[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "3e02A.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3cddB.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "3dofB.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"

## Summary of PDB Search
:539
    6e-37   8%  3cmvG  [x.x.x] PROTEIN RECA
    5e-34   8%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-33  10%  3cmvH  [x.x.x] PROTEIN RECA
    5e-32  19%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-31   7%  2bifA  [c.37.1 - c.60.1] PROTEIN
    4e-31   7%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    4e-31   7%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    7e-30  10%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    1e-28  25%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-28   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-28  12%  1aroP  [e.8.1] T7 RNA POLYMERASE
    3e-28   9%  3cmvC  [x.x.x] PROTEIN RECA
    1e-27  22%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    2e-27  12%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    3e-27   8%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    5e-27  18%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-27  11%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    9e-27  11%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-26   8%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-26  12%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    4e-26   6%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    5e-26   8%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    9e-26  10%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    1e-25   7%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-25  13%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    4e-24  10%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    4e-24   8%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    7e-24  13%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    8e-24  18%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    8e-24  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    1e-23  12%  3cmvA  [x.x.x] PROTEIN RECA
    1e-23   9%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    1e-23  10%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-23  10%  3cmxA  [x.x.x] PROTEIN RECA
    1e-23  10%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-23  15%  2akaB  [x.x.x] DYNAMIN-1
    2e-23   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    3e-23  14%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-23  16%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    6e-23  32%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-23   6%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-22   8%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-22  12%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    5e-22  13%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    6e-22  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    6e-22   9%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    7e-22  12%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    2e-21  11%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    3e-21  10%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-21   7%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    4e-21  11%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-21  11%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    4e-21   6%  2ctsA  [x.x.x] CITRATE SYNTHASE
    4e-21  11%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    5e-21  10%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    6e-21   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-21  10%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    1e-20  10%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-20  11%  2bdtA  [x.x.x] BH3686
    1e-20  10%  2cgtH  [x.x.x] 60 KDA GROEL
    2e-20   8%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    2e-20  11%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    4e-20  10%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    5e-20   8%  1e0jB  [c.37.1] DNA HELICASE
    5e-20   7%  4dcgA  [x.x.x] VP39
    7e-20  10%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-20  10%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    1e-19  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    1e-19   7%  2b8tC  [x.x.x] THYMIDINE KINASE
    2e-19  11%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    2e-19  11%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-19  10%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-19   9%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    5e-19   9%  1e0jA  [c.37.1] DNA HELICASE
    6e-19   7%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-19  13%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    1e-18  13%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    1e-18  10%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  10%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-18   8%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-18  10%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    2e-18  17%  3c8uA  [x.x.x] FRUCTOKINASE
    4e-18  12%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    6e-18  13%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-18  10%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-18  13%  421pA  [x.x.x] H-RAS P21 PROTEIN
    1e-17  14%  2axzC  [x.x.x] PRGX
    1e-17  13%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    1e-17   8%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-17   4%  1adoA  [c.1.10] ALDOLASE
    1e-17   7%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    1e-17   4%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-17   8%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-17   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-17  12%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    2e-17   7%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-17  19%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-17   9%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    2e-17  20%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-17  10%  2bx2L  [x.x.x] RIBONUCLEASE E
    3e-17   9%  3adkA  [x.x.x] ADENYLATE KINASE
    3e-17  11%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    4e-17  12%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-17   7%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    4e-17  10%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    5e-17   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    5e-17  13%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-17   9%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    6e-17   8%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-17   9%  2cckB  [x.x.x] THYMIDYLATE KINASE
    7e-17  11%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    8e-17  11%  3cmwC  [x.x.x] PROTEIN RECA
    1e-16  10%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-16   5%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-16  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    1e-16  10%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-16   5%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-16  11%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-16  12%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-16  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    3e-16   8%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-16  11%  3cmtD  [x.x.x] PROTEIN RECA
    3e-16  10%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    4e-16  12%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-16   8%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-16  12%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-16   5%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-16  16%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-16  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    5e-16  11%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    6e-16   5%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-16  11%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-16  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    7e-16  25%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-16  10%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    8e-16  10%  3da4A  [x.x.x] COLICIN-M
    8e-16  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    9e-16   8%  3cmvE  [x.x.x] PROTEIN RECA
    9e-16   5%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15  10%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-15  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-15  10%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-15   4%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-15   9%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    1e-15  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-15  18%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-15   5%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-15  11%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    3e-15  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-15   9%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    4e-15   5%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-15  17%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-15   4%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-15   5%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-15  12%  2c0bL  [x.x.x] RIBONUCLEASE E
    5e-15  25%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-15  22%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-15  13%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    7e-15   7%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    7e-15  12%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    8e-15  16%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    8e-15  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    9e-15  14%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-14   5%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-14  25%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-14  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-14  11%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    1e-14  10%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    1e-14   9%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    2e-14  13%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-14  10%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    2e-14   9%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-14   9%  3bczC  [x.x.x] PROTEIN MEMO1
    3e-14   7%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-14   6%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    3e-14  15%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-14   9%  2c4rL  [x.x.x] RIBONUCLEASE E
    3e-14   9%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    4e-14  15%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    4e-14  11%  2c9oC  [x.x.x] RUVB-LIKE 1
    5e-14  14%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    5e-14   8%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    7e-14  11%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    7e-14   9%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    7e-14  13%  3be4A  [x.x.x] ADENYLATE KINASE
    8e-14   4%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-14  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    9e-14  11%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    1e-13  10%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-13   7%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    1e-13   7%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-13   4%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    1e-13   7%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-13  20%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    2e-13   8%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    2e-13   9%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    2e-13  14%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-13   9%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-13  12%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    2e-13  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-13   9%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    3e-13  13%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    3e-13  17%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-13  12%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-13   7%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    4e-13  11%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-13  10%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-13  21%  2d2eA  [x.x.x] SUFC PROTEIN
    4e-13  10%  2bhvA  [x.x.x] COMB10
    5e-13  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    5e-13  21%  2d2fA  [x.x.x] SUFC PROTEIN
    5e-13  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    6e-13  10%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    7e-13  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    7e-13   9%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    8e-13  10%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-12  13%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-12  10%  2an9A  [x.x.x] GUANYLATE KINASE
    1e-12   8%  2bhvD  [x.x.x] COMB10
    1e-12  11%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    1e-12   9%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-12  11%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-12  13%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-12  26%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-12  12%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-12  13%  3a00A  [x.x.x] GUANYLATE KINASE
    3e-12  15%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-12   9%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    3e-12  12%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    4e-12  11%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-12  10%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    4e-12  11%  3ec1A  [x.x.x] YQEH GTPASE
    5e-12  12%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    5e-12   7%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    6e-12  12%  2a1fE  [x.x.x] URIDYLATE KINASE
    6e-12  10%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-12  14%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    1e-11   6%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    1e-11  10%  3cmvB  [x.x.x] PROTEIN RECA
    1e-11   9%  2anbA  [x.x.x] GUANYLATE KINASE
    1e-11  10%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-11  10%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    2e-11  12%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-11  10%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    3e-11   8%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    3e-11  10%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-11  11%  3dlbB  [x.x.x] ARGONAUTE
    3e-11  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    4e-11  15%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-11  11%  3cmuA  [x.x.x] PROTEIN RECA
    4e-11  10%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-11  11%  2a1fD  [x.x.x] URIDYLATE KINASE
    8e-11  12%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-11   7%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-11  29%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-10  32%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    1e-10   4%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-10   9%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    2e-10  15%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-10  11%  1e2iB  [c.37.1] THYMIDINE KINASE
    3e-10  15%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    3e-10  10%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    3e-10   9%  2c9gA  [x.x.x] PENTON PROTEIN
    4e-10  10%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-10  12%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-10  20%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-10  14%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    6e-10   7%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    6e-10  16%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-10   8%  2b8tD  [x.x.x] THYMIDINE KINASE
    7e-10   7%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    8e-10  13%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    8e-10  16%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-09  10%  2ancB  [x.x.x] GUANYLATE KINASE
    2e-09  17%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    3e-09  12%  3bm2B  [x.x.x] PROTEIN YDJA
    3e-09   8%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-09  11%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    3e-09  10%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    3e-09  17%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    4e-09  12%  2dftA  [x.x.x] SHIKIMATE KINASE
    5e-09  16%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-09  10%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-09  11%  2dftC  [x.x.x] SHIKIMATE KINASE
    7e-09  10%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    7e-09  11%  1e2iA  [c.37.1] THYMIDINE KINASE
    9e-09  11%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-09  33%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    1e-08  16%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    1e-08  12%  1e2mB  [c.37.1] THYMIDINE KINASE
    1e-08  30%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    1e-08  10%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    1e-08   7%  1eamA  [c.66.1] PROTEIN (VP39)
    1e-08  13%  3a00B  [x.x.x] GUANYLATE KINASE
    1e-08   7%  3dfdA  [x.x.x] PROTEIN YQBN
    2e-08   8%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-08  12%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    2e-08  11%  1e2nB  [c.37.1] THYMIDINE KINASE
    3e-08   8%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    3e-08   7%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    3e-08  10%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-08  11%  1e2nA  [c.37.1] THYMIDINE KINASE
    5e-08  11%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    5e-08  10%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    5e-08  18%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-08  12%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    7e-08   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    9e-08  12%  2a1fC  [x.x.x] URIDYLATE KINASE
    1e-07   6%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    1e-07   7%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-07  11%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-07  13%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    1e-07  12%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-07   5%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    2e-07  12%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    3e-07  24%  2ancD  [x.x.x] GUANYLATE KINASE
    3e-07  14%  1chdA  [x.x.x] CHEB METHYLESTERASE
    3e-07  12%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    3e-07  31%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    3e-07  15%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    4e-07  19%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-07   9%  2c5mD  [x.x.x] CTP SYNTHASE
    5e-07  12%  1e2hB  [c.37.1] THYMIDINE KINASE
    7e-07  14%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-06  10%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-06  10%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-06  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    2e-06  10%  1e2lA  [c.37.1] THYMIDINE KINASE
    2e-06  33%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-06  12%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    5e-06  15%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-06  29%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-06  12%  1e2lB  [c.37.1] THYMIDINE KINASE
    9e-06  11%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-05  19%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-05   9%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-05   8%  3e02A  [x.x.x] UNCHARACTERIZED PROTEIN DUF849
    2e-05  15%  2cdnA  [x.x.x] ADENYLATE KINASE
    2e-05  20%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    3e-05   9%  1e2mA  [c.37.1] THYMIDINE KINASE
    3e-05  13%  2bhvC  [x.x.x] COMB10
    3e-05  12%  1e2jB  [c.37.1] THYMIDINE KINASE
    4e-05  17%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    5e-05  12%  3dkvA  [x.x.x] ADENYLATE KINASE
    7e-05  10%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    1e-04  15%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-04  17%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    2e-04  10%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-04  17%  3cddB  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-04   5%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    4e-04  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    8e-04  12%  1e2hA  [c.37.1] THYMIDINE KINASE
    8e-04   6%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    0.001  13%  3dofB  [x.x.x] ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 2-BINDING
    3e-06  14%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC(query 281->505)
    5e-07   5%  2bifA  [c.37.1 - c.60.1] PROTEIN(query 421->504)
    4e-05   5%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/(query 421->505)
    6e-08   6%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 279->502)
    3e-04  14%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I(query 324->449)
    1e-06  17%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING(query 339->505)
    1e-11   5%  1aroP  [e.8.1] T7 RNA POLYMERASE(query 407->505)
    4e-06   5%  2ccjB  [x.x.x] THYMIDYLATE KINASE(query 339->505)
    2e-06   6%  2ccgB  [x.x.x] THYMIDYLATE KINASE(query 324->505)
    3e-06   6%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR(query 412->505)
    4e-05   5%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE(query 422->504)
    9e-09   6%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-(query 321->507)
    1e-05   1%  1e9fA  [c.37.1] THYMIDYLATE KINASE(query 425->504)
    6e-06   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 419->502)
    1e-06   6%  2ccgA  [x.x.x] THYMIDYLATE KINASE(query 421->505)
    2e-04   8%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3(query 298->497)
    4e-05   7%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE(query 477->505)
    4e-04   1%  1e98A  [c.37.1] THYMIDYLATE KINASE(query 421->505)
    1e-04  10%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284(query 428->505)
    6e-04  10%  2b8tA  [x.x.x] THYMIDINE KINASE(query 339->505)
    5e-05   9%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284(query 429->505)
    8e-05   8%  2akaB  [x.x.x] DYNAMIN-1(query 339->505)
    1e-05   1%  1e9cA  [c.37.1] THYMIDYLATE KINASE(query 412->505)
    3e-04  24%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 421->505)
    2e-04   7%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE(query 477->505)
    3e-04  15%  2cckA  [x.x.x] THYMIDYLATE KINASE(query 479->505)
    1e-05   8%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN(query 421->504)
    6e-07   9%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 398->505)
    2e-06   8%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 334->505)
    3e-05   7%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE(query 477->505)
    5e-04   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR(query 324->505)
    2e-04  11%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 479->505)
    1e-04  14%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT(query 477->505)
    6e-05   8%  2axzC  [x.x.x] PRGX(query 428->505)
    3e-07   9%  1adoA  [c.1.10] ALDOLASE(query 425->505)
    2e-05  12%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE(query 397->505)
    1e-05   9%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    4e-07  12%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 399->505)
    3e-05  11%  2bx2L  [x.x.x] RIBONUCLEASE E(query 422->505)
    4e-04  12%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 480->505)
    7e-04  15%  2cckB  [x.x.x] THYMIDYLATE KINASE(query 476->501)
    2e-04  14%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE(query 477->505)
    1e-05   9%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    1e-05   9%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    3e-04  17%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE(query 477->505)
    1e-06  10%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 406->505)
    8e-07  10%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE(query 405->505)
    8e-05   9%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    1e-04  30%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE(query 476->505)
    8e-05   9%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    1e-05  31%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 477->505)
    1e-05   9%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    2e-04   9%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    2e-04   0%  1e2gA  [c.37.1] THYMIDYLATE KINASE(query 480->505)
    6e-04   9%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    1e-04   9%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    9e-05   9%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    2e-04   9%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    2e-04  31%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 477->505)
    4e-05   9%  1aldA  [c.1.10 (2aldA)] ALDOLASE A(query 425->505)
    1e-05   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE(query 421->505)
    7e-04   6%  3be4A  [x.x.x] ADENYLATE KINASE(query 426->505)
    2e-05   9%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 425->505)
    7e-05   9%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE(query 425->505)
    7e-05  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN(query 422->505)
    8e-04   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE(query 419->505)
    2e-04  11%  2ccjA  [x.x.x] THYMIDYLATE KINASE(query 477->519)
    1e-04   8%  2a1fF  [x.x.x] URIDYLATE KINASE(query 429->504)
    3e-05  11%  2a1fE  [x.x.x] URIDYLATE KINASE(query 435->505)
    9e-04  11%  2a1fD  [x.x.x] URIDYLATE KINASE(query 435->505)
    1e-05  10%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE(query 428->505)
    7e-05   9%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A(query 428->505)
    4e-04  19%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA(query 477->505)
:539

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFQGLGLTKRYGDFTANSAIDIAIAPGQIHALLGENGAG
3cmvG           ------------------------------------DVETISTGSLDIALGAGGLPMGRIVEIYGPESSG
3dmdC           --------------------------------KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSG
3cmvH           ------------------------------------DVETISTGSLSLDIALGGLPMGRIVEIYGPESSG
2d3wB           ------------------------------------DLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2bifA           -----------------------------------------------------------LIVMVGLPARG
1bifA           ---------------------------------------------------------PTLIVMVGLPARG
2dwoA           ------------------------------------KIWVPVDHRPSLP-RSCGPNSPTVIVMVGLPARG
3c95A           ---------------------------------------IMVDLAGDISPLLELDSDTLRAVPVKLVHIN
3b5jA           ------------------------------------NIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSG
2c61B           -------------------------------------PKDFIQTGISTIDGTNTLVRGQKLPIFSASGLP
1aroP           ----------------------------------------------------------------------
3cmvC           -------------------------------------VETISTGSLDIALGAGGLPMGRIVEIYGPESSG
3b60A           --------------------------------FRNVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSG
2ccjB           -----------------------------------------------------------FITFEGPEGSG
1d1cA           -------------------------------------APHIFAISDVAYRSMLDDRQNQSLLITGESGAG
2bbsA           ------------------------------------ELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAG
2c03B           ------------------------------------TVYEALKEALGGEARLPVLKDRNLWFLVGLQGSG
2ccgB           ---------------------------------------------------------SAFITFEGPEGSG
3dmdB           --------------------------------KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSG
2a2zD           ---------------------------------------------------------IKKISIEGNIAAG
3eiuB           -------------------------------------PKDFIQTGISTIDGTNTLVRGQKLPIFSASGLP
2dwpA           --------------------------------------------------IWVPVDHRNVIVMVGLPARG
1e9fA           --------------------------------------------------------RGALIVLEGVDGAG
3eiuA           -------------------------------------PKDFIQTGISTIDGTNTLVRGQKLPIFSASGLP
2ccgA           -----------------------------------------------------------FITFEGPEGSG
1bg0A           -------------------------------VFDSIKNKKTGMGATLLDVIQSGVELDSGVGIYAPDAES
2czvA           --------------------------------------------------IEMDIRDKEAYELAKEWFDE
2a30D           ---------------------------------------------------------IKKISIEGNIAAG
2d62A           ------------------------------------NIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCG
1e98A           --------------------------------------------------------RGALIVLEGVDRAG
3cmvA           ------------------------------------TISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSG
2dr3A           ----------------------------------------KTGIPGVDEILHGGIPERNVVLLSGGPGTG
2b8tA           ---------------------------------------------------------GWIEFITGPMFAG
3cmxA           ------------------------------------------------------LPMGRIVEIYGPESSG
2dr3B           --------------------------------------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTG
2akaB           -------------------------------------LVNRLQDAFSAIGQNA-DLDLPQIAVVGGQSAG
1e9cA           --------------------------------------------------------RGALIVLEGVDRAG
1e69A           ----------------------------------------YLKGFKSFGRPSLIGFSDRVTAIVGPNGSG
2d4uB           ----------------------------------------------------------------------
2awnC           --------------------------------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCG
3b2qA           --------------------------------YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLP
3czpB           -------------------------------------LAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAG
2a5gA           ---------------------------------------------------------EMRILMLGLDAAG
2a30B           ---------------------------------------------------------IKKISIEGNIAAG
2cckA           -----------------------------------------------------------FITFEGPEGSG
3dm5A           --------------------------------IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSG
1cr4A           ------------------------------------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
2cjwB           --------------------------------------------------------TYYRVVLIGEQGVG
2b8wA           ------------------------------------NTNGRLMANPALKILSAITQPMVVVAIVGLYRTG
3b2qB           ------------------------------------PPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLP
2c03A           ------------------------------------TVYEALKEALGGEARLPVLKDRNLWFLVGLQGSG
2axpA           -----------------------------------------------------------LIILEGPDCCF
2ctsA           --------------------------------------ASSTNLKDILADLIEQARIKTFRQQHGNTAVG
2c9yA           ---------------------------------------------------------GIRAVLLGPPGAG
3a1wA           -------------------------------------------------------------ALAGCPNVG
2d0kA           ----------------------------------------------------------------------
1e2dA           --------------------------------------------------------RGALIVLEGVDRAG
3dtbB           --------------------------------------------LHNGLDFSAKVIQGSLDSL---PQEV
2bdtA           -----------------------------------------------------------LYIITGPAGVG
2cgtH           ----------------------------------------------------------------------
3b85A           -----------------------------------------RPKTLGQKHYVDAIDTNTIVFGLGPAGSG
2c04A           ------------------------------------TVYEALKEALGGEARLPVLKDRNLWFLVGLQGSG
1e9dA           --------------------------------------------------------RGALIVLEGVDRAG
1e0jB           ------------------------------------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
4dcgA           --------------------------------------------FFLSKLQRHG---ILDGATVVYIGSA
1e9rA           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
2dr3E           --------------------------------------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTG
2b8tB           ---------------------------------------------------------GWIEFITGPMFAG
2b8tC           ---------------------------------------------------------GWIEFITGPMFAG
2d4uA           --------------------------------------------------------------PLGSGGLF
1e3mB           ----------------------------------------------------------------------
1e9sD           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
1e2fA           --------------------------------------------------------RGALIVLEGVDRAG
1e0jA           ------------------------------------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
1e9sG           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
2a2zB           ---------------------------------------------------------IKKISIEGNIAAG
2a30A           ---------------------------------------------------------IKKISIEGNIAAG
1e9sF           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
1e3mA           -------------------------------------------------------------------LVN
1dhiA           ----------------------------------------------------------------------
1e3aB           --------------------------------QMKAKNWQEWTQQAAKQALTINWYYADVNGNIGYVHTG
3c8uA           --------------------------------------TLAALCQGVLERLDPRQPGRQLVALSGAPGSG
2bv7A           ---------------------------------------------------DISGNITKIKAVYDTNPTK
2bc9A           ------------------------------------NTNGRLMANPALKILSAITQPMVVVAIVGLYRTG
1e9rE           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
421pA           -------------------------------------------------------------VVVGARGVG
2axzC           ----------------------------------------------------------------------
1cr1A           -------------------------------LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
1draA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2c61A           ------------------------------------PPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLP
1cr2A           ------------------------------------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
3czpA           ---------------------------------------AEQARLAGLIRDKRFRQHSLVAVFEGNDAAG
2d3wA           ------------------------------------DLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
3bo6B           ------------------------------------NQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQG
2bbsB           ------------------------------------VVMENVTAFWVLKDINFKIERGQLLAVAGSTGAG
2bx2L           ----------------------------------------------------------------------
3adkA           --------------------------------------------------MEEKLKKSKIIFVVGGPGSG
3d7wA           ------------------------------------SGSFSNN-IPLLRQSTVPVSEGQRFVLVELTNAG
3dt2A           -----------------------------------------LAEHMLILGITNPEGKKKYLAAAFPSACG
2akaA           --------------------------------------PHIFAISDVAYRSMLDDRQNQSLLITGESGAG
3ch4B           ------------------------------------------------SMAPLGGAPRLVLLFSGKRKSG
3bh0A           ------------------------------------NITGVPSGFTELDRMTYGYKRRNFVLIAARPSMG
2awnD           ------------------------------------NVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2dr3D           --------------------------------------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTG
2drcA           ----------------------------------------------------------------------
2cckB           -----------------------------------------------------------FITFEGPEGSG
1ai4B           ----------------------------------------------AKQALTINWYYADVNGNIGYVHTG
3cmwC           ------------------------------------TISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSG
3dt7A           -------------------------------------RLAKEAEHMLILGITNPEGKKKYLAAAFPSACG
3dfnC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------EPIFMVGARGCG
2a5jA           -------------------------------------------------------------IIIGDTGVG
3dfnA           ----------------------------------------------------------------------
3bgwA           -------------------------------------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMG
3bb1B           -------------------------------------FAPATQTKLLEGNLKQEDVNSLTILVMGKGGVG
1d6jB           -----------------------------------------ASALTRSERTELRNQRGLTIWLTGLSASG
1dyhA           ----------------------------------------------------------------------
3cmtD           ------------------------------------------------------LPMGRIVEIYGPESSG
2ausC           ----------------------------------------------------------------------
3dt4A           ------------------------------------SRLAKEAEHMLILGITNPEGKKKYLAAAFPSACG
4dfrA           ----------------------------------------------------------------------
2d4hA           ------------------------------------NTNGRLMAPEALKILSAITQPMVVVAIVGLYRTG
3dfoD           ----------------------------------------------------------------------
3cr7D           --------------------------------------------------------RGLTIWLTGLSASG
1cr0A           -------------------------------LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMG
3clvA           ------------------------------------------------------KKSSYKTVLLGESSVG
3dfpD           ----------------------------------------------------------------------
1e9sJ           ------------------------------------RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTG
2a2zA           ---------------------------------------------------------IKKISIEGNIAAG
2awnB           ------------------------------------NVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
3bpbA           -------------------------------------PARSLVDGLTSSHPDYAKALEQHNAYIRALQTC
3da4A           ------------------------------------GISVYDAYHFA---KPAPSQYDYRSMNMKQMSGN
3d3kA           ----------------------------------------------LSVAEKHGLTLERRLEMTGVCASQ
3cmvE           ------------------------------------------------------LPMGRIVEIYGPESSG
3dfqA           ----------------------------------------------------------------------
2b92B           ------------------------------------NTNGRLMANPALKILSAITQPMVVVAIVGLYRTG
3d3qA           ---------------------------------------------------------PFLIVIVGPTASG
3bgwD           ---------------------------------------GVPSGFTELDRMTYGYKRRNFVLIAARPSMG
3dfnD           ----------------------------------------------------------------------
1e2gA           --------------------------------------------------------RGALIVLEGVDRAG
1d6jA           -----------------------------------------ASALTRSERTELRNQRGLTIWLTGLSASG
2d3wD           ------------------------------------DLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
3dftD           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3dt4C           ------------------------------------SRLAKEAEHMLILGITNPEGKKKYLAAAFPSACG
2bkhA           --------------------------------SLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAG
3dfqD           ----------------------------------------------------------------------
2bbtB           ------------------------------------KAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAG
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2awoC           --------------------------------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCG
2awnA           ------------------------------------NVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
3ecpA           ----------------------------------------------------------------------
1dkiA           ------------------------------------GIHYNQGNYNLLTPVIEKVKPGEQSGQHAATGSV
3cr7A           ---------------------------------------------------------GLTIWLTGLSASG
2aunB           ----------------------------------------------------------------------
2dr3F           ---------------------------------------RRVGIPGVDEILHGGIPERNVVLLSGGPGTG
3cr7C           --------------------------------------------------------RGLTIWLTGLSASG
1aldA           ----------------------------------------------------------------------
1b0uA           ------------------------------------DLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSG
1e9rD           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
2bwjA           --------------------------------------------------FMEDLRKCKIIFIIGGPGSG
3dymA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2dflA           --------------------------------ERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSG
1e4yA           -----------------------------------------------------------RIILLGALVAG
3bczC           ------------------------------------------------------AGSWYTASGPQLNAQL
3cddF           --------------------------------------------------RDKTADLVDCSIDYPSGQFN
2bhjA           ----------------------------------------------------------------------
3cm0A           ---------------------------------------------------------GQAVIFLGPPGAG
2c4rL           ----------------------------------------------------------------------
1av6A           ------------------------------------------------------RHGILDGATVVYIGSA
2aunA           ----------------------------------------------------------------------
2c9oC           --------------------------------------------------IKSKKMAGRAVLLAGPPGTG
2cvfA           -----------------------------------------TGTKSLDSLLGGGFAPGVLTQVYGPYASG
3cioD           --------------------------------------------------AMMETENNILMITGATPDSG
3cbnA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
3be4A           ------------------------------------------------------NSKKHNLILIGAPGSG
3dfoC           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3cueF           ------------------------------------------------------YDYLFKLLLIGNSGVG
2bkiA           --------------------------------------PHVFAIADKAFRDMKVLKLSQSIIVSGESGAG
2eg5G           ------------------------------------VLAKVKCVRELLRANLPNINKCIKVADLGCASGP
1drbA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1bmfC           --------------------------------IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTG
3d31A           ------------------------------------SLSRKWKNFSLDN-LSLKVESGEYFVILGPTGAG
1dp0A           --------------------------------------------------------GTRELNYGPHQWRG
2c7cH           ----------------------------------------------------------------------
1cjtC           ---------------------------------------------------------THRLLLLGAGESG
3cnlA           ----------------------------------------HKGEPRKVLLKKLSFDRLARVLIVGVPNTG
1dg3A           ------------------------------------NTNGRLMAPEALKILSAITQPMVVVAIVGLYRTG
3bk7A           ------------------------------------------------------IRKGEVIGIVGPNGIG
1cfrA           -------------------------------------------------------------DIISKSGEG
3dyoA           ----------------------------------------------------------------------
2d3wC           ------------------------------------DLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2d4hB           ------------------------------------NTNGRLMANPALKILSAITQPMVVVAIVGLYRTG
3dm9B           -----------------------------------------ETSRRIDLIEEIRKAEKPYVIFVGFNGSG
1akeA           -----------------------------------------------------------RIILLGAPGAG
1dekB           -----------------------------------------------------------LIFLSGVKRSG
2d2eA           ------------------------------------DLWASIDGETILKGVNLVVPKGEVHALMGPNGAG
2bhvA           ----------------------------------------------------------------------
3dhwC           ------------------------------------NITKVFHQIQALNNVSLHVPAGQIYGVIGASGAG
2d2fA           ------------------------------------DLWASIDGETILKGVNLVVPKGEVHALMGPNGAG
2ccjA           -----------------------------------------------------------FITFEGPEGSG
3bb1F           ------------------------------------TFAPATQTLELLGNLKQEDVNSLTILVMGKGGVG
1ak2A           ---------------------------------------------------------GVRAVLLGPPGAG
1e59A           ------------------------------------------------------VRHGESQWNKENRFTG
3crmA           -------------------------------------------------------SLPPAIFLMGPTAAG
1e9sB           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
2an9A           -------------------------------------------------------AQGTLYIVSAPSGAG
2bhvD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1c9kC           -----------------------------------------------------------MILVTGGARSG
1e9sM           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
2a1fF           ----------------------------------------------------------------------
2awoA           ------------------------------------NVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
1e4vA           -----------------------------------------------------------RIILLGAPVAG
3a00A           ----------------------------------------------------------RPIVISGPSGTG
2ancF           -------------------------------------------------------AQGTLYIVSAPSGAG
1cjaA           ----------------------------------------------------------------------
3dvlD           ------------------------------------------------------LPIGRSTLVSGTSGTG
1e2kA           ------------------------------------------------------MPTLLRVYIDGPHGMG
2bjbA           ---------------------------------------DGVGSELTVSGRIEPGPGARV--DCGLAG--
3ec1A           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2ck3C           --------------------------------IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTG
2a1fE           ----------------------------------------------------------------------
1e9sI           ------------------------------------RMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTG
2aumB           ----------------------------------------------------------------------
3bwdD           ---------------------------------------------------------FIKCVTVGDGAVG
3cmvB           ------------------------------------TISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSG
2anbA           -------------------------------------------------------AQGTLYIVSAPSGAG
3bb1C           ------------------------------------TFAPATQTLELLGNLKQEDVNSLTILVMGKGGVG
2dr3C           --------------------------------------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTG
1culC           ---------------------------------------------------------THRLLLLGAGESG
3d3qB           ---------------------------------------------------------PFLIVIVGPTASG
3b55A           ----------------------------------------------------------------------
3cddD           ---------------------------------------------------------FDLETYKFNDAQY
3dlbB           ------------------------------------------------------VEGLAVYRREHARGPG
3cr7B           ---------------------------------------------------------GLTIWLTGLSASG
1cs4C           ---------------------------------------------------------THRLLLLGAGESG
3cmuA           ------------------------------------TISTGSLSLDIAL-GAGGLPMGRIVEIYGPESSG
2b8wB           ------------------------------------NTNGRLMANPALKILSAITQPMVVVAIVGLYRTG
2a1fD           ----------------------------------------------------------------------
3bb1A           --------------------------------INTFAPATQTKLLELLGNLKQEDVNSLTILVMGKGGVG
5dfrA           ----------------------------------------------------------------------
3c15C           ------------------------------------------------------YRATHRLLLLGAGESG
3e8aC           ---------------------------------------------------------THRLLLLGAGESG
3bv4A           ----------------------------------------------------------------------
2ahwD           ------------------------------------------------------IPDEATLCVLGGILEA
2e85A           ----------------------------------------------------------------------
1e2iB           ------------------------------------------------------MPTLLRVYIDGPHGMG
2aumA           ----------------------------------------------------------------------
2czvB           ------------------------------------GVKFIEMDIRDKEAYELAKEWFEVVVSIKFNEEV
2c9gA           ------------------------------------SLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMN
2bkeA           ------------------------------------NVKKISTGSQALDGLLAGGIETRTTEFFGEFGSG
1e9sH           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
2bbtA           ------------------------------------ELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAG
1bccF           ----------------------------------------------------------------------
1accA           ----------------------------------------QETTARIIFNGKDLNLVERRIAAVNPSTTK
1e9rF           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
2b8tD           ---------------------------------------------------------GWIEFITGPMFAG
3brwA           ---------------------------------------KHFLGKEHFNYYSLDTALGHLVFSLKYDVIG
3bb1E           ------------------------------------TFAPATQTLELLGNLKQEDVNSLTILVMGKGGVG
1e9rG           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
2ancB           -------------------------------------------------------AQGTLYIVSAPSGAG
3d1mA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3cnnA           -----------------------------------------KGEPRKVLLKKLSFDRLARVLIVGVPNTG
2ahvA           -------------------------------------INGRVPVLSAQEAVNY-IPDEATLCVLGAGGGA
2d7vA           ------------------------------------SCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKG
2dpyB           --------------------------------LQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVG
2dftA           -------------------------------------------------------------VLVGLPGSG
1e9sL           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
2d7vB           ------------------------------------SCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKG
2dftC           -------------------------------------------------------------VLVGLPGSG
3di4A           -----------------------------------------EVLVPPREGRCFEVKAGQFFRISSVEGPQ
1e2iA           ------------------------------------------------------MPTLLRVYIDGPHGMG
1e9sE           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLVNGATGTG
3c7kA           -------------------------------------------------------------LLLGAGESG
2e85B           ----------------------------------------------------------------------
1e2mB           ------------------------------------------------------MPTLLRVYIDGPHGMG
1azsC           ------------------------------------------------------YRATHRLLLLGAGESG
2a5vA           -----------------------------------------DSAVLGSIEYAVTVLNVPLIVVLGHDSCG
1eamA           ------------------------------------------------------RHGILDGATVVYIGSA
3a00B           ----------------------------------------------------------RPIVISGPSGTG
3dfdA           ------------------------------------EVEVPISKRFNVVPFIFKAITTDRIDELEKENTT
1ckvA           ------------------------------------GLKGKDFADQFFADENQVVHESDTVVLVLKKSDE
2dpyA           --------------------------------LQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVG
1e2nB           ------------------------------------------------------MPTLLRVYIDGPHGMG
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2awoD           ------------------------------------NVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
1e2nA           ------------------------------------------------------MPTLLRVYIDGPHGMG
3bjqB           ----------------------------------------------------------------------
3cphA           -------------------------------------------------------------LLIGDSGVG
1e9sA           ------------------------------------RMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTG
3ci2A           ----------------------------------------------------------------------
1afrA           --------------------------------------------------VTHSMPPQKIEIFKSLDNWA
2a1fC           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3dm5B           --------------------------------IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSG
3cddC           -------------------------------------------------------------KAGGKIYQG
3d1mB           ----------------------------------------------------------------------
3b85B           -----------------------------------------------------AIDTNTIVFGLGPAGSG
1e1qB           -------------------------------------VREPMQTGIKAVDSLVPIGRGQRELIIGDRQTG
1ek0A           -------------------------------------------------------------VLLGEAAVG
2ancD           ---------------------------------------------------------GTLYIVSAPSGAG
1chdA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3c14C           ---------------------------------------------------------THRLLLLGAGESG
3do6A           ------------------------------------GHYIAKIDHRFLKSLENHEDGKLILVTATPAGEG
1e9rB           -------------------------------------MTREKAKQVTVAGVPMPRDAEPRHLLVGATGTG
2c5mD           ----------------------------------------------------------------------
1e2hB           ------------------------------------------------------MPTLLRVYIDGPHGMG
1d8jA           ----------------------------------------------------------------------
3bb1G           ------------------------------------TFAPATQTLELLGNLKQEDVNSLTILVMGKGGVG
2a5vB           --------------------------------------------------YAVTVLNVPLIVVLGHDSCG
1e2jA           ------------------------------------------------------MPTLLRVYIDGPHGMG
1e2lA           ------------------------------------------------------MPTLLRVYIDGPHGMG
1cjuC           ---------------------------------------------------------THRLLLLGAGESG
3b9qA           -------------------------------IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGG
3bb1H           -------------------------------------FAPATQTLELLGNLKQEDVNSLTILVMGKGGVG
1cjvC           ---------------------------------------------------------THRLLLLGAGESG
1e2lB           ------------------------------------------------------MPTLLRVYIDGPHGMG
1dvrA           -------------------------------------------------------SESIRMVLIGPPGAG
1e9sK           -------------------------------------MTREKAKQVTVAGVPMPRDAEPRHLLVGATGTG
1e2kB           ------------------------------------------------------MPTLLRVYIDGPHGMG
3e02A           ----------------------------------------------------------------------
2cdnA           -------------------------------------------------------GSHMRVLLLGPPGAG
3c85A           ----------------------------------------------------------------------
1e2mA           ------------------------------------------------------MPTLLRVYIDGPHGMG
2bhvC           ----------------------------------------------------------------------
1e2jB           ------------------------------------------------------MPTLLRVYIDGPHGMG
2bwjB           ------------------------------------------------------LRKCKIIFIIGGPGSG
3dkvA           -------------------------------------------------------------VLMGLPGAG
3dmdA           -------------------------------VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSG
1ckeA           -------------------------------------------------------AIAPVITIDGPSGAG
2bwjD           ------------------------------------------------------LRKCKIIFIIGGPGSG
1dekA           -----------------------------------------------------------LIFLSGVKRSG
3cddB           --------------------------------------------LKAGGKIYQGWTKIGITRSLEASGAF
3cd9A           --------------------------------LKGIDFKEDGNILGHKLEYNYNCESNVYIMADKQKNGI
3ed8A           ------------------------------------GTDFKE-DGNILGHKLEYNFNSHNVYITATRGTQ
1e2hA           ------------------------------------------------------MPTLLRVYIDGPHGMG
3bs4A           ------------------------------------------------------KKHSLILIHEEDASSR
3dofB           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSTLVKTICGLIQPDDGAMRWRXXXXXXXXXXXXXXXXIGLVSQHFALFDNLTVAENVALGQRGGESLDI
3cmvG           KTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK---LGVDIDNLLCSQPDTGEQALEICDARSGAVDV
3dmdC           KTTTIAKLANWLKNHGFSVV------------------IAASDTFRAGAIEQLEEHAKRIGVKIKHSYGA
3cmvH           KTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK---LGVDIDNLLCSQPDTGEQALEICDARSGAVDV
2d3wB           KSTLSATLAGREDYEVTGVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRG
2bifA           KTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAA-----------
1bifA           KTYISKKLTRYLNFIGVPTREF-----------------NVGQYRRDMVKTYKSFEFFLPDNEGLKIRKQ
2dwoA           KTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCAL-------------
3c95A           KCPVLAQANTLRPEDADLRENPQVREKVVAIFAESDNVDAQLYNGFFSDADRAAMKIVLETEP-RNLPAL
3b5jA           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQ-VGVVLQDNVLL-NRSIIDNISLAEKVIYAAKL
2c61B           HNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVDITNYAE
1aroP           ----------------------------------------------------NDFSDIELAAIPFNTLAD
3cmvC           KTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK---LGVDIDNLLCSQPDTGEQALEICDARSGAVDV
3b60A           KSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIE
2ccjB           KTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRK---IVLEGNDMDIRTEAMLFAASRREHLV-----L
1d1cA           KTENTKKVIQYLASVAGRNQALEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQ
2bbsA           KTSLLMMIMGELEPSEGKIKHSG---------------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRS
2c03B           KTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESI------------
2ccgB           KTTVINEVYHRLVKDYDVIMTREPGGVPTGEEI-----RKIVLEGNDMDIRTEAMLFAASRREHLVLKVI
3dmdB           KTTTIAKLANWLKNHGFSVV------------------IAASDTFRAGAIEQLEEHAKRIGKVIKHSYGA
2a2zD           KSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPTFQTYACLSRIRAQLASLNEKPVFFERSV
3eiuB           HNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPATNYAEALR
2dwpA           KTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCAL-------------
1e9fA           KSTQSRKLVEALCAAGHRAELLRFPERSTEIGKL----LSSYLQKKSDVEDHSVHLLFSANRWQVPLIKE
3eiuA           HNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPILTDITNYA
2ccgA           KTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRK---IVLEGNDMDIRTEAMLFAA-----SRREHLVL
1bg0A           YRTFGPLFDPIIDDYHGGFKLT-----DKHPPKQWGDINTLVGLDPAGQFIISTRVRCGRSQGYPFNPCL
2czvA           VVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVLIYVESNDLRVIRYSIEKGVDAIISNRKDPGI
2a30D           KSTFVNILKQLCEDWEVVRWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKPLFFERSV
2d62A           KTTTLRIAGLEEPTRGQIYIEDNLVADPEKGVFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQ
1e98A           KSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKL-
3cmvA           KTTLTLQVIAAAQREGKTCAF----------------------------IDAEHALD--PIYARKLGVDI
2dr3A           KTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQ-FGWDVKPYEEKGMFAMVDAFTAGIGKEY----
2b8tA           KTAELIRRLHRLEYADVKYLVFKPKIDTRSIRNIQSR-TGTSLPSVEVESAPEILNYIMSNSFNDDRICE
3cmxA           KTTLTLQVIAAAQREGKTCAF---IDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDAPKAEARM
2dr3B           KTIFSQQFLWNGLKMGEPGIYVA--------------------LEEHPVQVRQNMAQFGWDVKPYEE---
2akaB           KSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAESPVPINLRV
1e9cA           KSTQSRKLVEALCAAGHRAELLRFPERSTEIGKL----LSSYLQKKSDVEDHSVHLLFSANRWQVPLIKE
1e69A           KSNIIDAIKWVFGEKFDMI-FAGSENLPPAGSAYVELVFEENGEEITVAIDRIVNAYQRVNESFNRFISL
2d4uB           --------------------------------------IRYMMDQNNIGSGSTVAELMESASKQAEKNWA
2awnC           KSTLLRMIAGLGVGMVF--------------------------QSYALYPHLSVAENMSFGLKLGAKKEV
3b2qA           HNEIALQIARQASVPGSESAFA-VVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDVERIVTPRM
3czpB           KGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAP
2a5gA           KTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVRIDEARQE
2a30B           KSTFVNILKWEVVPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNDPVLFFERSV
2cckA           KTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEDMDIRTEAMLFAASRREH-------------
3dm5A           KTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKG
1cr4A           KSTFVRQQALQWGTAMGKKVGL---AMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
2cjwB           KSTLANIFAGVEDTYERTLMVDGESATIILLDMWENH-DHMQVGDAYLIVYSITDRASFEKASLRIQLRR
2b8wA           KSYLMNKLAGKKKGFSLGSTVHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDFVYNSIGTIN
3b2qB           HNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMS-DFEKTGALERAVVFLNLADDPAVNYAEAL
2c03A           KTTTAAKLALYYKGKGRRPLL-----------------VAADTQRPAAREQLRLLGEKVGVPVLEVMDGE
2axpA           KSTVAAKLSKELKYPIIKGSLAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSITERQLRF
2ctsA           QITVDMMYGGMRGMKGLVYETSLDPDEGIRFRGYSIPECQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEE
2c9yA           KGTQAPRLAENFCVCHL--ATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKCKNGFLLDGF
3a1wA           KTSLFNALTGTKQYVANWPGVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDDLVILV
2d0kA           ----------------------------------------------AISLIAALAVDRVIGNE-------
1e2dA           KSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLL---SSYLQKKSDVEDHSVHLLFSANRWEQVPLIKE
3dtbB           RKFVEGNA-QLCQPEYI---------HICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLAARIESKTVI
2bdtA           KSTTCKRLAAQLDNSAYIEGDIINHVVGGYRPPWESDEITDLTVNFLLAQNDVVLDYIAFPDEAALAQTV
2cgtH           --------------------------------------AIAQVGTISANSDETVGKLIAEAMDVGKEGVI
3b85A           KTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFLPGDPYLRPLHDALRDVEPEVIPKLEVEVAPLAYR
2c04A           KTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESI------------
1e9dA           KSTQSRKLVEALCAAGHRAELL----RFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANWEQVPLIKE
1e0jB           KSTFVRQQALQWGTAMGKKVGLAMLEESVEETAED---LIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
4dcgA           PGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
1e9rA           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL
2dr3E           KTIFSQQFLWNGLKMGEPGIY-VALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGK------
2b8tB           KTAELIRRLHRLEYADVKYLVFKPKILPSVEVESAPEILNYIMSNSFNDETKVIGID--EVQFFDDRICE
2b8tC           KTAELIRRLHRLEYADVKYLVFKPKIDSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFD
2d4uA           FNALKNCKENFTVLQTIRQQQSTLNGSWVALLQTRNTLNRYMMDQNNIGSGSTVAELMESASISLKQAEK
1e3mB           --------------------------------------VEQVLNEPFIANNLSPQRRLIITGPNGGKSTY
1e9sD           KSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDII---LNPYDQRTKGWSFFNEIRNDY-------
1e2fA           KSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYL----QKKSDVEDHSVHLLFSANRWEQVPLIK
1e0jA           KSTFVRQQALQWGTAMGKKVG---LAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
1e9sG           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAL
2a2zB           KSTFVNILKQLCEDWEVVPEPNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGEKLFFERSV
2a30A           KSTFVNILKQLCEDWEVVRWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRIRAQLASAEKPVLFFERSV
1e9sF           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRN---------
1e3mA           LAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLN--EPFIANPLNLSPQRRLIITGPNGGKSYRQTAL
1dhiA           -----------------------------------------------ISLIAALAVDRVIGME-------
1e3aB           AYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPQSGYIANWNNSTEIDRLLEQKPRLTADQAWDV
3c8uA           KSTLSNPLAAALSAQGLPAEVV----------PDGFHLDNRLLEPRGLLPRKGAPETFDFEGRLCHALKH
2bv7A           FRTLQNILEVEKEMYGAEWPKVGAT-------------LALMWLKRGLRFIQVFLQSICDGERDEN-HPN
2bc9A           KSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGL--------------GDVEK
1e9rE           KSVLLRELAYTGLLRGDRMVIV---------------------DPNGDMLSKFGRDKDIILNPYDQRTKG
421pA           KSALTIQLIQNHFVDEYDPTIQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINTKSFED
2axzC           ----------------------------------------------------------------------
1cr1A           KSTFVRQQALQWGTA---MGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDE
1draA           -----------------------------------------------ISLIAALAVDRVIGME-------
1adoA           ----------------------------------------------------------------------
3dauA           -----------------------------------------------ISLIAALAVDRVIGME-------
3dfpC           ----------------------------------------------------------------------
1dhjA           --------------------------------------------------------IAALAVDRVIGME-
2c61A           HNEIALQIARQASVPGSESAFAVVFAAMGITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPR
1cr2A           KSTFVRQQALQWGTAMG---KKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGK-------
3czpA           KGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAP
2d3wA           KSTLSATLAGREDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEILNAVRSYRGQETLDRFDFQ
3bo6B           FQLESHGGDVFMHAHRENPQCKGDFAGDKFHISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQ
2bbsB           KTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRY-------------RSVI
2bx2L           -----------------------------------------FLIHQESNVIVRAFRDYLEILIDNPKVLE
3adkA           KGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGF
3d7wA           GDTITAAIDVTNLYVVAYEAGN-----------QSYFLSDAPAGAETQDFSGTTSSSQPFNGSYPD----
3dt2A           KTNLAMMNPTLPGWK--VECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIF
2akaA           KTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFGKFIEIQFNSAGFIS
3ch4B           KDFVTEALQSRLGADVCAVLR-LSGPLKEQYAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKITR
3bh0A           KTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASE-----DWGKLSMA
2awnD           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIISRLHKR
2dr3D           KTIFSQQFLWNGLKMGEPGIYVAL-------------------EEHPVQVRQNMAQFGWDVKPYEEKGMF
2drcA           -----------------------------------------------ISLIAALAVDRVIGME-------
2cckB           KTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEG
1ai4B           AYPDRQSGHDPRLPVPGTGKWDWKGLLPFEMNPKVYNPFAFLWGGADRVTEIDRLLEQKPRLTADQAWDV
3cmwC           KTTLTLQVIAAAQREGKTCAFI---DAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDARSGAVDI
3dt7A           KTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTN
3dfnC           ----------------------------------------------------------------------
1e6cA           MTTVGRELARALGYEFVDTDIQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGVLLEQNR
2a5jA           KSCLLLQFTDKRFQPIGVEFRMVNIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDIRRETFNH
3dfnA           ----------------------------------------------------------------------
3bgwA           KTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAI----
3bb1B           KSSTVNSIIGERVVSISPFQSGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDV
1d6jB           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEENIRRIAEVAKLFADSNSIAITSFISPYRK
1dyhA           -----------------------------------------------ISLIAALAVDRVIGMEN------
3cmtD           KTTLTLQVIAAAQREGKTCAF---IDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICAEMGLAARM
2ausC           -------------------------------------------------KREVIVKDDKAETN--PKWGF
3dt4A           KTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIF
4dfrA           -----------------------------------------------ISLIAALAVDRVIGMENA-----
2d4hA           KSYLMNKLAGKKKGFSLGSTVQKGIWMWCVPHPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTF
3dfoD           ----------------------------------------------------------------------
3cr7D           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSRRIAEVAKLFADSNSIAITSFISPYRKDRDT
1cr0A           KSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFG
3clvA           KSSIVLRLTKDTFHENTNTTIGASFCTYVVNLNDNYNEIWDTAGQERYASIVPLYYRGATCAIVDISNSN
3dfpD           ----------------------------------------------------------------------
1e9sJ           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQ----
2a2zA           KSTFVNILKQLCEDWEV--VPEPVARWCNVQSTNVLQMMYEKPERWSFTFQTYACLSRI-RAQLASLNGK
2awnB           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFG--LKLAGAKKEV
3bpbA           DVDITLLPPDERFPDSVFVEDRCAIITRPGAESRRGETEIIEETVQRFYPGKVERIEAPGTVEAGD----
3da4A           VTTPIVALAHYLWGNGAERSVKISPMKINQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYGVVRSYD
3d3kA           MALTLLGGPQRPTVALLCGPHVQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSL
3cmvE           KTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARK---LGVDIDNLLCSQPDTGEQALEICDARSGAVDV
3dfqA           ----------------------------------------------------------------------
2b92B           KSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHGDVEKGDNQNDSWIFALAVLLFVYNSIGT
3d3qA           KTELSIEVAKKFNGEIISGDSQVYQGDIGTAKVTTEEEGIPHYIDILPPDFKKRAEKYIKDITRRGKVPI
3bgwD           KTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASED-----WGKLSMA
3dfnD           ----------------------------------------------------------------------
1e2gA           KSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYL----QKKSDVEDHSVHLLFSANRWQVPLIKE
1d6jA           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLN---------KDLGFSEADRNENIRRIAEVAKLFADSN
2d3wD           KSTLSATLAGREDVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRG
3dftD           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3dt4C           KTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPE--NGFFGVAPGTSVKTNPNAIKTTIFTNVA
2bkhA           KTENTKFVLRYLTESYGTGQDI-----DDRIVEANPLLEAFGNAKTVRNNNSSRFGKNEKSSVVGGFVSH
3dfqD           ----------------------------------------------------------------------
2bbtB           KTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIK------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2c0bL           ---------------------------------------PFLIHQESNVIVRAFRDYLRQDIGDNPKVLE
2awoC           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVIN----
2awnA           KSTLLRMIAGLETITSGDLFI--------------------------------------------GEKRM
3ecpA           --------------------------------------AKSVFSSAALGDPRTARLVNVAAQLAKYSGKS
1dkiA           ATATAQIMKYHNYPNKGLKDYTYTLSSNNPYFNH----PKNLFAAISTRQYNWNNILPTYSGRE-SNVQK
3cr7A           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRIRRIAEVAKLFADSNSIAITFISPYRK
2aunB           ---------------------------------------------------QPIDGRVALIAPASAIATE
2dr3F           KTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQ-FGWDVKPYEEKGMFAMVDAF------------
3cr7C           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADNIRRIAEVAKLFADSNSIAITFISPYRK
1aldA           ----------------------------------------------------------------------
1b0uA           KSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKVFQHFNLWSHMTVLENVPIQVLGLSKHDA
1e9rD           KSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNE---------------
2bwjA           KGTQCEKLVEKYGFTHL--STGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKELGDTRGFLID
3dymA           ----------------------------------------------------------------------
2boeX           --------------------------------------------------NMSSAEWVRNNPNDPRTPVI
1bglA           ----------------------------------------------------------------------
2dflA           KTQLCHQLSVNVQLPPEKGGLS--------------GKAVYIDTEGTFRWERIENMAKALGLDIDNVMNN
1e4yA           KGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVK-------------
3bczC           EGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQ-VDPSITRRIFILGPSHHVPLSRCDIYRTPLYD
3cddF           NQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELQRGVLLTSDTFGNLVITRASTKAGVSL
2bhjA           --------------------------------------LTRGPRDKPTPLEELLPHAIEFINQYYGSFKE
3cm0A           KGTQASRLAQELGFKKL--STGDILRDHVARGTPLGERVRPIMERGDLVPDDLILELIRVIFDGFPRTLA
2c4rL           --------------------------------------APFLIHQESNVIVRAFRDYLRQDIGLIDNPKV
1av6A           PGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYL-RSIKKQLHPSKIILISDV
2aunA           ----------------------------------------------TWQPIDGRVALIAPA---SAIATE
2c9oC           KTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVL-MENFRRAIGLRIKETKKKEIIQDVTLHDLDVA
2cvfA           KTTLALQTGLLSGKKVAYVDTE---GGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLK
3cioD           KTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTV-SNEHGLSEYLAGKDELNKVIQHFGRGQVPPNP
3cbnA           --------------------------------------TFEVTVDP----EIGETADCIIGVSSSDSIST
1eilA           ----------------------------------------------------------------------
3be4A           KGTQCEFIKKEYGLAHLSTGDMLREAIKNGIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFAKI
3dfoC           ----------------------------------------------------------------------
3bjdB           ------------------------------------------RQAYAAYQQLLYVLSLSDDVATAQTRRW
3cueF           KSCLLLRFSDDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGVYDVTDQESFNG
2bkiA           KTENTKFVLRYLTESYGTGQDI-----DDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHVVGGFVSH
2eg5G           NTLLTVRDIVQSIQLERPTIQIFLNDLFPNDFNSVFKLLPSFYRKLEKENGRKIGSCLIGAMPGSFYSRL
1drbA           -----------------------------------------------ISLIAALAVDRVIGME-------
6aldA           ----------------------------------------------------------------------
1bmfC           KTSIAIDTIINQKRFNDGTDEKKKLY------------CIYVAIGQKRSTVAQLVKRLT-----------
3d31A           KTLFLELIAGFHVPDSGRILLDGKDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNL-----EFGMRMKKIK
1dp0A           DFQFQQQLMETSHRHLLHAEEGTWLN------------IDGFHMGIGGDDSWSPSVSA------------
2c7cH           --------------------------------------------TISANSDETVGKLIAEAMDKVGKEGV
1cjtC           KSTIVKQMRILHVGEKATKVQKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNV-------
3cnlA           KSTIINKLKGKRAKGIQWFSLENGVKILDTPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEI
1dg3A           KSYLMNKLAGKKHTKGIWMWCVPHPKKPGHILVLLDTEG-LGDVEKGDNQNDSWIFALAVLLSSTFVYNS
3bk7A           KTTFVKMLAGVEEPTEGKVEWD--------------LTVAYKPQYIKAEYEGTVYELLS---KIDSSKLN
1cfrA           NKYTINSAIAFIDINTTRLGGKISDGSFNKCNGDWYEWIGIRAIEFFLESETNFIPNATSFDVMSIYKSC
3dyoA           ----------------------------------------------------------------------
2d3wC           KSTLSATLAGREDYEVTTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRG
2d4hB           KSYLMNWMWCVPHPKKPGHITEGLGQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELFSLDLE
3dm9B           KTTTIAKLANWLKNHGFSVVTFRAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKAR------
1akeA           KGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFL
1dekB           KDTTADFIMSNYSAVKYQL------------AGPIKDALAYAWGVFAANTDYPLTRKEFEG-------ID
2d2eA           KSTLGKILAGDPEYTERGEILLDGENILELSPDERARKGLFLAFQYPVVPGVTIANFLRLQAKLGREVGV
2bhvA           --------------------------------------LLRTITADKMIPAFLITPISS--QIAGKVIAQ
3dhwC           KSTLIRCVNLLERPTEGSVLVQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPELDNTPKDE
2d2fA           KSTLGKILAGDPEYTVEEILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANFLRLALQVGVAEFW
2ccjA           KTTVINEVYHRLVKDYDVIMTREPGGVPT---------GEEIRKIVLEGNDMDIRTEAMLFAASRREHLV
3bb1F           KSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTID
1ak2A           KGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFL
1e59A           WYDVDLSEKGVSEAKAAGKLLDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGAQGLNKAE
3crmA           KTDLAMALADALPCELISVDS-ALIYRGMDIGTAKPSRELLARYPHRLIDIRDPAESYSAAEFRADALAA
1e9sB           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYAS
2an9A           KSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRD---AFLEHAEVFGNYYG
2bhvD           --------------------------------------LLRTITADKMIPAFLITPISSQIAGIAQVESD
2bofX           -------------------------------------------DRIASVPQGTWFAHHNPGQGQVDALMS
1c9kC           KSRHAEALIGDAPQVLYIATSQ-----ILHHKDGRPAHWRTARHLDTLITADLAPDDAILLEC-------
1e9sM           KSVLLRELAYTGLLRGDRMVIV---DPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNYDWQRYALS
2a1fF           ----------------------------------------------------------------------
2awoA           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALY--PHLSVAENMSFGLKLAGAKKEV
1e4vA           KGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDI-MDAGKLVTDELVIALVKERIAQEDCRNGF
3a00A           KSTLLKKLFAEYPDSFGFSVSSTTRT------------PRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWA
2ancF           KSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRIFILPPSKIELDRRLRGRGQDSEEVI
1cjaA           --------------------------------------DNIMLSERGATVVPIDSKIIPLDASHPHGERV
3dvlD           KTLFSIQFLYNGIIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDASPD----------
1e2kA           KTTTTQLLVADDIVYVPEPMT---YWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMAQITMGMPYAV
2bjbA           --TVLRFVPPLAALGSVPVTFDQARGRPIAPLLDALRELGVAVDGTGLPFRVRGNGS----------LAG
3ec1A           --------------------------------------SGATLYDTPGIINHHQMAHFARDLKIITPKRE
4atjA           --------------------------------------SILLDNTTSFRTEKDAFGNANSA-RGFPVIDR
2ck3C           KTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDAD--------------------
2a1fE           ----------------------------------------------------------------------
1e9sI           KSVLLRELAYTGLLRGDRMVI---------------------VDPNGDMLSKFGRDKDIILNPYDQRTKG
2aumB           ----------------------------------------------TWQPIDGRVALIAPA---SAIATE
3bwdD           KTCLLISYTSNTFPFSANVVLGLWDTAGEDYNRLRPLSYRGADVFIL-AFSLISKASYENVSKKWIPELK
3cmvB           KTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVD---IDNLLCSQPDTGEQALEICDARSGAVDV
2anbA           KSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSR
3bb1C           KSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTID
2dr3C           KTIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGW-DVKPYEEKGMFAMVD--------------
1culC           KSTIVKQMRILHVGEKATKVQD-IKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFD
3d3qB           KTELSIEVAKKFNGEIISGDSQYQGDIGTAKVTTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITR
3b55A           ----------------------------------------------------------------------
3cddD           KAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTL-
3dlbB           WRVLGGAVLDLWVSDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGE-----
3cr7B           KSTLAVELEHQLVRDRRVHAYRLDGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFIS
1cs4C           KSTIVKQMRILHVGEKATKVQKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYIL------------
3cmuA           KTTLTLQVIAAAQREGKTCAF---IDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDA-----LA
2b8wB           KSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAV
2a1fD           ----------------------------------------------------------------------
3bb1A           KSSTVNSIIGERVVSISPPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYV
5dfrA           --------------------------------------------------------------SLIAALAV
3c15C           KSTIVKQMRILHVNGEKATKVQ------------------------------------------------
3e8aC           KSTIVKQMRILHVNGEKATKV-------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2ahwD           TTLITALALSIISPTGLGDRA-DRGISPLAQEGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQ
2e85A           ----------------------------------------------------SAVTDVLLCVG----NSM
1e2iB           KTTTTQLLVALGSRDDIVYVPE---------PMTYWRVLGASETIANIYTTQHRLDQGEISAG-----DA
2aumA           -----------------------------------------SSDQ-TWQPIDGRVALIAPA---SAIATE
2czvB           DKEKLREARKEYGKVAILLSNPKPSLVRDTVQKFKSYLIYVESNDLRVIRYSIEKDAIISPWVNRKDPGI
2c9gA           NAIVEHYLKVGRQNGVLESDI-------------------------------------------------
2bkeA           KTQLCHQLSVNVQLPPEKGGLSGKAVYIDTEGTFRWERIENAKALGLDIDN------------------V
1e9sH           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDQRYALS
2bbtA           KTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFA
1bccF           --------------------------------------NAAGFNKYGLMRDDTIYENDDVKAIRRLPENL
1accA           PDMTLKEALKIANEPNGNLQYQGKD----------------ITEFDFNF-DQQTSQNIKNQLAELNATNI
1e9rF           KSVLLRELAYTGLLRGDRMVI-------------------------------------------------
2b8tD           KTAELIRRLHRLEYADVKYLVFKPKSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEV
3brwA           DQEHLRLLLRTKCRTYHDVIPISC-------------------LTEFPNVVQMAKLVCEDVNVDRFYPVL
3bb1E           KSSTVNSIIGERVVSSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYV
1e9rG           KSVLLRELAYTGLLRGDRMVI-------------------------------------------------
2ancB           KSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSR
3d1mA           ----------------------------------------------------------------------
3bm2B           -------------------------------------------LELLIN-RRSASRLAEPAPTGEQLQNI
3cnnA           KSTIINKLKGKRAGIQNGVKILDTPGILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIG
2ahvA           TTLITARNLSIISPTGLGDRA-DRGISPLAQEGLVKWALCGHWGQSPRI-SDLAEQNKIIAYNYPQTLRA
2d7vA           KTSVTKVVLRPQVVFSG----TSKPTLQQLEKHHLAHENCFIANSV--ETEVVT----------------
2dpyB           KSVLLGMMARYTRADVIVVGL-------------------------------------------------
2dftA           KSTIGRRLAKALGVGLLDTDQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGV
1e9sL           KSVLLRELAYTGLLRGDRMVI-------------------------------------------------
2d7vB           KTSVTKVVLRPQVVFSG----TSKPTLQQLEKHHLAHENCFIANSV--ETEVVT----------------
2dftC           KSTIGRRLAKALGVGLLDTDVEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSP
3di4A           VGDLNLHNL-------HDLTERFFSGKTRALHGTHVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGS
1e2iA           KTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAVMTSAQITMGMPYAVTDAVLAPHIGGEAG
1e9sE           KSVLLRELAYTGLLRGDRMVI---VDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFN-------------
3c7kA           KSTIVKQMKIIFSGEDVKQYK-------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e2mB           KTTTTQLLVALGSRDDIPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAV
1azsC           KSTIVKQMRILHVNGEKATKV-------------------------------------------------
2a5vA           AVNAALAAINDGTLPGGYVRDV---------VERVAPSVLLGRRDGLSRVDEFEQRHVHETAILMARSSA
1eamA           PGTHIRYLRDHFYNLGVIIKWGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILIS-------
3a00B           KSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGN-------
3dfdA           KELDSQRFYARIAVETTVYPTFKAKELREA--------YKTEDPVEVAKRVLSVGGEYANWLN-------
1ckvA           INTFIEEILLTDYKKNVGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSS-TIGRAYTLGNK----
2dpyA           KSVLLGMMARYTRADVIVVGLIGERGREVKDFIENILGPDGRSVVIAAPADVSPLLRMQGAAYA------
1e2nB           KTTTTQLLVALGSRDDIVYPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAV
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2awoD           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLG
1e2nA           KTTTTQLLVALGSRDDIVYPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSATMGMPYAV
3bjqB           ----------------------------------------------------------------------
3cphA           KSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDV
1e9sA           KSVLLRELAYTGLLRGDRMVI-------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1afrA           EENILVHLKPVEKCWQPQDFL-------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3dffA           -----RLLAISPHLDDAVLSF----GAGLAQAAQDGANVLVYTVFAGAAQPPAAQRHTIWGLADDDAVLY
3dm5B           KTTTVAKLARYFQKRGYKVGVVC------------------SDTWRPGAYHQLRQLLDRYHIEVFGNPQE
3cddC           WTKIGITRSLETYKFQYKAFPIKQGQACTVDIGGERVITGYVDDWVPSYDGRDKTADLVDCSIGQFNNQT
3d1mB           ----------------------------------------------------------------------
3b85B           KTYLAAKAVQALQSKQVSRIILTRPAVEAGEKLGFLP------DPYLRPLHDALRDVEPEVIPKLEAGIV
1e1qB           KTSIAIDTIINQKRFNDGTDE-KKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQ
1ek0A           KSSIVLRFVSNDFAENKEGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQ
2ancD           KSSLIQALLKTQPLYDTQVSV-------------------------------------------------
1chdA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3c14C           KSTIVKQMRILHVNGEKATKVQ------------------------------------------------
3do6A           KTTTSIGLSSLNRIGKKSI---------------------------------------------------
1e9rB           KSVLLRELAYTGLLRGDRMVI-------------------------------------------------
2c5mD           ----------------------------------------------------------------------
1e2hB           KTTTTQLLVALGSRDDIWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMAVTDAVLAPHIG
1d8jA           --------------------------------------------------SGSSGYKFGVLAKIVNYMK-
3bb1G           KSSTVNSIIGERVVSISPFQSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGALNIIKSFLLDKTIDVLLYV
2a5vB           AVNAALAAINDGTLPGGYVRDVVERVAPS---------VLLGRRDGLSRVDEFEQRHVHETVAMARSSAI
1e2jA           KTTTTQLLRDDIVYVPEPMTYGASETIANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAIGGEAGS
1e2lA           KTTTTQLLDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAV
1cjuC           KSTIVKQMRILHVNGEK-----------------------------------------------------
3b9qA           KTTSLGKLAHRLKNEGTKVLM-------------------------------------------------
3bb1H           KSSTVNSIIGERVVSISPFQS-------------------------------------------------
1cjvC           KSTIVKQMRILHVEKATKVQD-------------------------------------------------
1e2lB           KTTTTQLLVALGSRDDIVY---------VPEPMTYWRVLGASETIANIFTTQHRLDQGEISAGMTSAQIT
1dvrA           KGTQAPNLQERFHAAHL--ATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTACKNGFI
1e9sK           KSVLLRELAYTGLLRGDRMVI-------------------------------------------------
1e2kB           KTTTTQLLVALGSRDDIVYPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAV
3e02A           --------------------------------------TRFEFECYDVGHLYNLAHFVDRKLVEPPFFLQ
2cdnA           KGTQAVKLAGIPQISTGELFRR-----NIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDPDAANGFILDG
3c85A           ----------------------------------------------------------------------
1e2mA           KTTTTQLLRDDIVYVPEPMTY----WRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPY
2bhvC           --------------------------------------TPISSQIAGKV-IAQVESDIFAHMGKAVLIPK
1e2jB           KTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANI-YTTQHRLDQGEISAGDAAVVMTSMGMPYAV
2bwjB           KGTQCEKLVEKYGFTHLSTG--------------------------------------------------
3dkvA           KGTQAERIVE--KYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRER------LSK
3dmdA           KTTTIAKLANWLKNHGFSVVI-------------------------------------------------
1ckeA           KGTLCKAMAQWHLLDSGAIY-----RVLALAALHHHVDVASEDALVPLASHLDVRVSTNGNLEVILEGED
2bwjD           KGTQCEKLVEKYGFTHLSTG--------------------------------------------------
1dekA           KDTTADFIMSNYSAVKY--QLAGPIKDALAYAWGVFAANTDYPLTRKEFEGIDYDRETNLNLT------K
3cddB           DLETYKFLGNDAQYKAFIEPI-------------------------------------------------
3cd9A           KANFKTRHNIEDGSVQLADHYQ-QNTPIGDGPVLLPDNHYLSTCS---ALSKDPNEKRDH----------
3ed8A           KNGIKANFTVRHNVEDG-----------------------------------------------------
1e2hA           KTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTD
3bs4A           GKDILFYILSRKLKSDNLVGM-FSISYPLQLIIRILSRFGVDVIKYLENHRLAIVDTFGSFHG-------
3dofB           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALMQDPQFLILDEPTAVLTPAEADRLFDVLEQL
3cmvG           IV--VDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVK
3dmdC           DPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQF
3cmvH           IVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGA
2d3wB           QETLDRFDFLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSLD-IDALKVVADGVNSL
2bifA           -----LNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLG
1bifA           CALAALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLG
2dwoA           ---AALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKIS
3c95A           DITFVDKRIEKLLFNYRARNFPGTLDYAEQQRWLEHRRQVFTP--EFLQGYADELQMLVQQEKVALLKAL
3b5jA           AGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI
2c61B           ALRQMGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK
1aroP           HYGE-RLAREQLALEHEYEMGEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEI
3cmvC           IV--VDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVK
3b60A           EAAMDFINKMDNGLDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQA-ALDE
2ccjB           KVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNN
1d1cA           SYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQ
2bbsA           VIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2c03B           -----RRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAF
2ccgB           ---PALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNS
3dmdB           DPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQF
2a2zD           YSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGLEYLEKL
3eiuB           QMGAAGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVAR-----
2dwpA           ---AALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKIS
1e9fA           KLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK-----------RY
3eiuA           EALRQMGPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH--
2ccgA           KVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNS
1bg0A           TAEQYKEMEEKVSSTLSSYYPLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTF
2czvA           DHVLAKLMVKKNVALGFSLRPLLYSNPYERANKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI
2a30D           YSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCRNEEQGIPLEYLEKL
2d62A           EIDKRVREVAELGLTELLNRKPRELSGGQRQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQ
1e98A           --SQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA
3cmvA           DNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLGNL
2dr3A           ----------------EKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINMARSIILQLKRVL
2b8tA           VANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKH------
3cmxA           MSQAMRKLAGNLKQSNTLLIFINQIRNPETTTGGNALKFYASV-RLDIRRIGAVKEGENVVGSETRVKVV
2dr3B           -KGMFAMVDAFTAGIGEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQVL
2akaB           YSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVD
1e9cA           KLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHE----RY
1e69A           LFFGGEGRLISIRKPGRRDQKLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKEN
2d4uB           DYEALPRDPQSTAAAAEIKRNYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQN
2awnC           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDALRVQMRIEISRLH
3b2qA           ALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGA---ARNEVPGRRGYPGYMYTDLATLYERAGIVKGA
3czpB           ADWLRAYGEINDFEEQLSEYGWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKGDVDRTSTLVEAN
2a5gA           LHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSN
2a30B           YSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCRNEEQGIPLEYLEKL
2cckA           -LVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAERIIKNS
3dm5A           VDIIIVDTAGR----------HKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFK------
1cr4A           LFGNDTFHLYDSF---------AEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFA--
2cjwB           ARQTEDIPIILVGNKSDLVRREVSVSEGRAAVVFDCKFIETSAAVQHNVKE-------------------
2b8wA           QQAMDQLYYVTELTHRIRSKSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFN
3b2qB           RQMGRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK
2c03A           SPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAF
2axpA           IEDKIKAKAKVVYLHALRVRGDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKD--IIFLV
2ctsA           QVSWLSKEWAKRHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIH-----------------
2c9yA           PRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDD--ITG
3a1wA           ADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEY
2d0kA           --NALPWNLPADLAWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAA
1e2dA           KLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA
3dtbB           ITQEQRDTVPIPKSGQSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIEVVASM
2bdtA           QAKVDDVEIRFIILWTNREELLRRDALRKKGERCLELVEEFES--KGIDERYFYNTSHLQPTNLNDIVKN
2cgtH           TVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGK
3b85A           GRTLNDAFVILDEAQNTTPAQKFLTRLGFGSKVVTGDGLRLVRH-ILRGVDDVHFSELTSSDVVQLVGHI
2c04A           -----RRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAF
1e9dA           KLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAK----RGAFGHERY
1e0jB           --LFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERMIDNLMTKLKGFA
4dcgA           ILNPVASSLKWRCPFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKL
1e9rA           SVVPRGKTDEAEEWASYGRLLLRETKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEA
2dr3E           --------------EYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVL
2b8tB           VANILAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATH-------SLRKIDGK
2b8tC           DRICEVANILAENGFVVIISGLDKNFGPIAKLFTYADKITKLTAICNECGAEATHSLRK-------IDGK
2d4uA           NWALPRDPRQSTAAAAEIKRNYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQN
1e3mB           RQTALIALAPAQKVEIGPIDRIFTRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLA
1e9sD           -----------DWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDGF
1e2fA           EKLSQGVTLVVDRYAFSGVAFTGKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFG---HERYE
1e0jA           --LFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNMTKLKGFA
1e9sG           SVVPRGKASYGRLLLRETAKKLAGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSAR
2a2zB           YSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKL
2a30A           YSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCRNEEQGIPLEYLEKL
1e9sF           ---------DYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDL
1e3mA           IALAYIGSYVPAQKVEIGPIDRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAEN
1dhiA           --NAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACG
1e3aB           IRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSML
3c8uA           QERVIYPLFDR-------ARDI--AIAGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPA
2bv7A           LIRVNATKAYEM---------ALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLF
2bc9A           GDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDL
1e9rE           WSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDL
421pA           IHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRE
2axzC           ------------------------EVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYI
1cr1A           LFGNDTF---------HLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDN--LMTKLKGFA
1draA           --NAMPWNLPAELAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAC
1adoA           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEE
3dauA           --NAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAC
3dfpC           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
1dhjA           --NAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAC
2c61A           MALTAAEYLAYEHGMHVLVILTDITNYAEALRQMGAARNEVPGRRGYPGYMYTDLATLYERAIVKGAKGS
1cr2A           FDQWFDELFGNDTFHLYDS---FEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGF--A
3czpA           ADWLRAYGEINDFEEQLSEYGIIVIDKQTQERFKE-REKTPYKRYKITEEDWRNRDKWDEIAPWTLVEAN
2d3wA           DLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSL
3bo6B           QSRVAVGAQFTLYVKPDQSQYSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELR
2bbsB           KACQLEEDISKFAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2bx2L           LARQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSAR
3adkA           LIDGYPREVKQGEEFERKGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVI
3d7wA           LERYAGHRDQIPLGIDQLIQSVTALRFPGGQTKTQARSILILIQ--MISEAARFNP------ILWRARQY
3dt2A           TNVAETSDGGVYWEGIDEPLAPGVWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGR
2akaA           GASEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQ-
3ch4B           RVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFG------------------
3bh0A           IGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDKMA
2awnD           LGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVE
2dr3D           AMVDAFTAGIGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVL
2drcA           --NAMPFNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAC
2cckB           KVVLCDRYIDSSLAYQGYARGILNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGY
1ai4B           IRQTSRQDLNLRLFLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSML
3cmwC           VVDSVAALTPKAEIEGE--IGDSHMGLAARMMSQAMRKLAGNLK--------------------------
3dt7A           VAETSDGGVYWEGIDEPLAVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGI
3dfnC           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
1e6cA           QFMRAHGTVVYLFAPAESLQAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDAQPPAAIVELMQTM
2a5jA           LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKE
3dfnA           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
3bgwA           -------GEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQA
3bb1B           LLYVDRLDAYRVDNLDKLVAKAITDGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLA
1d6jB           DRDTARQLHEVATPGEETGLPFVEVYVDVPVEVAEQRAPYEAPANPEVHVKNYELPVQD--AVKQIIDYL
1dyhA           --AMPWNLPADLAW-FKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACG
3cmtD           MSQAMRKLAGNLKQSNTLLIFINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVKE----GENVVGSET
2ausC           PPDKRPIELHIQYGVINLDKPPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQAL
3dt4A           TNVAETSDGGVYWEGIDEPVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGR
4dfrA           MPWNLPADLAW----FKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACG
2d4hA           VYNSIAMDQLYYVTELTHRIRSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLFNL
3dfoD           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
3cr7D           A-RQLHEVAEETGLPDPKGLYKKAREGVIKEFTGISAP-YEAPANPEVHVKNYELPVQD--AVKQIIDYL
1cr0A           NDTF------------HLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKL--KGFA
3clvA           TLDRAKTWVNQLKISSNYIIILVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEE
3dfpD           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
1e9sJ           --------------RYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDL
2a2zA           EKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRI
2awnB           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIESRLH
3bpbA           --IMMVGDHFYIGESARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKP
3da4A           DKYDFNASTHRGIIGESLTRLGAMFSGKEYQILLPGEIHIKES---------------------------
3d3kA           --KDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHID-AKWSLALGLPLPLG
3cmvE           IV--VDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGVKE
3dfqA           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEE
2b92B           INQQAMDQLYYVTELTHRIRSKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKD
3d3qA           IAGYIQSLLYNYAFEISEDKKQVKLKLKEEYLASFDKESAKDIHPNNRKRVLRAIEYYKTKKLLSVQQFT
3bgwD           IGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDKMA
3dfnD           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
1e2gA           KLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQE-
1d6jA           SIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYELKQIIDYL
2d3wD           DLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLR
3dftD           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEE
3czjA           ----------------APLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAH
3dt4C           ETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGR
2bkhA           YLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQILQ-----
3dfqD           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEE
2bbtB           --ACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
3dfqC           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEE
3dftC           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEE
2c0bL           LARQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSAR
2awoC           --QRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL
2awnA           NDTPPAERGVGMVFQSYALEVINQRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL
3ecpA           ITISSEGSKAAQFIRNPNVSAEAIRKAGAMQTV----KLAQEFPELLAIEDTTSLSY-RHQVAEELGKLG
1dkiA           MAISELMADVGISVDMDYGPSSGSAGSSRVQRALKENFGYNQSVHQINRGDF------SKQDWEAQIDKE
3cr7A           DRDTARQLHEVTGLPVEKGLYKKAREGVIKEFTGISAPYAPANPEVHVKNYELPVQDAVKQIIDYLDTK-
2aunB           VLEATLRQLEVHGVDYHLGARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLE
2dr3F           ------TAGIGKSKEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIILQLL
3cr7C           DRDTARQLHEVTGLPFPKGLYKKAREGVIKEFTGISAP-YEAPANPEVHVKNYELPVQD--AVKQIIDYL
1aldA           -----------------PYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEE
1b0uA           RERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQL
1e9rD           ------IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDL
2bwjA           GYPREVKQGEEFGRRIGDPQLVICM--DCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVI
3dymA           --GDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVEKAAGHYQAEAALLQCTADTLADAVLITTAH
2boeX           R-DRIASVPQGTWFAHHNPGQ---ITGQVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSHIDEFAAGL
1bglA           ----------------APLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAH
2dflA           IYYIRAINTD--HQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENAVRQQKLNKHLHQLTRLA
1e4yA           --------ERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVH--APS
3bczC           LRIDQKIYGELWKTGFERSLQTDEDEHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKY
3cddF           ILGDNVKAARGRFSWRQRFSKFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSI-
2bhjA           AKARLEAVTKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHI
3cm0A           QAEALDRLLSETGTRL---LGVVLVEVPEEELVRILRRAELEGRSDDNEETVRRRLEVYREKTEPLVGYY
2c4rL           LELQHIAALGRPDFSSKIKLYTGEIPLFSHYQIESQIESAFQRGGSIVIDSTEALTAIDINSARGDIEET
1av6A           RSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYT
2aunA           VLEATLRQLEVHGVDYHLEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLE
2c9oC           GEINKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI
2cvfA           KTVDSNFALVVSITAHYRAEENRSGLIAKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKL
3cioD           SELLMRDRMRQLLEWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQA
3cbnA           LPDRESLVRVILRTENGYDEIRGYGTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDL------
1eilA           --YLGFAVKDVPAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYLEVDDAAALERMA
3be4A           LSEIGDSLTSVIYFEIDDSEIIERIS-GRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAV
3dfoC           -----------------PHSHPALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEE
3bjdB           LARIYRVEERFPAADLSRALSEEDFQKRLEQEIAAQSRERHPSYVFSGSASRAQLQVFLRHQWFRTFRLY
3cueF           VKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQ
2bkiA           YLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKE-----------
2eg5G           FPEESMHFLHSSGLVTEIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCIC
1drbA           --NAMPWNLPACLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACG
6aldA           -------------------SHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEE
1bmfC           -DADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPP-
3d31A           DPKRVLDTARDLKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAEMLSVLH
1dp0A           --KKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAH
2c7cH           ITVEDGTGLDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGK
1cjtC           ----------------------------------------------------------------------
3cnlA           FARSIGSFSEFFEDFAR--KRGLLKKGGVPDIERALMLFFTEAGRVSFERPE------------------
1dg3A           IGTINQQAMTELTHRIRSKSDSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFN
3bk7A           SNFYKTELLKPLGIIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHL
1cfrA           LSEFIYDLRSKLSL-----NNVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNF
3dyoA           ------------QFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAH
2d3wC           QETLDRIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDG
2d4hB           ADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDP
3dm9B           ------------------GIDVVLIDTAGRSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQF
1akeA           LDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEE
1dekB           YDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLM
2d2eA           AEFWTKVKKALELLDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARVNAMR
2bhvA           VESDIFAHMGKAVLIPKGSKVIGYYSNEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYTSA
3dhwC           VKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPTTRSILELLKDIN
2d2fA           TKVKKALELLDWDESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVAMR
2ccjA           LKVIPALKEKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNS
3bb1F           VLLYVDRLDAYRVDNLDKLVAKAITGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK
1ak2A           LDGFPRTVRQAEMLDDLMEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEP
1e59A           TAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPR
3crmA           MAKATARGRIPLLVGGTMLYYKA--LLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEAL
1e9sB           VVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFASNEAS
2an9A           TSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQS
2bhvD           IFAHMGKAVLIPKGSKVIGYYSNNNKMGYRLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVP
2bofX           AAQAAGKIPILVVSNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLE
1c9kC           -ITTMVTNLLFALGDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDI
1e9sM           VVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEA
2a1fF           -------------------------SQPIYKRILLKLSGE-----ALQGEDGLGIDPAILDRMAVEIKEL
2awoA           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRL
1e4vA           LLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGE
3a00A           QFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKA
2ancF           AKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIERLRMSRQKQRHDALISKLL--------------
1cjaA           RELLRTLIAHPGHESSQFHSIRDIITLYTGYDVGTEGSISMQEGFLATVRECASFDLLSWQESLQKCHNL
3dvlD           ---------------PEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASELFRLVARL
1e2kA           TDAVLAP----------------HIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAPPT
2bjbA           GTVAIDASASSQFV--SGLLLSAASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDDDSTPNRWQVRP
3ec1A           IHPRVYQLNEGQTLFFGGLARLDYIKGGRRSFVCYMANELTVH-RTKLEKADSLYANQLGELLSPPSKRY
4atjA           MKAAVESACPRTVSCADLAQQSVTLAGGPSWRVPLGRRDFLDLANANLPAPFFTLPQLKDSFRNVGLNRS
2ck3C           ----AMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLR-RPP
2a1fE           -------------------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKEL
1e9sI           WSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDL
2aumB           VLEATLRQLEVHGVDYHLEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLE
3bwdD           HYAPGVPIVLVGTKLDLRDDKQFFIDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVV
3cmvB           I------VVDSVAALTPKAEIEGEISHMGLAARMMSQAMRKLAG------------------------NL
2anbA           EAIEQVLATGVDVF---LDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQA
3bb1C           VLLYVDRLDAYRVDNLKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSE-ALLQVVRSGASL
2dr3C           -------AFTAGIGEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPARSIILQLKRV
1culC           FPPEFYEH--------------------------------------------------------------
3d3qB           RGKYIQSLLYNYAF---EDKKQVKLKLKELEHLN--NNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYY
3b55A           ---YNTNQIAKWLEAHAKPLKTTNPTASLNDLKPL--KNVGSASIVGLGEATHGAHE-VFTKHRIVKYLV
3cddD           -TQIADIVCKPFGIKGEPFQR-IQIEQGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVS--
3dlbB           ----EDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLP
3cr7B           PYRKDRDTARQLVETGLPFVEVYAEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQD
1cs4C           ----------------------------------------------------------------------
3cmuA           RSGAVDVIVVDSVAALTPKAEIEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLI-FINQIRMKIGVMFG
2b8wB           LLSS--TFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYL
2a1fD           -------------------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKEL
3bb1A           DRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSE-ALLQVVRSGASL
5dfrA           DRVIGPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACG
3c15C           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3bv4A           ------------------------TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEE
2ahwD           TLRAAAAHQPGIISDIFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFI-----------
2e85A           MGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDP-----
1e2iB           AVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAF
2aumA           VLEATLRQLEVHGVDYHLGRHVEARAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLE
2czvB           DHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLRFLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI
2c9gA           ----------------------------------------------------------------------
2bkeA           NNIYYIRAINTDHQIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLTRL
1e9sH           VVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEA
2bbtA           EKDNI-------------VLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
1bccF           YDDRMFRIKRALDLNMRQQI---LPKEQWTKYEEDVPYLEPYLKEVI-----------------------
1accA           --YTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTE------GLLLNIDKDIR
1e9rF           ----------------------------------------------------------------------
2b8tD           QFFDDAENGFVVIISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRKIDGKH------
3brwA           YPKASRLIVTFDEHVISNNFKFGVIYQKLGATSEEELFSTN-EESPAFVEFLEFLGQKVKLQDFKGFRGH
3bb1E           DRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK
1e9rG           ----------------------------------------------------------------------
2ancB           EAIEQVLATGVDV---FLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVAQAVAEMS
3d1mA           ----LAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNAL
3bm2B           LRAGRAPDWHFRERFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAGC-AVAQAA
3cnnA           IESSFSEFFEDFA-----RKRGLLKKGGVPDIERALMLFFTEAGRVSFERPE------------------
2ahvA           AAAHQPGIISDIGIGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAI------------------
2d7vA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dftA           LAGHTVVYLEISAAEGVRRTGGNDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGA-VVRHILSRL---
1e9sL           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2dftC           GVRAALAGHTVVYLEISAAEGGGDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGA-VVRHILSRL---
3di4A           VHDVIGTRCDPYTGNLLAGGHYHGLPLHEAELVHDVLNVFCTGFTYFKASPVRPGDYLEFFAEIDLLGNL
1e2iA           PPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHLDLAMLAAI
1e9sE           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2e85B           -------------CAAAPKGNWVVIDGGSAPENDIVARELRPTRLLIVDATDMGLNPGEIRII-----DP
1e2mB           TDAVLAPHIGGEAFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
1azsC           ----------------------------------------------------------------------
2a5vA           ISERIAGGSAIVGVTYQLD---------------------------------------------------
1eamA           -DVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLS
3a00B           -----YYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSGAHDKV--IVNDDLDKA
3dfdA           ----------------------------------------------------------------------
1ckvA           --FTITSELMGLDRKL------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e2nB           TDAVLAPHIGGLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVRLAKLDLAMLAAI
2b0lC           -------------------------------------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGN
2aexA           ----------------------------------------EEDELAHRCSSFMAPPVTDLGELRRRPGDM
2awoD           RTMIYVTHDQVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVEL------
1e2nA           TDAVLAPH-IGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA------------------
3bjqB           -----------------------------QARVVDP---------ILSTHARGYRQSTLIGKKLFPVAPV
3cphA           TIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKL
1e9sA           ----------------------------------------------------------------------
3ci2A           -----------------------------------------------------ELVGKSVEEAKKVILQD
1afrA           ------------------------------------TFISHGNTARQAKEHGDIKLAQICGTIA------
2a1fC           -------------------------SQPIYKRI-----LLKLSGEALQGEDGLGIDPAILDRMAVEIKEL
3dffA           RRKEDIAALDHLRVAHRHGRFLDSIRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDL-VGEVADDIRSII
3dm5B           KDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAF
3cddC           LTQIADIVCKPFGIKVIVNTDVIQIEQGETPH-ELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLI
3d1mB           ------------NVAEKTLGASGRYEGKITRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNAV
3b85B           EVAPLAYRGRTLNDAFVILDEAQNTTPAQKFL----TRLGFGSKVVTGDSGLRLVRHILRGVDDVFSELT
1e1qB           YLAPYSGCSMGEYFRDNGKHALIPPGREAYPGDVFYLHSRLLERAAKMNDAF------------------
1ek0A           SFIKARHWVKELHEQASKDIIIADLQEGGERKVAREEGLAEEKGLLFFE--TSAKTGENVNDVFLGIGEK
2ancD           ----------------------------------------------------------------------
1chdA           --------------------------------------LLSSEKLIAIGASTGGT-----EAIRHVLQPL
1dwmA           -----------------------------------------------------ELVGKSGNMAAATVERE
3c14C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           -----------------------------KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQKERKG
1e2hB           GEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL
1d8jA           --TRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLTEALVNNPKIEVIDGKYAFKPK-------------
3bb1G           DRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRS---GA
2a5vB           SERIAGGSLAIVGVTYQLDDRAVLRDHIGNIGEE------------------------------------
1e2jA           PPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQR
1e2lA           LAPHIGGEAGSPPPALTLIFDHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALIDRL
1cjuC           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1e2lB           MGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAARYLMGS----MTPQAVLAFVALIPPT
1dvrA           LVGFPRTIPQAEKLDQMLTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEA
1e9sK           ----------------------------------------------------------------------
1e2kB           TDAVLAPHIGGFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPG-------------------
3e02A           CVFGILGHRTIADRLFGQDYYLSVLAAGRHQPFVTSAILGGNVRVGLEDSGKGQLATSNAEQVRKIRRII
2cdnA           YPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDV----ILNRMKVYRDETAPL
3c85A           ----------------------LQRRNYKGQIAAIAEYPD-QLEGLLESGVDAAFNIYEAGSGFHVCKQL
1e2mA           AVTD----------AVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAARYMGSMTPQAVLAFVALIPPT
2bhvC           GSKVIGY------------YSNNNKMGEYRLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRY---
1e2jB           TDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAV--------------------
2bwjB           ----------------------------------------------------------------------
3dkvA           SDCERGFLLDGFPRTVAQAEALEEILEEMGRPIDYVINIQVDKEELMRICSVCGTTYHLVFNPPKTPGIC
3dmdA           ----------------------------------------------------------------------
1ckeA           VSGEIRTQEVANAASQVAAFPRVREALLRRQRALIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQL
2bwjD           ----------------------------------------------------------------------
1dekA           LEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNN
3cddB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e2hA           AVLAPHIGGEAGSPPPALTLIFAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ
3bs4A           -IMPGVWYLEGMLSSETLPIKYAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLET-
3dofB           -------------------------------------AVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDT
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RADGRALLYISHKLEEVKRLCDTATILRAGRVVAACNPRAETAASLARMMVGVDVIPPKPQPGHSIGAPR
3cmvG           EGEVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINLGVKEKLIEKAGLAAALGQIEKQFGKGSIMRLGE
3dmdC           EAVKIDGIILTKLDADARGGAALSISYVIDAPILFVDLRPFEKEWFLERIFG------------------
3cmvH           VKEGENVVGSETRVKVVKNKIAAPFKQAEFQIL-------------------------------------
2d3wB           RDGKRSFIIVTHYRILDYIKPDYVHVLYQGRIVKSGDF--------------------------------
2bifA           SPDYVNRDSDEATEDFMRRIECYENSYESLD---------------------------------------
1bifA           SPDYVNRDSDEATEDFMRRIECYENSYESLDEEQDRDL--------------------------------
2dwoA           SPDYKDCNSAEAMDDFMKRISC------------------------------------------------
3c95A           WQYADEIV--------------------------------------------------------------
3b5jA           C-KGRTVIIIAHRLSTV-KNADRIIVMEKGKIVEQGKHK-------------------------------
2c61B           GIY-----PPINVLPSLSRLMNSGIGAGKTREDH------------------------------------
1aroP           KPEAVAYITIKTTLACLTSADNTTVQAVASAIGR------------------------------------
3cmvC           EGESETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELTAKEIEKKVRELLALGQIEKQFGKGSIMRLGE
3b60A           LQKNRTSLVIAHRLSTI-EQADEIVVVEDGIIVERGTH-SELLAQVYAQLHK------------------
2ccjB           RLDQEDLKFHEKVIEGYQEIIQRFKSVNADQPLE------------------------------------
1d1cA           A--MDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGE--------------------------------
2bbsA           LMANKTRILVTSK-MEHLKKADKILILHEGSSYFYGTFSENLRPDFSSKLMSFDQFSAERR---------
2c03B           EKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGLEPFYPERLAGRILG------------------
2ccgB           LDQDLKFHEIEGYQEIIHNESQRFKSVNADQPLE------------------------------------
3dmdB           EAVKIDGIILTKLDADARGGAALSISYVIDAPIL------------------------------------
2a2zD           HYKESWLLHRTLKTNFDYLQEVPILTLDVNEDF-------------------------------------
3eiuB           ELHRKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVSD-------------------------------
2dwpA           SPDYKDCNSAEAMDDFMKRISC--YEASYQPLD-------------------------------------
1e9fA           ENGAFQERALRCFHQLMKDTTLNWKMVDASKSI-------EAVHEDIRVLS-------------------
3eiuA           ---RKGIYPPINVLPSLSRLMNSGIGAGKTREDHKAVS--------------------------------
2ccgA           RDQNRLDQEDLKFHEKVIEGYQEIIHNESQRFKS------------------------------------
1bg0A           DHLRIISMQKGGDLKTVYKRLVTAVDNIESKLPFSHDDRFGFLTFCTTMRASVHIQLPKLAKDRKVLEDI
2czvA           ---GMEIPQAKASISMY-----------------------------------------------------
2a30D           HYKESWLLHRTLKTNFDYLQEVPILTLDVNEYE-------------------------------------
2d62A           RQLGVTTIYVTH---DQVEATGDRIAVNKGELQQVGTPDEVYYKPVNTFVAGFIGSPPNFLDATITDDGF
1e98A           ----FQERALRCFHQLMKDTTLNWKMVDASKRIEAVHEEIRVLEDAIRTATE------------------
3cmvA           KQSNTLLIFINQGGNALKFYASVRLDIRRIGAVK------------------------------------
2dr3A           AGTGCTSIFVSQVSGFGPHGVDGIIRLDLDEIDGELKRS-------------------------------
2b8tA           ADYNDDIVKIGC-QEFYSAVCRHH-HKVPNRPYLNSNS--------------------------------
3cmxA           KN-----KIAAPFKQAEFQILYGEGINFYGELVDIEKAGAWYSYKGEKIGQGKA----------------
2dr3B           AGTGCTSIFVSQVSVGERGFGGPGVEGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKG
2akaB           PQGQRTIG-VITKLDLMDEGTDARDVLENKLLPLRRGYIGV-----------------------------
1e9cA           ENGAFQERALRCFHQLMKDTTLNWKMVDASKSIE------------------------------------
1e69A           -SKHTQFIVITHNKIVM-EAAD------------------------------------------------
2d4uB           DR--------------------------------------------------------------------
2awnC           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
3b2qA           KGSVTQIPILSM-PGDDITHPIPDLSGYITEGQ-------------------------------------
3czpB           DKRFARVKVLRTINDAIEAA--------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2a30B           HYKESWLLHRTLKTNFDYLQEVPILTLDVNEYESLVE---------------------------------
2cckA           RLDQEDLKFHEKVIEGYQEIIRFKSVNADQPLENVVDTYQTIIKYLEK----------------------
3dm5A           EATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKIDDIEPFDPPRFVSRLLG------------------
1cr4A           KSTGVVLVVICHLKGALRQLSDTIIALERNQLVLVRILK-------------------------------
2cjwB           LFEGIVRQVRLRRDSKE-KNERRLAYQKRKE---------------------------------------
2b8wA           LPRCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDFVQQVADFCSYIFS------------------
3b2qB           GI-----YPPINVLPSLSRLMNSGIGAGKTREDHKAVSD-------------------------------
2c03A           DEKGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEK-----------------------------
2axpA           ELE-------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2c9yA           EPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHS-------------------------------
3a1wA           ----------------------------------------------------------------------
2d0kA           DVPEIFVIGGGRVYEQFLPKAQKLYLTHIDAEVE------------------------------------
1e2dA           FQE----RALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIR-----------------------------
3dtbB           RIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
2bdtA           LKTNPRFIF-------------------------------------------------------------
2cgtH           LLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRR-------------------------------
3b85A           V---------------------------------------------------------------------
2c04A           EKVGVTGLVLTKLDGDARGAALSARHVTGKPIYFAEGLEPFYPERLAGRILG------------------
1e9dA           ENGAFQERALRCFHQLMKDTTLNWKMVDASKSIE------------------------------------
1e0jB           KSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLV---------
4dcgA           NKIVRNKVVVNFDYPNQEYD-----YFHMYFMLRTVYC--------------------------------
1e9rA           S---------------------------------------------------------------------
2dr3E           AGTGCTFVSQVSVGPGVEHGVDGIIRLDLDEIDGELKRSLIVWK--------------------------
2b8tB           HADYNDDIVKIGCQEFYSAVCRHH-HKVPNRPYLNSNSE-------------------------------
2b8tC           HADYNDDIVKIGCQEFYSAVCRHHHKVPNRPYL-------------------------------------
2d4uA           DRLHDIAVSDNN----------------------------------------------------------
1e3mB           NKIKALTLFATHYFELTQLPEKEGVANVHLDALEDTIAFHSVQDGAASKSYGLAV---------------
1e9sD           LEGTLAESLFAGSNEASKALTSARFVLSDKLPEH------------------------------------
1e2fA           NGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHE---------------------------------
1e0jA           KSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDMPNLV---------
1e9sG           FVLSDKLPEHVTMPDGDFSIRS------------------------------------------------
2a2zB           HYKESWLLHRTLKTNFDYLQEVPILTLDVNEDF-------------------------------------
2a30A           HYKESWLLHRTLKTNFDYLQEVPILTLDVNEYESLVE---------------------------------
1e9sF           RGFLEGESLFAGSNEASKALTS------------------------------------------------
1e3mA           NKIKALTLFATHYFELTQLPEKEGVANVHLDALEHGDTIASVQDGAASKSYGLAVAALAGVPKEVI----
1dhiA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE------------------------------------
1e3aB           KRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNI------------------------------------
3c8uA           DLEARRWLDHGLNHDAAVARAQGNDLANARAIEAARLP--------------------------------
2bv7A           LVNYTATIDVIYEMYTRMNAELNYKV--------------------------------------------
2bc9A           EADPDEYLTYSLKLKKGTSQKDETFNL-------------------------------------------
1e9rE           RGFLEGTLLFAGSNEASKALTSARFVLSDKLPEHVTMP--------------------------------
421pA           ----------------------------------------------------------------------
2axzC           NQFKNISINGYYDLEIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLV-------------------
1cr1A           KSTGVVLVVICHLKGALRQLSDTIIALERNQLV-------------------------------------
1draA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE------------------------------------
1adoA           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD----------------------------------
3dauA           GDVEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPD-----------------------------
3dfpC           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD----------------------------------
1dhjA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDDWESVSSEFHDADAQNSHSY---------
2c61A           VTQIPILSMPGDDITHP-IPDLSGYITEGQIVVARELH--------------------------------
1cr2A           KSTGVVLVVICHKSGALRQLSDTIIALERNNLV-------------------------------------
3czpA           DKRFARVKVLRTINDAIEAA--------------------------------------------------
2d3wA           RDGKRSFIIVTHQRILDYIKPDYVHVLYQGRIVKSGDF--------------------------------
3bo6B           SGRDGGQSQALREEPFYRLMAE------------------------------------------------
2bbsB           LMANKTRILVTSKM-EHLKKADKILILHEGSSYFYGTF--------------------------------
2bx2L           GDIEE--TAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRAVENRLREAVRQDRARIQISHSR
3adkA           AFYEKRGIVRKV----------------------------------------------------------
3d7wA           INSGASFLPDVYMLTSWGQQSTQVQHSTDGVFNNP-----------------------------------
3dt2A           RPAGVPLVYEALSWQHGVFVGATAAAEHKGKVIMHDPFA-------------------------------
2akaA           --AMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGAGE--------------------------------
3ch4B           --DFDWVIENHGVEQRLEEQLENLIEFIRSRL--------------------------------------
3bh0A           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRE--------------------------------------
2awnD           LPMPRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQL------------------
2dr3D           AGTGCTSIFVSQVSVGERGFGGGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHPFDITDKG
2drcA           GDVPIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE------------------------------------
2cckB           QEIRFKSVNADQPLENVVEDTY------------------------------------------------
1ai4B           KRTVVAAVPMPFDKWYSASGYETTQDGPTGSLNI------------------------------------
3cmwC           ----------------------------------------------------------------------
3dt7A           RPAGVPLVYEALSWQHGVFVGATAAAEHKGKVIMHDPFA-------------------------------
3dfnC           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
1e6cA           R---------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3dfnA           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
3bgwA           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLLYRDDYYDKESESKNIVEVIIAKHRDG-PVGTVS
3bb1B           SDIPVVLIENSGRCNSDEKVLPNGIAWIPHLV--------------------------------------
1d6jB           DTKG------------------------------------------------------------------
1dyhA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE------------------------------------
3cmtD           RVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDIEKAGAWYSYKGEKIGQGKA----------------
2ausC           LPAGKEYVALMHLHGDV-PEDKIRAVMKEFEGE-------------------------------------
3dt4A           RPAGVPLVYEALSWQHGVFVGATAAAEHKGKVIMHDPF--------------------------------
4dfrA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE------------------------------------
2d4hA           PRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQD------------------------------------
3dfoD           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
3cr7D           DTKG------------------------------------------------------------------
1cr0A           KSTGVVLVVICHDLRALRQLSDTIIALERNQLV-------------------------------------
3clvA           IYKNI-----------------------------------------------------------------
3dfpD           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
1e9sJ           RGFTLAESLFAGSNEASKALTSARFVLSDKLPEH------------------------------------
2a2zA           YLRGRNEQGIPLEYLEKLHYKHESWLLH------------------------------------------
2awnB           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
3bpbA           EFQDFNIIEIPEEE----SYAANCIWVNERVIMPAGYPRTREKIARLGYRVIEVDTSEYRKID---GGVS
3da4A           ----------------------------------------------------------------------
3d3kA           EHAGRIYLCDIGIPQQVFQEVGINYHSPFG----------------------------------------
3cmvE           GENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFY--------------------------------
3dfqA           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
2b92B           ETFNLPRLCIRKFF----PKKKCFVFDRPVHRRKLAQLE-------------------------------
3d3qA           ENYDTLLIGIESRETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAIG------------------
3bgwD           RELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDKESESKNIVEVIIAKHR
3dfnD           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD----------------------------------
1e2gA           -------RALRCFHQLMKDTTLNWKMVDASKSIE------------------------------------
1d6jA           DTKG---YLPAKK---------------------------------------------------------
2d3wD           DGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDF--------------------------------
3dftD           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
3czjA           AWQQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARILNCQLAQVAERVNWLGLGPQENYPDRLTA
3dt4C           RPAGVPLVYEALSWQHGVFV---GAAMRSEATAAAE----------------------------------
2bkhA           ----------------------------------------------------------------------
3dfqD           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
2bbtB           LMANKTRILVTS-KMEHLKKADKILILHEGSSYFYGTFSENLRPDFSSKLMD------------------
3dfqC           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD----------------------------------
3dftC           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
2c0bL           AADEIARQLRLRDLGGVIDFIDMTPVRHQRAVENRLAVRQDRARIQISHISRFGLLEMSRQRLS------
2awoC           HKRGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2awnA           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATA
3ecpA           SIQDKSRGWWVHSVLLLEATTFRTVGLLHQEWWMRPDD--------------------------------
1dkiA           LSQNQPVYYQGV------GKVGGHAFVIDGADG-------------------------------------
3cr7A           ----------------------------------------------------------------------
2aunB           AASPRPLIGFSDISVLLSAFHRHGLPAIHGPVATEQQERLASLASVSRLLAGIDHELPVQHLGGHKQRVE
2dr3F           AGTGCTSIFVSQVSGGVEHGVDGIIRLDLDEIDG------------------------------------
3cr7C           DTKG------------------------------------------------------------------
1aldA           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
1b0uA           AEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPFGNPQSPRLQQFLK------------------
1e9rD           RGFLEAESLFAGSNEASKALTSARFVLSDKLPEHVTMP--------------------------------
2bwjA           AYYETKTQLHKIEGTPEDVFLQLCTAIDSI----------------------------------------
3dymA           AWQQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVA-------------------
2boeX           KNRPAYIIVEPDLISLMSSCMQHVQQEVLETMA-------------------------------------
1bglA           AWQQGKTLFISRKTYRIDGSGQMAITVDVEVASDPHPARIGLNCQLAQVAERVNWLGLGPQENY------
2dflA           EVYDIAVIITNQVMHTLYHVPGIRIQLKKSRGNVVDAPHLPEGEVVFAL---------------------
1e4yA           GRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET------------------------------------
3bczC           LADPSNLFVVSSDDESQGEIYRSIEHLDKGSIINYLKKYHNTICGRHPIGVLLNAITELQKNGNSFSFLN
3cddF           GKSNAEYTVTGWRIPQTGNINTLVPVIDEIGLDE------------------------------------
2bhjA           LYANNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDG---------------------------
3cm0A           EARGVKRVDGLGTPDEVYARIRAA----------------------------------------------
2c4rL           AFTNLEAADEIARQLRL-RDLGGLIVIDFIDMTPVRHQRA------------------------------
1av6A           GENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQ-----------------------------
2aunA           AASPRPLIGFSDISVLLSAFHRHGLPAIHGPVATGLGLRLASLASVSRLLAGIDHELPVQHLGGHKQRVE
2c9oC           PLDLDRVMIIRTMLYTPQEMKQ---IIKIRAQTEGINISEEALNHLGEIG--------------------
2cvfA           PKPGLRVAVLERHRFRPEGLMAYFRITERGIEDV------------------------------------
3cioD           GVNIKGAI--------------------------------------------------------------
3cbnA           --RKGRELKVEIIVEYEGH---------------------------------------------------
1eilA           DKLRQAGVAFTRGDEA--LMQQRKVMGLLCLQD-------------------------------------
3be4A           KVRDVFHKQTAPLVKFYEDLGILKRVNAKLPPKEVT----------------------------------
3dfoC           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD----------------------------------
3bjdB           R-DAADLLVNLTDVDEA-AALARYLYGELGEEDEKGSHPRLLAKLLEAIGLEADFQAV------------
3cueF           IKESM-----------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2eg5G           ---KGVELDARNAIDLLEMAINDLVVEGHLEEEKLDSF--------------------------------
1drbA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHF-------------------------------
6aldA           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKA------------------------------------
1bmfC           GREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVI--------------------------------
3d31A           KKNKLTVLHITHDQTEARIMADRIAVVMDGKLIQVGKP--------------------------------
1dp0A           AWQQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARI-----------------------------
2c7cH           PLLIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLED
1cjtC           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1dg3A           LPRLCIRKFFPK----------------------------------------------------------
3bk7A           EKNEKTALVVEHDVLMIDYVSDRLIVFRHGRALPPMGMREGMNRFLASVGITFRRDPDSGRP--------
1cfrA           IDYELEHIKSFLSVKTTFRPDRRLQLAH------------------------------------------
3dyoA           AWQQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWD
2d3wC           KRSFIIVTHYQR--ILDYIKPDYVHVLYQGRIVKSGDF--------------------------------
2d4hB           EFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLE------------------------------------
3dm9B           EAVKIDGIILTKLDADARGGAALSISYVIDAPI-------------------------------------
1akeA           LTTRMTAPLIGYYSKEAEAGNTKYAKVDGTKPVA------------------------------------
1dekB           QALGTDLIVNNFDRMYWVKLFALDYLDKFN----------------------------------------
2d2eA           GPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGP--------------------------------
2bhvA           FGDYLLMQLMRQSGMGINQVVNQIL----RDKSKIAPIVVIREGSRVFISPNTDIFFPIP----------
3dhwC           RRLGLTILLITHEMDVVKRICDCVAVISNGELI-------------------------------------
2d2fA           GPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGP--------------------------------
2ccjA           NRLQEDLKFHEKVIEGYQEIIHRFKSVNADQPLE------------------------------------
3bb1F           K-DIPVVLIENSGRCNKNDSDE--KVLPNGIAWIPHLVQTITEVALNKSE--------------------
1ak2A           LIRDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASIL-------------------
1e59A           MKSGERVIIAAHG-NSLRALVKYLDNMSEEEILELNIPTG------------------------------
3crmA           HA-----RSDLHAGLPSIRAVGYRQVWDYLDGKL------------------------------------
1e9sB           KALTSARFVLSDKLPEHVTMPD------------------------------------------------
2an9A           HYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQR----HDALISKLLA------------------
2bhvD           FGDYLLMQLMRQSGMGINQVVNLRDKSKIAPIVVIREGS------RVFISPNTDIFFPIP----------
2bofX           TMA-YAGKALKAGSSQARIYFDAGHSAWHSPAQMAS----------------------------------
1c9kC           AGRV---------NQRLAAAADEVWLVVSGIGVK------------------------------------
1e9sM           ----------------------------------------------------------------------
2a1fF           VEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGML--------------------------------
2awoA           HKRGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
1e4vA           ELTTRTAPLIGYYSKEAEAGNTKYAKVDGTKPVA------------------------------------
3a00A           YKELKDFI-FAEK---------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjaA           SISPQAIPFILRML--------------------------------------------------------
3dvlD           KQIGATTVMTTERIEEYGPIAR------------------------------------------------
1e2kA           LPGTNIVLGALPEDRHIDRLAK------------------------------------------------
2bjbA           GPVAARRWDIEPDLTNAVAFLSAAVVSG-GTVRITVQPADHILAILRQLNAVVIHAD-------------
3ec1A           --AAEFPPLVPR-SLSVKERKTDIVFSGLGWVTCNDPG--------------------------------
4atjA           SDLVALSGGHTFGKNQCRFIMDRLYNFS-NTGLPDPTLNTTYLQTLRGLC--------------------
2ck3C           GREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVI--------------------------------
2a1fE           VEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGML--------------------------------
1e9sI           RGFTLAESLFAGSNEASKALTSARFVLSDKLPEH------------------------------------
2aumB           AASPRPLIGFADISVLLSAFHRHGLPAIHGPVATGLGLRLASLASVSRLLAGIDHELPVQHLGGHKQRVE
3bwdD           L---------------------------------------------------------------------
3cmvB           KQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENV-------------------------------
2anbA           VAEMSHYAEVNDDFDTALTDLKTIIRAERLRMSRQKQR--------------------------------
3bb1C           KSDIPVVLIENSGRCNKNDSDE--KVLPNGIAWIPHLVQTITEVALNKSE--------------------
2dr3C           LAGTGCTSIFVSQVSGVEHGVDGIIRLDLDEIDGELKRS-------------------------------
1culC           ----------------------------------------------------------------------
3d3qB           ENYDTLLIGIESRETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAIG------------------
3b55A           SEKGFTNLVLEEGWDRALELDR------------------------------------------------
3cddD           LILGDNVKAARGRFSWRQR---------------------------------------------------
3dlbB           WEERRRTREIASWIGRRLGLGTPEAVRAQAYRLS------------------------------------
3cr7B           AVK-------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3cmuA           NPETTTGGNALKFYASV-----------------------------------------------------
2b8wB           TSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRP--------------------------------
2a1fD           VEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGIC
3bb1A           KSDIPVVLIENSGRCNKNDSDE--KVLPNGIAWIPHLVQTITEVALNKSE--------------------
5dfrA           DVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHF-------------------------------
3c15C           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3bv4A           NRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD----------------------------------
2ahwD           ----------------------------------------------------------------------
2e85A           DDIAEMFMMTTHNMPLNYLIDDIGEVIFLGIQPDIVGFY-------------------------------
1e2iB           VALIPPTL--------------------------------------------------------------
2aumA           AASPRPLIGFADISVLLSAFHRHGLPAIHGPVATGLGLRLASLASVSRLLAGIDHELP------------
2czvB           MEIPQAKASISMYPEIIKRL--------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2bkeA           AEVDIAVIITNQVVPGI---RIQLKKSRGNRRIAVDAPHLPEGEVVFALT--------------------
1e9sH           SKATSARFVLSDKLPEHVTMPDGDFSIRSWL---------------------------------------
2bbtA           LMANKTRILVTSK-MEHLKKADKILILHEGSSYFYGTF--------------------------------
1bccF           ----------------------------------------------------------------------
1accA           KILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKT--------------------------------
1e9rF           ----------------------------------------------------------------------
2b8tD           ADYNDDIVKIGC-QEFYSAVCRHHHKVPNRPYLN------------------------------------
3brwA           GQTGTESVYCNFRNKEPYTEGDAQQLQRKRHIGNDQDENTPFVPDMIASNFLHAYVVVQAEG--------
3bb1E           KASDIPVVLIENSGRCNKN-DSDEKVLPNGIAWI------------------------------------
1e9rG           ----------------------------------------------------------------------
2ancB           HYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDA-----------------------------
3d1mA           AIPGVKLRVTEGWDEDGHHSEE--SLHYEGRAVDITTSD-------------------------------
3bm2B           VAQGFGGIWRSGALTESPVVREAFGCREQDKIVG------------------------------------
3cnnA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3di4A           SACPGGDCSSEASCHPLLVE-----IFAPAEGLGD-WPSPSVNGYDRS----------------------
1e2iA           RRVYGLLANTVRYLQCGGSWREDWGQLSGTGPR-------------------------------------
1e9sE           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2e85B           DDIAEMFMMTTHNMPLNYLIEDIGEVIFLGIQPD------------------------------------
1e2mB           AKLDLAMLAAIRRVYG--LLANTVRYLQCGGSWRED----------------------------------
1azsC           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1eamA           IYTGENMRLTRVTKSDAVNYAKKMYYLNKIVRNKVVVN--------------------------------
3a00B           YKELKDFI-FAEK---------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e2nB           RRVYGLLANTVRYLQCGGSWREDWGQLS--GPQSNAGPRPHIGDTLFTLFRAPELLAPNGDL--------
2b0lC           EGLLVASKITRSVIVNALRKLESAGVIESRSLGMKGTY--------------------------------
2aexA           KTKCQALAQVDGGANFSVDRWERKEGGGGISCVLQDSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFC
2awoD           PMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIAETQIHIQIPSIRQNLVYRQNDVVLVEEGATFA
1e2nA           ----------------------------------------------------------------------
3bjqB           AQYGGKILTFGKRLYNTKRNTKRIDFGYEGDPY-------------------------------------
3cphA           IQEKIDSNKLVGVG--------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3ci2A           KPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLDNIAQVPR-------------------------------
1afrA           ADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRKKIS--------------------------------
2a1fC           VEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGIC
3dffA           DEFDPTLVVTCA---AIGEHPDHEATRDAALFATHEKN--------------------------------
3dm5B           KEATPIGIIVTKLDGSAKGGGALSAVAATGAPIKIDDIEPFDPPRFVSRLLGLGDI--------------
3cddC           L---GDNVKAARGRFSWRQRFSKFTIKADSAGLP------------------------------------
3d1mB           MNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRSKYGMLARLAVEAGFDWVYYESKAHIHCS-
3b85B           SSDVVRHQLVGHIVDAY-----------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1chdA           PLSSPAIITQHMPPGFTRSFAERLNKLCQISVKEAEDG--------------------------------
1dwmA           NRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSVPH-------------------------------
3c14C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           DYLGKTVQVVPHITDAIQEWVMRQALEPQVCVIELGMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSTGE
1e2hB           AKRDLAMLAAIR--RVYGLLANTVRYLQCGGSWREDWGQ-------------------------------
1d8jA           ----------------------------------------------------------------------
3bb1G           SLSDIPVVLIENSGRCN-KNDSDEKVLPNGIAWIPHLVQ-------------------------------
2a5vB           ----------------------------------------------------------------------
1e2jA           PGERLDLAMLAAIRRVYGLLANTVRYLQCGGSW-------------------------------------
1e2lA           AKRQRDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTL-------------------
1cjuC           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1e2lB           LPGTNIVLGALPEDRHIDRLAK------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3e02A           EELSLDIATPDEARAL------------------------------------------------------
2cdnA           EYYRDQLKTVDAVFARALRALG------------------------------------------------
3c85A           EPQ-------------------------------------------------------------------
1e2mA           LPGTNIVLGALPEDRHIDRLAK------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3dkvA           DKDGGELYQRADDNEETVTKRLEVNMKQTAPLLAFYDSKE------------------------------
3dmdA           ----------------------------------------------------------------------
1ckeA           QVKGFSNFERLLAEIKLVPAADALVLDSTTLSIEQV----------------------------------
2bwjD           ----------------------------------------------------------------------
1dekA           FDMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEM-----------------------------------
3cddB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e2hA           RPGERDLAMLAAIRRVYGLLANTVRYLQCGGS--------------------------------------
3bs4A           ----------------------------------------------------------------------
3dofB           EENKLTPIFNEYISLVEKYIEE------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           --------------------------------------------------------------------TQ
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LVVNGLSLAPDDPHGVTLKQIDLQLRXXXXXXXXXXXXXXQDELFAALSGEAPLDEARTILIDGQAAGDL
3cmvG           DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG-------KTCAFID
3dmdC           ----------------------------------------------------------------------
3cmvH           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
3cmvC           DRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREG-KTCAFIDA---EH
3b60A           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1bg0A           ASKFNLQVRGTRGEHTESEGGVYDI---------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2d62A           LDFGEFKLKLLQDQF-------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2dr3B           IIVYP-----------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3dtbB           LGKKCFALRIASRLAKEILGITNPEG--------------------------------------------
2bdtA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bx2L           FGLLEMSRQRLSP---------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2dr3D           IIVYP-----------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           LAFIKEY---------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3bpbA           CMS-------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3bgwD           DGPVGTVSLAFIKEYGNFVNLE------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3czjA           ACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGT
3dt4C           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awnA           IDQVQVELPMPNRQ--------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2aunB           GALIGGNLTAL-----------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3bczC           YAQSSQCRNWQD----------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2aunA           GALIGGNLT-------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2c7cH           L---------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dyoA           LPLSDMYTPYVFPSENGLRCGTRELNQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLIDGFHMGDD
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
2aumB           GALIG-----------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a1fD           DTYN------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2aexA           AMGVSSVIHPKNPHAPTI----------------------------------------------------
2awoD           IGLERCHLFREDGTAC------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2a1fC           DTYN------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           QKTKPTQNSVRELRGLGLSPDLVVCR--------------------------------------------
1e2hB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3e02A           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
2d3wB           LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGTVEFKGKDLLAL
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           SRVQKIWVPVDHR---PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIG-VPTKVFNVGEYRR
3c95A           -------------------------------------------VLAQANTLRPEDADR-LGINRQHCLDN
3b5jA           ----------------------------------------------------------QVLIDGHDLALA
1aroP           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------VIMTREPGGVPT
2ccgB           -------------------------------------------VINEVYHRLVKDY-DVIMTREPGGVPT
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
2dwpA           ----------------------------------------KTYISKKLTRYLNWIGVP-TKVFNVGEYRR
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
2czvA           -----------------VKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKL-REARKEYGKVAIL
2a30D           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------KYLVFKPKIDTR
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------SGIVTRRPLVLQ
1e9cA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e3mB           -----------------------------------------------------AYTLNYTCPTFIDKPGI
2a30A           ----------------------------------------------------------------------
1e3mA           -------------------------------------------RAYTLNYTCPTF-IDKPGIRITEGRHP
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SITARRRFGAAFIPEQRLGHATVPTMRLSENALLTSHADPGVVRRGFVDRAALLGLVDRVTAAFGVRKAQ
3cmvG           AEHALDPIYARKLGVDIDNLLCSQPDTGEQAEICDALARSGAVDVIVVDSAALTPKAEIEGLAAR-----
3dmdC           ----------------------------------------------------------------------
3cmvH           -------------------------------------------------------VVDSVAALTPKAEIE
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
3cmvC           ALDPIYARKLGVDIDN---LLCSQPDTGEQALEICDALAR--------SGAVDVIVVDSVA-------AL
3b60A           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3czjA           WLNIDGFH-MGIGGDDSWSPSVSAEFQLSAG---------------------------------------
3dt4C           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1cfrA           ----------------------------------------------------------------------
3dyoA           SWSPSVSAEFQ-LSAGRY----------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3e02A           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
2d3wB           SPEDRAGEGIFMAFQY---PVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPDLL
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           EAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVK----------------------------SYLAKEG
3c95A           LKILRENPQVREKVVAIFAESDNVDAQLYNGFFSDADRAAMVLETEPRNLPALDITFVDKRIEKLLFNYR
3b5jA           DPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIV-------
1aroP           --------------------------------------------------------ERLAREQLALEHES
2ccjB           GEEIRKIVLEGNDMDIRTEAMLF------AASRREHLVLKVIPALKEGKVVLCDRYIDS-----------
2ccgB           GEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPAL---------KEGKVVLCDRYI----------
3dmdB           -------------------------------------------------------------AIQHAKARG
2a2zD           ----------------------------------------------------------------------
2dwpA           EAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVK----------------------------SYLAKEG
1e9fA           ----------------------------------------------------------------------
3eiuA           --------------------------------------------------------------------AT
2ccgA           ----------------------------------------------------------------------
2czvA           LSNPKPSLVRDTVQKFKSYLIYVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLL
2a30D           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           SIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISG
2dr3B           ----------------------------------------------------------------------
2akaB           LVNSTTEYAE-FLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMT
1e9cA           -------------------------------------------------------------VVDRYAFSG
2awnC           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2d0kA           -----------------------------------------------LAVDRVIGNENALPWNLDLAWFK
1e3mB           RITEGRHPVVEQVLNEPF-IANPLNLSPQRRLIITG---PNGGKSTYRQTALIALAYIGSYVPAQKVEIG
2a30A           ----------------------------------------------------------------------
1e3mA           VVEQVLNEP--FIANP---LNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVE--------I
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------IGMENAMPWNLPADLAWF-----K
3dfpC           ----------------------------------------------------------------------
1dhjA           ------------------------------------------------MENAMPWNLPASLAWF-----K
2bx2L           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
1dyhA           -------------------------------------------------------MPWNLPADLAWFKRN
4dfrA           ------------------------------------------------------AMPWNLPADLAWFKRN
3dfoD           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
3dyoA           --------------------------------------------------------------------RA
2ccjA           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RDPEAERLSGGNLQKFIVGREILRQPKLLVVNQPSWXXXXXXXXXXXXXXXXXXXGGAAVLVISQDLDEL
3cmvG           ------MMSQAMRKLAGNLKQSNTLLIFINQGGNAASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAA
3dmdC           ----------------------------------------------------------------------
3cmvH           GLAARM-MSQAMRKLAGNLKQSNTLLIFINQGGNLKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK
2d3wB           ----------------------------------------------------------------------
2bifA           ----------------------------------------------------------------------
1bifA           ----------------------------------------------------------------------
2dwoA           ----------------------------------------------------------------------
3c95A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2c61B           ----------------------------------------------------------------------
1aroP           ----------------------------------------------------------------------
3cmvC           TPLAARMMSQAMRKLA--GNLKQSNTLLIFINQGFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIA
3b60A           ----------------------------------------------------------------------
2ccjB           ----------------------------------------------------------------------
1d1cA           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2c03B           ----------------------------------------------------------------------
2ccgB           ----------------------------------------------------------------------
3dmdB           ----------------------------------------------------------------------
2a2zD           ----------------------------------------------------------------------
3eiuB           ----------------------------------------------------------------------
2dwpA           ----------------------------------------------------------------------
1e9fA           ----------------------------------------------------------------------
3eiuA           ----------------------------------------------------------------------
2ccgA           ----------------------------------------------------------------------
1bg0A           ----------------------------------------------------------------------
2czvA           ----------------------------------------------------------------------
2a30D           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1e98A           ----------------------------------------------------------------------
3cmvA           ----------------------------------------------------------------------
2dr3A           ----------------------------------------------------------------------
2b8tA           ----------------------------------------------------------------------
3cmxA           ----------------------------------------------------------------------
2dr3B           ----------------------------------------------------------------------
2akaB           ----------------------------------------------------------------------
1e9cA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
3b2qA           ----------------------------------------------------------------------
3czpB           ----------------------------------------------------------------------
2a5gA           ----------------------------------------------------------------------
2a30B           ----------------------------------------------------------------------
2cckA           ----------------------------------------------------------------------
3dm5A           ----------------------------------------------------------------------
1cr4A           ----------------------------------------------------------------------
2cjwB           ----------------------------------------------------------------------
2b8wA           ----------------------------------------------------------------------
3b2qB           ----------------------------------------------------------------------
2c03A           ----------------------------------------------------------------------
2axpA           ----------------------------------------------------------------------
2ctsA           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
3a1wA           ----------------------------------------------------------------------
2d0kA           ----------------------------------------------------------------------
1e2dA           ----------------------------------------------------------------------
3dtbB           ----------------------------------------------------------------------
2bdtA           ----------------------------------------------------------------------
2cgtH           ----------------------------------------------------------------------
3b85A           ----------------------------------------------------------------------
2c04A           ----------------------------------------------------------------------
1e9dA           ----------------------------------------------------------------------
1e0jB           ----------------------------------------------------------------------
4dcgA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
2dr3E           ----------------------------------------------------------------------
2b8tB           ----------------------------------------------------------------------
2b8tC           ----------------------------------------------------------------------
2d4uA           ----------------------------------------------------------------------
1e3mB           ----------------------------------------------------------------------
1e9sD           ----------------------------------------------------------------------
1e2fA           ----------------------------------------------------------------------
1e0jA           ----------------------------------------------------------------------
1e9sG           ----------------------------------------------------------------------
2a2zB           ----------------------------------------------------------------------
2a30A           ----------------------------------------------------------------------
1e9sF           ----------------------------------------------------------------------
1e3mA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1e3aB           ----------------------------------------------------------------------
3c8uA           ----------------------------------------------------------------------
2bv7A           ----------------------------------------------------------------------
2bc9A           ----------------------------------------------------------------------
1e9rE           ----------------------------------------------------------------------
421pA           ----------------------------------------------------------------------
2axzC           ----------------------------------------------------------------------
1cr1A           ----------------------------------------------------------------------
1draA           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
3dauA           ----------------------------------------------------------------------
3dfpC           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
2c61A           ----------------------------------------------------------------------
1cr2A           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
3bo6B           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bx2L           ----------------------------------------------------------------------
3adkA           ----------------------------------------------------------------------
3d7wA           ----------------------------------------------------------------------
3dt2A           ----------------------------------------------------------------------
2akaA           ----------------------------------------------------------------------
3ch4B           ----------------------------------------------------------------------
3bh0A           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2dr3D           ----------------------------------------------------------------------
2drcA           ----------------------------------------------------------------------
2cckB           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
3cmwC           ----------------------------------------------------------------------
3dt7A           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
2a5jA           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3bgwA           ----------------------------------------------------------------------
3bb1B           ----------------------------------------------------------------------
1d6jB           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
3cmtD           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
3dt4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
2d4hA           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
3cr7D           ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
3clvA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1e9sJ           ----------------------------------------------------------------------
2a2zA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
3bpbA           ----------------------------------------------------------------------
3da4A           ----------------------------------------------------------------------
3d3kA           ----------------------------------------------------------------------
3cmvE           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
2b92B           ----------------------------------------------------------------------
3d3qA           ----------------------------------------------------------------------
3bgwD           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
1e2gA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
3czjA           ----------------------------------------------------------------------
3dt4C           ----------------------------------------------------------------------
2bkhA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
2c0bL           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
3ecpA           ----------------------------------------------------------------------
1dkiA           ----------------------------------------------------------------------
3cr7A           ----------------------------------------------------------------------
2aunB           ----------------------------------------------------------------------
2dr3F           ----------------------------------------------------------------------
3cr7C           ----------------------------------------------------------------------
1aldA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e9rD           ----------------------------------------------------------------------
2bwjA           ----------------------------------------------------------------------
3dymA           ----------------------------------------------------------------------
2boeX           ----------------------------------------------------------------------
1bglA           ----------------------------------------------------------------------
2dflA           ----------------------------------------------------------------------
1e4yA           ----------------------------------------------------------------------
3bczC           ----------------------------------------------------------------------
3cddF           ----------------------------------------------------------------------
2bhjA           ----------------------------------------------------------------------
3cm0A           ----------------------------------------------------------------------
2c4rL           ----------------------------------------------------------------------
1av6A           ----------------------------------------------------------------------
2aunA           ----------------------------------------------------------------------
2c9oC           ----------------------------------------------------------------------
2cvfA           ----------------------------------------------------------------------
3cioD           ----------------------------------------------------------------------
3cbnA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
3be4A           ----------------------------------------------------------------------
3dfoC           ----------------------------------------------------------------------
3bjdB           ----------------------------------------------------------------------
3cueF           ----------------------------------------------------------------------
2bkiA           ----------------------------------------------------------------------
2eg5G           ----------------------------------------------------------------------
1drbA           ----------------------------------------------------------------------
6aldA           ----------------------------------------------------------------------
1bmfC           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1dp0A           ----------------------------------------------------------------------
2c7cH           ----------------------------------------------------------------------
1cjtC           ----------------------------------------------------------------------
3cnlA           ----------------------------------------------------------------------
1dg3A           ----------------------------------------------------------------------
3bk7A           -DRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVL
1cfrA           ----------------------------------------------------------------------
3dyoA           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d4hB           ----------------------------------------------------------------------
3dm9B           ----------------------------------------------------------------------
1akeA           ----------------------------------------------------------------------
1dekB           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2bhvA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
2ccjA           ----------------------------------------------------------------------
3bb1F           ----------------------------------------------------------------------
1ak2A           ----------------------------------------------------------------------
1e59A           ----------------------------------------------------------------------
3crmA           ----------------------------------------------------------------------
1e9sB           ----------------------------------------------------------------------
2an9A           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
2bofX           ----------------------------------------------------------------------
1c9kC           ----------------------------------------------------------------------
1e9sM           ----------------------------------------------------------------------
2a1fF           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
1e4vA           ----------------------------------------------------------------------
3a00A           ----------------------------------------------------------------------
2ancF           ----------------------------------------------------------------------
1cjaA           ----------------------------------------------------------------------
3dvlD           ----------------------------------------------------------------------
1e2kA           ----------------------------------------------------------------------
2bjbA           ----------------------------------------------------------------------
3ec1A           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
2ck3C           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1e9sI           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3bwdD           ----------------------------------------------------------------------
3cmvB           ----------------------------------------------------------------------
2anbA           ----------------------------------------------------------------------
3bb1C           ----------------------------------------------------------------------
2dr3C           ----------------------------------------------------------------------
1culC           ----------------------------------------------------------------------
3d3qB           ----------------------------------------------------------------------
3b55A           ----------------------------------------------------------------------
3cddD           ----------------------------------------------------------------------
3dlbB           ----------------------------------------------------------------------
3cr7B           ----------------------------------------------------------------------
1cs4C           ----------------------------------------------------------------------
3cmuA           ----------------------------------------------------------------------
2b8wB           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
3bb1A           ----------------------------------------------------------------------
5dfrA           ----------------------------------------------------------------------
3c15C           ----------------------------------------------------------------------
3e8aC           ----------------------------------------------------------------------
3bv4A           ----------------------------------------------------------------------
2ahwD           ----------------------------------------------------------------------
2e85A           ----------------------------------------------------------------------
1e2iB           ----------------------------------------------------------------------
2aumA           ----------------------------------------------------------------------
2czvB           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2bkeA           ----------------------------------------------------------------------
1e9sH           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
1accA           ----------------------------------------------------------------------
1e9rF           ----------------------------------------------------------------------
2b8tD           ----------------------------------------------------------------------
3brwA           ----------------------------------------------------------------------
3bb1E           ----------------------------------------------------------------------
1e9rG           ----------------------------------------------------------------------
2ancB           ----------------------------------------------------------------------
3d1mA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
3cnnA           ----------------------------------------------------------------------
2ahvA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
2dpyB           ----------------------------------------------------------------------
2dftA           ----------------------------------------------------------------------
1e9sL           ----------------------------------------------------------------------
2d7vB           ----------------------------------------------------------------------
2dftC           ----------------------------------------------------------------------
3di4A           ----------------------------------------------------------------------
1e2iA           ----------------------------------------------------------------------
1e9sE           ----------------------------------------------------------------------
3c7kA           ----------------------------------------------------------------------
2e85B           ----------------------------------------------------------------------
1e2mB           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------
3a00B           ----------------------------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
2dpyA           ----------------------------------------------------------------------
1e2nB           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2aexA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
1e2nA           ----------------------------------------------------------------------
3bjqB           ----------------------------------------------------------------------
3cphA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
3ci2A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
2a1fC           ----------------------------------------------------------------------
3dffA           ----------------------------------------------------------------------
3dm5B           ----------------------------------------------------------------------
3cddC           ----------------------------------------------------------------------
3d1mB           ----------------------------------------------------------------------
3b85B           ----------------------------------------------------------------------
1e1qB           ----------------------------------------------------------------------
1ek0A           ----------------------------------------------------------------------
2ancD           ----------------------------------------------------------------------
1chdA           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
1e9rB           ----------------------------------------------------------------------
2c5mD           ----------------------------------------------------------------------
1e2hB           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3bb1G           ----------------------------------------------------------------------
2a5vB           ----------------------------------------------------------------------
1e2jA           ----------------------------------------------------------------------
1e2lA           ----------------------------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3bb1H           ----------------------------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1e2lB           ----------------------------------------------------------------------
1dvrA           ----------------------------------------------------------------------
1e9sK           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
3e02A           ----------------------------------------------------------------------
2cdnA           ----------------------------------------------------------------------
3c85A           ----------------------------------------------------------------------
1e2mA           ----------------------------------------------------------------------
2bhvC           ----------------------------------------------------------------------
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3dkvA           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
3cddB           ----------------------------------------------------------------------
3cd9A           ----------------------------------------------------------------------
3ed8A           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
3bs4A           ----------------------------------------------------------------------
3dofB           ----------------------------------------------------------------------
2d3wB           TRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSLDIDALKVVADGVNSLRDGKRS-FIIVTHYRILD
2bifA           GHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFM
1bifA           GHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFM
2dwoA           GQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFM
3c95A           ARNFPGTLDYAEQQRWLEHRRQVFTPEFL-----------------------------------------
3b5jA           -GEQGAGLSGGQRQRIAIARALVNNPKILIFDEAT-SALDYESEHVIMRNMHKICKGRTVIIIAHR-LST
1aroP           YEMGEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACL
2ccjB           ---SLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGY
2ccgB           -DSSLAYQGYARGIGVEEVRALNEFAINGLYPDLIYLNVSAEVGRERIIKNSLDQEDLKFHEKEGYQEII
3dmdB           IDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDADA
2a2zD           -ETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFD
2dwpA           GQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFM
1e9fA           ----GAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENG-----------AFQERALRCFHQLM
3eiuA           LYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDL-----SGYITEGQIVVARELHRKGIYPPINVLPSL
2ccgA           IDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKV
2czvA           YSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKASIS--
2a30D           --------------------------------------------------------ESWLLHRTLKTNFD
1e98A           VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENG----AFQERALRCFHQLM
2dr3A           -------TDIREFIEVLRQAIRDINAKRVVVDSVTTNKPAMARSIILQLKRVLAGTGCTSIFVSQVSGFG
2b8tA           LKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEA------THSLRKIDGKHADYNDDIVKIGCQEF--
2dr3B           --------DIREFIEVLRQAIRDINAKRVVVDSVYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSVGE
2akaB           KVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQR-TIGVITKLDLM
1e9cA           VAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ----ERALRCFHQLM
2awnC           LDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA
2a30B           --------------------------------------------------------ESWLLHRTLKTNFD
2cckA           ----------------------------------------------------------DLKFHEKVIEGY
3b2qB           LYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELHRK-----GIYPPINVLPSL
2d0kA           RNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPTDDRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQF
1e3mB           PIDRIFTRVGTFVETETANILHNATEYSLVLDEIGTSTYDGLSLAWACAENLANKIKALTLFATHYFELT
2a30A           --------------------------------------------------------ESWLLHRTLKTNFD
1e3mA           GPIDRIFTRVGFVETETANILHNATEYSLVLDEIGTSTYDGLSLAWACAENLANKIKALTLFATHYFELT
1dhiA           ----------------------------------------------------------MVIGGGRVYEQF
1e3aB           --------------------------------------------------------VVAAVPMPFDKWYS
2axzC           -------EVSSIIKPYPIVDSFGKDYDLTIQTVLSINRNLKEAQYYINQFEHLKTIKNISINGYYDLQIY
1adoA           ----PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3dauA           RNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQF
3dfpC           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
1dhjA           RNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDPEIMVIGGGRVYEQF
2bx2L           -KLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIE--ETAFNTNLEAA
2drcA           -----------------------------------------------------------VIGGGRVYEQF
2cckB           -------------------------------------------------------IRFKSVNADQPLENV
1ai4B           --------------------------------------------------------VVAAVPMPFDKWYS
3dfnC           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3dfnA           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3bgwA           --------------------------------------------------------DVVVIALSQLSRQV
1dyhA           TLDKP--VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRVYEQF
4dfrA           TLDKP--VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRVYEQF
3dfoD           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
1cr0A           -------------------------------------------------------TGVVLVVICHDLRAL
3dfpD           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
2awnB           --------------------------------------------------------GRTMIYVTHDQVEA
3dfqA           ----PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3dfnD           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
1e2gA           -----------------------------------------------------------ERALRCFHQLM
3dftD           ----PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3dfqD           ----PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3dfqC           ----PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
3dftC           ----PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
2awnA           --------------------------------------------------------GRTMIYVTHDQVEA
1aldA           ----PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
1bglA           PLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRI
3be4A           -----ERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVRLDVFHKQTAPLVKFY
3dfoC           ----PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
6aldA           ----PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
2c7cH           -QFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIAEDVEGEALATLV
3dyoA           PLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRI
2ccjA           --------------------------------------------------------QEDLKFHEKVIEGY
2a1fF           --------SQPIYKRILLKL-----SGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLF
2a1fE           --------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLF
2a1fD           --------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLF
5dfrA           -------VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRVYEQF
3bv4A           -------TPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVN
2bkeA           --------------------------------------------------------DIAVIITNQVVPG-


                         *         .         .         .         .         +         .:560
query           LEIADSIAVMYHGRLSPPLAAAETGREQLxxxxxxxxxxxxxxxxxxxx
3cmvG           PFKQAEFQILYGEGI----------------------------------
3dmdC           -------------------------------------------------
3cmvH           IAAPFKQAEFQILY-----------------------------------
2d3wB           -------------------------------------------------
2bifA           -------------------------------------------------
1bifA           -------------------------------------------------
2dwoA           -------------------------------------------------
3c95A           -------------------------------------------------
3b5jA           -------------------------------------------------
2c61B           -------------------------------------------------
1aroP           -------------------------------------------------
3cmvC           APFKQAEFQILYG------------------------------------
3b60A           -------------------------------------------------
2ccjB           -------------------------------------------------
1d1cA           -------------------------------------------------
2bbsA           -------------------------------------------------
2c03B           -------------------------------------------------
2ccgB           -------------------------------------------------
3dmdB           -------------------------------------------------
2a2zD           -------------------------------------------------
3eiuB           -------------------------------------------------
2dwpA           -------------------------------------------------
1e9fA           -------------------------------------------------
3eiuA           -------------------------------------------------
2ccgA           -------------------------------------------------
1bg0A           -------------------------------------------------
2czvA           -------------------------------------------------
2a30D           -------------------------------------------------
2d62A           -------------------------------------------------
1e98A           -------------------------------------------------
3cmvA           -------------------------------------------------
2dr3A           -------------------------------------------------
2b8tA           -------------------------------------------------
3cmxA           -------------------------------------------------
2dr3B           -------------------------------------------------
2akaB           -------------------------------------------------
1e9cA           -------------------------------------------------
1e69A           -------------------------------------------------
2d4uB           -------------------------------------------------
2awnC           -------------------------------------------------
3b2qA           -------------------------------------------------
3czpB           -------------------------------------------------
2a5gA           -------------------------------------------------
2a30B           -------------------------------------------------
2cckA           -------------------------------------------------
3dm5A           -------------------------------------------------
1cr4A           -------------------------------------------------
2cjwB           -------------------------------------------------
2b8wA           -------------------------------------------------
3b2qB           -------------------------------------------------
2c03A           -------------------------------------------------
2axpA           -------------------------------------------------
2ctsA           -------------------------------------------------
2c9yA           -------------------------------------------------
3a1wA           -------------------------------------------------
2d0kA           -------------------------------------------------
1e2dA           -------------------------------------------------
3dtbB           -------------------------------------------------
2bdtA           -------------------------------------------------
2cgtH           -------------------------------------------------
3b85A           -------------------------------------------------
2c04A           -------------------------------------------------
1e9dA           -------------------------------------------------
1e0jB           -------------------------------------------------
4dcgA           -------------------------------------------------
1e9rA           -------------------------------------------------
2dr3E           -------------------------------------------------
2b8tB           -------------------------------------------------
2b8tC           -------------------------------------------------
2d4uA           -------------------------------------------------
1e3mB           -------------------------------------------------
1e9sD           -------------------------------------------------
1e2fA           -------------------------------------------------
1e0jA           -------------------------------------------------
1e9sG           -------------------------------------------------
2a2zB           -------------------------------------------------
2a30A           -------------------------------------------------
1e9sF           -------------------------------------------------
1e3mA           -------------------------------------------------
1dhiA           -------------------------------------------------
1e3aB           -------------------------------------------------
3c8uA           -------------------------------------------------
2bv7A           -------------------------------------------------
2bc9A           -------------------------------------------------
1e9rE           -------------------------------------------------
421pA           -------------------------------------------------
2axzC           -------------------------------------------------
1cr1A           -------------------------------------------------
1draA           -------------------------------------------------
1adoA           -------------------------------------------------
3dauA           -------------------------------------------------
3dfpC           -------------------------------------------------
1dhjA           -------------------------------------------------
2c61A           -------------------------------------------------
1cr2A           -------------------------------------------------
3czpA           -------------------------------------------------
2d3wA           -------------------------------------------------
3bo6B           -------------------------------------------------
2bbsB           -------------------------------------------------
2bx2L           -------------------------------------------------
3adkA           -------------------------------------------------
3d7wA           -------------------------------------------------
3dt2A           -------------------------------------------------
2akaA           -------------------------------------------------
3ch4B           -------------------------------------------------
3bh0A           -------------------------------------------------
2awnD           -------------------------------------------------
2dr3D           -------------------------------------------------
2drcA           -------------------------------------------------
2cckB           -------------------------------------------------
1ai4B           -------------------------------------------------
3cmwC           -------------------------------------------------
3dt7A           -------------------------------------------------
3dfnC           -------------------------------------------------
1e6cA           -------------------------------------------------
2a5jA           -------------------------------------------------
3dfnA           -------------------------------------------------
3bgwA           -------------------------------------------------
3bb1B           -------------------------------------------------
1d6jB           -------------------------------------------------
1dyhA           -------------------------------------------------
3cmtD           -------------------------------------------------
2ausC           -------------------------------------------------
3dt4A           -------------------------------------------------
4dfrA           -------------------------------------------------
2d4hA           -------------------------------------------------
3dfoD           -------------------------------------------------
3cr7D           -------------------------------------------------
1cr0A           -------------------------------------------------
3clvA           -------------------------------------------------
3dfpD           -------------------------------------------------
1e9sJ           -------------------------------------------------
2a2zA           -------------------------------------------------
2awnB           -------------------------------------------------
3bpbA           -------------------------------------------------
3da4A           -------------------------------------------------
3d3kA           -------------------------------------------------
3cmvE           -------------------------------------------------
3dfqA           -------------------------------------------------
2b92B           -------------------------------------------------
3d3qA           -------------------------------------------------
3bgwD           -------------------------------------------------
3dfnD           -------------------------------------------------
1e2gA           -------------------------------------------------
1d6jA           -------------------------------------------------
2d3wD           -------------------------------------------------
3dftD           -------------------------------------------------
3czjA           -------------------------------------------------
3dt4C           -------------------------------------------------
2bkhA           -------------------------------------------------
3dfqD           -------------------------------------------------
2bbtB           -------------------------------------------------
3dfqC           -------------------------------------------------
3dftC           -------------------------------------------------
2c0bL           -------------------------------------------------
2awoC           -------------------------------------------------
2awnA           -------------------------------------------------
3ecpA           -------------------------------------------------
1dkiA           -------------------------------------------------
3cr7A           -------------------------------------------------
2aunB           -------------------------------------------------
2dr3F           -------------------------------------------------
3cr7C           -------------------------------------------------
1aldA           -------------------------------------------------
1b0uA           -------------------------------------------------
1e9rD           -------------------------------------------------
2bwjA           -------------------------------------------------
3dymA           -------------------------------------------------
2boeX           -------------------------------------------------
1bglA           -------------------------------------------------
2dflA           -------------------------------------------------
1e4yA           -------------------------------------------------
3bczC           -------------------------------------------------
3cddF           -------------------------------------------------
2bhjA           -------------------------------------------------
3cm0A           -------------------------------------------------
2c4rL           -------------------------------------------------
1av6A           -------------------------------------------------
2aunA           -------------------------------------------------
2c9oC           -------------------------------------------------
2cvfA           -------------------------------------------------
3cioD           -------------------------------------------------
3cbnA           -------------------------------------------------
1eilA           -------------------------------------------------
3be4A           -------------------------------------------------
3dfoC           -------------------------------------------------
3bjdB           -------------------------------------------------
3cueF           -------------------------------------------------
2bkiA           -------------------------------------------------
2eg5G           -------------------------------------------------
1drbA           -------------------------------------------------
6aldA           -------------------------------------------------
1bmfC           -------------------------------------------------
3d31A           -------------------------------------------------
1dp0A           -------------------------------------------------
2c7cH           -------------------------------------------------
1cjtC           -------------------------------------------------
3cnlA           -------------------------------------------------
1dg3A           -------------------------------------------------
3bk7A           DYLSDVIHVVYGEP-----------------------------------
1cfrA           -------------------------------------------------
3dyoA           -------------------------------------------------
2d3wC           -------------------------------------------------
2d4hB           -------------------------------------------------
3dm9B           -------------------------------------------------
1akeA           -------------------------------------------------
1dekB           -------------------------------------------------
2d2eA           -------------------------------------------------
2bhvA           -------------------------------------------------
3dhwC           -------------------------------------------------
2d2fA           -------------------------------------------------
2ccjA           -------------------------------------------------
3bb1F           -------------------------------------------------
1ak2A           -------------------------------------------------
1e59A           -------------------------------------------------
3crmA           -------------------------------------------------
1e9sB           -------------------------------------------------
2an9A           -------------------------------------------------
2bhvD           -------------------------------------------------
2bofX           -------------------------------------------------
1c9kC           -------------------------------------------------
1e9sM           -------------------------------------------------
2a1fF           -------------------------------------------------
2awoA           -------------------------------------------------
1e4vA           -------------------------------------------------
3a00A           -------------------------------------------------
2ancF           -------------------------------------------------
1cjaA           -------------------------------------------------
3dvlD           -------------------------------------------------
1e2kA           -------------------------------------------------
2bjbA           -------------------------------------------------
3ec1A           -------------------------------------------------
4atjA           -------------------------------------------------
2ck3C           -------------------------------------------------
2a1fE           -------------------------------------------------
1e9sI           -------------------------------------------------
2aumB           -------------------------------------------------
3bwdD           -------------------------------------------------
3cmvB           -------------------------------------------------
2anbA           -------------------------------------------------
3bb1C           -------------------------------------------------
2dr3C           -------------------------------------------------
1culC           -------------------------------------------------
3d3qB           -------------------------------------------------
3b55A           -------------------------------------------------
3cddD           -------------------------------------------------
3dlbB           -------------------------------------------------
3cr7B           -------------------------------------------------
1cs4C           -------------------------------------------------
3cmuA           -------------------------------------------------
2b8wB           -------------------------------------------------
2a1fD           -------------------------------------------------
3bb1A           -------------------------------------------------
5dfrA           -------------------------------------------------
3c15C           -------------------------------------------------
3e8aC           -------------------------------------------------
3bv4A           -------------------------------------------------
2ahwD           -------------------------------------------------
2e85A           -------------------------------------------------
1e2iB           -------------------------------------------------
2aumA           -------------------------------------------------
2czvB           -------------------------------------------------
2c9gA           -------------------------------------------------
2bkeA           -------------------------------------------------
1e9sH           -------------------------------------------------
2bbtA           -------------------------------------------------
1bccF           -------------------------------------------------
1accA           -------------------------------------------------
1e9rF           -------------------------------------------------
2b8tD           -------------------------------------------------
3brwA           -------------------------------------------------
3bb1E           -------------------------------------------------
1e9rG           -------------------------------------------------
2ancB           -------------------------------------------------
3d1mA           -------------------------------------------------
3bm2B           -------------------------------------------------
3cnnA           -------------------------------------------------
2ahvA           -------------------------------------------------
2d7vA           -------------------------------------------------
2dpyB           -------------------------------------------------
2dftA           -------------------------------------------------
1e9sL           -------------------------------------------------
2d7vB           -------------------------------------------------
2dftC           -------------------------------------------------
3di4A           -------------------------------------------------
1e2iA           -------------------------------------------------
1e9sE           -------------------------------------------------
3c7kA           -------------------------------------------------
2e85B           -------------------------------------------------
1e2mB           -------------------------------------------------
1azsC           -------------------------------------------------
2a5vA           -------------------------------------------------
1eamA           -------------------------------------------------
3a00B           -------------------------------------------------
3dfdA           -------------------------------------------------
1ckvA           -------------------------------------------------
2dpyA           -------------------------------------------------
1e2nB           -------------------------------------------------
2b0lC           -------------------------------------------------
2aexA           -------------------------------------------------
2awoD           -------------------------------------------------
1e2nA           -------------------------------------------------
3bjqB           -------------------------------------------------
3cphA           -------------------------------------------------
1e9sA           -------------------------------------------------
3ci2A           -------------------------------------------------
1afrA           -------------------------------------------------
2a1fC           -------------------------------------------------
3dffA           -------------------------------------------------
3dm5B           -------------------------------------------------
3cddC           -------------------------------------------------
3d1mB           -------------------------------------------------
3b85B           -------------------------------------------------
1e1qB           -------------------------------------------------
1ek0A           -------------------------------------------------
2ancD           -------------------------------------------------
1chdA           -------------------------------------------------
1dwmA           -------------------------------------------------
3c14C           -------------------------------------------------
3do6A           -------------------------------------------------
1e9rB           -------------------------------------------------
2c5mD           -------------------------------------------------
1e2hB           -------------------------------------------------
1d8jA           -------------------------------------------------
3bb1G           -------------------------------------------------
2a5vB           -------------------------------------------------
1e2jA           -------------------------------------------------
1e2lA           -------------------------------------------------
1cjuC           -------------------------------------------------
3b9qA           -------------------------------------------------
3bb1H           -------------------------------------------------
1cjvC           -------------------------------------------------
1e2lB           -------------------------------------------------
1dvrA           -------------------------------------------------
1e9sK           -------------------------------------------------
1e2kB           -------------------------------------------------
3e02A           -------------------------------------------------
2cdnA           -------------------------------------------------
3c85A           -------------------------------------------------
1e2mA           -------------------------------------------------
2bhvC           -------------------------------------------------
1e2jB           -------------------------------------------------
2bwjB           -------------------------------------------------
3dkvA           -------------------------------------------------
3dmdA           -------------------------------------------------
1ckeA           -------------------------------------------------
2bwjD           -------------------------------------------------
1dekA           -------------------------------------------------
3cddB           -------------------------------------------------
3cd9A           -------------------------------------------------
3ed8A           -------------------------------------------------
1e2hA           -------------------------------------------------
3bs4A           -------------------------------------------------
3dofB           -------------------------------------------------
2d3wB           YIKPDYVHVLYQGRI----------------------------------
2bifA           RRIECYENSYESLD-----------------------------------
1bifA           RRIECYENSYESLDE----------------------------------
2dwoA           KRISCYEASYQP-------------------------------------
3c95A           -------------------------------------------------
3b5jA           VKNADRIIVMEKGKI----------------------------------
1aroP           TSADNTTVQAVASAI----------------------------------
2ccjB           QEIIQRFKSVNADQP----------------------------------
2ccgB           HNESQRFKSVNADQP----------------------------------
3dmdB           RGGAALSISYVIDAP----------------------------------
2a2zD           YLQEVPILTLDVNE-----------------------------------
2dwpA           KRISCYEASYQPLDPDK--------------------------------
1e9fA           KDTTLNWKMVDASK-----------------------------------
3eiuA           SRLMNSGIGAGK-------------------------------------
2ccgA           IEGYQEIIHNESQRF----------------------------------
2czvA           -MYPEII------------------------------------------
2a30D           YLQEVPILTLDVNEY----------------------------------
1e98A           KDTTLNWKMVDASKR----------------------------------
2dr3A           EHGVDGIIRLDLDEI----------------------------------
2b8tA           YSAVCRHHHKVPNRP----------------------------------
2dr3B           RGFGPGVEHGVDGII----------------------------------
2akaB           DEGTDARDVLENKLL----------------------------------
1e9cA           KDTTLNWKMVDASKS----------------------------------
2awnC           MTLADKIVVLDAGRV----------------------------------
2a30B           YLQEVPILTLDVNEY----------------------------------
2cckA           QEIIRFKSVNADQPL----------------------------------
3b2qB           SRLMNSGIGAGKTR-----------------------------------
2d0kA           LPKAQKLYLTHIDAE----------------------------------
1e3mB           QLPEKEGVANVHLDA----------------------------------
2a30A           YLQEVPILTLDVNEY----------------------------------
1e3mA           QLPEKEGVANVHLDA----------------------------------
1dhiA           LPKAQKLYLTHIDAE----------------------------------
1e3aB           ASGYETTQDGPTGSL----------------------------------
2axzC           QFLTDKNIDSYLNAV----------------------------------
1adoA           PCIGGVILFHETLYQ----------------------------------
3dauA           LPKAQKLYLTHIDAE----------------------------------
3dfpC           PCIGGVILFHETLYQ----------------------------------
1dhjA           LPKAQKLYLTHIDAE----------------------------------
2bx2L           DEIARQLRLRDLGGL----------------------------------
2drcA           LPKAQKLYLTHIDAE----------------------------------
2cckB           VEDTYQTIIKY--------------------------------------
1ai4B           ASGYETTQDGPTGSL----------------------------------
3dfnC           PCIGGVILFHETLYQ----------------------------------
3dfnA           PCIGGVILFHETLYQ----------------------------------
3bgwA           EQRQDKRPMLSDLRE----------------------------------
1dyhA           LPKAQKLYLTHIDAE----------------------------------
4dfrA           LPKAQKLYLTHIDAE----------------------------------
3dfoD           PCIGGVILFHETLYQ----------------------------------
1cr0A           RQLSDTIIALERNQL----------------------------------
3dfpD           PCIGGVILFHETLYQ----------------------------------
2awnB           MTLADKIVVLDAGRV----------------------------------
3dfqA           PCIGGVILFHETLYQ----------------------------------
3dfnD           PCIGGVILFHETLYQ----------------------------------
1e2gA           KDTTLNWKMVDASKS----------------------------------
3dftD           PCIGGVILFHETLYQ----------------------------------
3dfqD           PCIGGVILFHETLYQ----------------------------------
3dfqC           PCIGGVILFHETLYQ----------------------------------
3dftC           PCIGGVILFHETLYQ----------------------------------
2awnA           MTLADKIVVLDAGRV----------------------------------
1aldA           PCIGGVILFHETLYQ----------------------------------
1bglA           DGSGQMAITVDVEVA----------------------------------
3be4A           EDLGILKRVNAKLPP----------------------------------
3dfoC           PCIGGVILFHETLYQ----------------------------------
6aldA           PCIGGVILFHETLYQ----------------------------------
2c7cH           VNTMRGIVKVAAVKA----------------------------------
3dyoA           DGSGQMAITVDVEVA----------------------------------
2ccjA           QEIIHRFKSVNADQP------LENVVEDT--------------------
2a1fF           RGAKLAKAGMNRVV-----------------------------------
2a1fE           RGAKLAKAGMNRVVG----------------------------------
2a1fD           RGAKLAKAGMNRVVG----------------------------------
5dfrA           LPKAQKLYLTHIDAE----------------------------------
3bv4A           PCIGGVILFHETLYQ----------------------------------
2bkeA           --IRIQLKKSRGNRR----------------------------------