAAHKTGRPV
1dgjA           N-EQGQVVIHSKSVAIHLHALMIAPGLGLEFPKDLVLVQNTTGGTFGYKFSPTME-ALVGVAVMATGRPC
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
3b9jC           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMER--ALFHMDNCYKI
3b9jK           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMER--ALFHMDNCYKI
3bdjA           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERA--LFHMDNCYKI
2ckjA           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMER--ALFHMDNCYKI
2ckjC           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
2ckjD           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMER--ALFHMDNCYKI
2e3tB           RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERA--LFHMDNAYKI
2ckjB           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMER--ALFHMDNCYKI
2e1qA           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
2e3tA           RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMER--ALFHMDNAYKI
1dgjA           HLRYNYEQQQNYTGKRSPFWTTMRYAADRQGKILAMETDWSVDHGPYSEF--GDLLTLRGAQYIGAGYGI
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
3b9jC           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGDL-THFNQRLE
3b9jK           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGDL-THFNQRLE
3bdjA           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGDL-THFNQRLE
2ckjA           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKE-GDLTHFNQKLE
2ckjC           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKE-GDLTHFNQKLE
2ckjD           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKE-GDLTHFNQKLE
2e3tB           PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGLPAEEVRRKNMYKEGD-LTHFNQKLE
2ckjB           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKE-GDLTHFNQKLE
2e1qA           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKE-GDLTHFNQKLE
2e3tA           PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGLPAEEVRRKNMYKEGDL-THFNQKLE
1dgjA           ANIRGTGRTVATNHCWGAAFRGYGAPESEFPSEVLMDELAEKLGMDPFELRALNCYREGDT-TSSGQIPE
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGDFGASLDAALKAADYSXXXXXXXXXXXXXXXXXXXFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
3b9jC           GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISF-------TVPFLNQAGALIHV
3b9jK           GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISF-------TVPFLNQAGALIHV
3bdjA           GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISFT-------VPFLNQAGALIHV
2ckjA           GFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISF-------TVPFLNQAGALLHV
2ckjC           GFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISF-------TVPFLNQAGALLHV
2ckjD           GFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISF-------TVPFLNQAGALLHV
2e3tB           GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGISF-------TLPFLNQGGALVHV
2ckjB           GFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFT-------VPFLNQAGALLHV
2e1qA           GFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISF-------TVPFLNQAGALLHV
2e3tA           GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGISF-------TLPFLNQGGALVHV
1dgjA           VMSLPEMFDKMRPYYEESKKRVKERST---------------AEIKRGVGVALGVYGAGLPDTSEAWVEL
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFXX
3b9jC           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAASVSTDIYGQAVYEA
3b9jK           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAASVSTDIYGQAVYEA
3bdjA           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAASVSTDIYGQAVYEA
2ckjA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAA
2ckjC           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAA
2ckjD           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAA
2e3tB           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISETSTNTVPNTSPTAASASADLNGQGVYEA
2ckjB           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAA
2e1qA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAASVSADLNGQAVYAA
2e3tA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISETSTNTVPNTSPTAASASADLNGQGVYEA
1dgjA           NDDGSVTLGNSWEDHGQGADAGSLGTAHRPLGITPENIHLVMNDTSKTPNSGPAGGSRSQVVTGNAIRVA
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
3b9jC           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLS---------TTGFYRTPNLGYSFETNSGNAFHY--
3b9jK           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTT---------GFYRTPNLGYSFETNSGNAFHY--
3bdjA           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTT---------GFYRTPNLGYSFETNSGNAFHY--
2ckjA           CQTILKRLEPYKKKNPSGSWEDWVTAAYMDT------------VSLSATGFYRTPNLGYS--FETNSGNP
2ckjC           CQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFY---------------RTPNLGYSFETNSGN
2ckjD           CQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSAT---------GFYRTPNLGYSFE------TNSGN
2e3tB           CQTILKRLEPFKKKKPTGPWEAWVMDAYTSAVSLSATGFY---------------KTPNLGYSFETNSGN
2ckjB           CQTILKRLEPYKKKNPSGSWEDWVTAAYMDT------------VSLSATGFYRTPN--LGYSFETNSGNP
2e1qA           CQTILKRLEPYKKKNPSGSWEDWVTAAYMDT------------VSLSATGFYR---TPNLGYSFETNSGN
2e3tA           CQTILKRLEPFKKKKPTGPWEAWVMDAYTSAVSLSATGFY---------------KTPNLGYSFETNSGN
1dgjA           CEMLIEGMRKPGGGFFTPAEMKAEGRPMRYDG----------------------KWTAPAKDCDAKGQGS
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
3b9jC           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3b9jK           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3bdjA           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjA           FHY-FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjC           PFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjD           PFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2e3tB           PFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
2ckjB           FHY-FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2e1qA           PFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2e3tA           PFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
1dgjA           PFACYMYGLFLTEVAVEVATGKATVEKMVCVADIGKICNKLVVDGQIYGGLAQGVGLALSE----DYEDL
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           LVTASFMDYAMPRADDVPSFKVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATP
3b9jC           LHTRGPSTYKIPAFGSIPTEFRVSRDCPNKKAIYASKAVGEPPLFLGASAIKDAIRAARAQHRLDSPATP
3b9jK           LHTRGPSTYKIPAFGSIPTEFRVLRDCPNKKAIYASKAVGEPPLFLGAFAIKDAIRAARAQHRLDSPATP
3bdjA           LHTRGPSTYKIPAFGSIPTEFRVSRDCPNKKAIYASKAVGEPPLFLGASAIKDAIRAARAQHRLDSPATP
2ckjA           LHTRGPSTYKIPAFGSIPIEFRVSRDCPNKKAIYASKAVGEPPLFAIKDAIRAARAQHTGNNRLDSPATP
2ckjC           LHTRGPSTYKIPAFGSIPIEFRVSRDCPNKKAIYASKAVGEPPLFAIKDAIRAARAQHTGNNRLDSPATP
2ckjD           LHTRGPSTYKIPAFGSIPIEFRVSRDCPNKKAIYASKAVGEPPLFAIKDAIRAARAQHTGNNRLDSPATP
2e3tB           LHTRGPSTYKIPAFGSIPIEFRVLRDCPNKRAIYASKAVGEPPLFLASSAIKDAIRAARAQHQLDSPATP
2ckjB           LHTRGPSTYKIPAFGSIPIEFRVSRDCPNKKAIYASKAVGEPPLFAIKDAIRAARAQHTGNNRLDSPATP
2e1qA           LHTRGPSTYKIPAFGSIPIEFRVSRDCPNKKAIYASKAVGEPPLFAIKDAIRAARAQHTGNNRLDSPATP
2e3tA           LHTRGPSTYKIPAFGSIPIEFRVSRDCPNKRAIYASKAVGEPPLFLASSAIKDAIRAARAQHQLDSPATP
1dgjA           KKHSTMGGAGIPSIKMIPDIEIVYVETPRKDGPFGASGVGEMPLTAPHAAIINGIYNACGARVRHLPARP
3dsnB           ----------------------------------------------------------------------
3dosB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           DRVWHAIHGNx
3b9jC           EKIRNACV---
3b9jK           EKIRNACV---
3bdjA           EKIRNACVDK-
2ckjA           EKIRNACV---
2ckjC           EKIRNACVD--
2ckjD           EKIRNAC----
2e3tB           EKIRNACV---
2ckjB           EKIRNAC----
2e1qA           EKIRNACV---
2e3tA           EKIRNACV---
1dgjA           EKVLEAM----
3dsnB           -----------
3dosB           -----------