[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38484.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e8gA.bssp"
#ERROR : Can't open dsspfile "3bw7A.bssp"
#ERROR : Can't open dsspfile "1ahuA.bssp"
#ERROR : Can't open dsspfile "1e0yA.bssp"
#ERROR : Can't open dsspfile "1dznA.bssp"
#ERROR : Can't open dsspfile "1e8fA.bssp"
#ERROR : Can't open dsspfile "3c0pA.bssp"
#ERROR : Can't open dsspfile "3d2hA.bssp"
#ERROR : Can't open dsspfile "3d2dA.bssp"
#ERROR : Can't open dsspfile "2bvfA.bssp"
#ERROR : Can't open dsspfile "3d2jA.bssp"
#ERROR : Can't open dsspfile "3e0tA.bssp"
#ERROR : Can't open dsspfile "3dq0A.bssp"
#ERROR : Can't open dsspfile "2ckjB.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "3bdjA.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "2e67A.bssp"
#ERROR : Can't open dsspfile "3c0qA.bssp"
#ERROR : Can't open dsspfile "3c52A.bssp"
#ERROR : Can't open dsspfile "3cwcA.bssp"

## Summary of PDB Search
:489
    7e-72  15%  1e8gA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    7e-72  17%  3bw7A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    4e-71  15%  1ahuA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    6e-70  15%  1e0yA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    1e-69  15%  1dznA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    1e-67  15%  1e8fA  [d.145.1 - d.58.32] VANILLYL-ALCOHOL OXIDASE
    6e-65  17%  3c0pA  [x.x.x] CYTOKININ DEHYDROGENASE 1
    8e-65  14%  3d2hA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    4e-64  13%  3d2dA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    4e-64  17%  2bvfA  [x.x.x] 6-HYDROXY-D-NICOTINE OXIDASE
    3e-63  14%  3d2jA  [x.x.x] BERBERINE BRIDGE-FORMING ENZYME
    8e-63  14%  3e0tA  [x.x.x] GLUCOOLIGOSACCHARIDE OXIDASE
    3e-55  18%  3dq0A  [x.x.x] CYTOKININ DEHYDROGENASE 1
    6e-51   8%  2ckjB  [x.x.x] XANTHINE OXIDOREDUCTASE
    4e-45   9%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    2e-44   6%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-41   7%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    8e-40   8%  3bdjA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-37   7%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-37  10%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-34  10%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    6e-33  10%  2e67A  [x.x.x] HYPOTHETICAL PROTEIN TTHB029
    1e-24  12%  3c0qA  [x.x.x] UV ENDONUCLEASE
    2e-20  11%  3c52A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE
    4e-15  12%  3cwcA  [x.x.x] PUTATIVE GLYCERATE KINASE 2
:489

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxGQNQARRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNLYRGHSPLVLR
1e8gA           --------------RPLTLPPLSLSDFNEFIQDIIRIVGSENVEVISVDGSYMKPTHTHDDYFLASAIVA
3bw7A           ----------------------------PWPASLAALALDGKLRTDSNATAAASTDFGNITSALPAAVLY
1ahuA           -------------------PKLSLSDFNEFIQDIIRIVGSENVEVISSKDQIVDGSYMKPDYFLASAIVA
1e0yA           --------------RPLTLPPKLSLDFNEFIQDIIRIVGSENVEVISVDGSYMKPTHTHDDYFLASAIVA
1dznA           -----------------LPPKLSLSDFNEFIQDIIRIVGSENVEVISVDGSYMKPTHTHDDYFLASAIVA
1e8fA           --------------RPLTLPPKLSLDFNEFIQDIIRIVGSENVEVISMKPTHTHDPTHVQDYFLASAIVA
3c0pA           -----------------------------WPASLAALALDGKLRTDSNATAAASTDFGNITSALPAAVLY
3d2hA           ----------------------------FNGVRNHTVFSADSDSDFNRFLHLSIQNPLFSLISKPSAIIL
3d2dA           -----------------EAGNDLLSCLTFNGVRNHTVFSADSDSDFNRFLHLSIQNPLFSLISKPSAIIL
2bvfA           --------------------------------ATPLSIQGEVIYPDDSGFDAIANIWDGRHLQRPSLIAR
3d2jA           ----------------------------FNGVRNHTVFSADSDSDFNRFLHLSIQNPLFSLISKPSAIIL
3e0tA           ---------------------------------INACLAAADVEFHEEDSEGWDMDGTAFVDYDPAAIAI
3dq0A           -------------------------------ASLAALALDGKLRTDSNATAAASTDFGNITSALPAAVLY
2ckjB           -------RCTGYRPILQGFRTFARPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQ
2ckjC           ---------------------------------TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQ
2e3tA           --------------------------------------------PPELLRLKDTPQKKLRFEGERVTWIQ
2e1qA           ---------------------------FKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQ
3bdjA           ----GNLCRCTGYRPILQGFRTFAPSLFNPEEFMPLDPTQEPIFPPELLRLKDVPPKQLRFEGERVTWIQ
2e3tB           -------------------------------------PTQEPIFPPELLRLKDTPQKKLRFEGERVTWIQ
2ckjD           -----LCRCTGYRPILQGFRTFARPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQ
2ckjA           ----QGNLCRCTGYRPILQGFRTFARPSLFKPEEFTPPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQ
2e67A           ----------------------------------------------------------------------
3c0qA           --------------VNPGSPDPARLLSLLGAEDGVLVLHLGGAYGEKGKALRRFVENLRGEVLRYLALAN
3c52A           ----------------------------------------------------------------------
3cwcA           ------------------------------------------------------------KESLSALEVA


                         .         .         *         .         .         .         .:140
query           PGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQ
1e8gA           PRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPSGSVVLDMGKNMNVLEVNVEGAYCVVEPGVTYH
3bw7A           PSSTADLVALLSAANSTPGWPYTRGRGHSLMGQAFA-PGGVVVNMASLGDAANVSADGRYVDAGGEQVWI
1ahuA           PRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPRVSVVLDMGKNMNVLEVNVEGAYCVVEPGVTYH
1e0yA           PRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPSGSVVLDMKNMNRVLEVNVEGAYCVVEPGVTYH
1dznA           PRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPSGSVVLDMGKNMNVLEVNVEGAYCVVEPGVTYH
1e8fA           PRNVADVQSIVGLANKFSFPLWPISIGRNSGYGGAAPSGSVVLDMKNMNRVLEVNVEGAYCVVEPGVTYH
3c0pA           PSSTADLVALLSAANSTPGWPYTRGRGHSLMGQAFAPGG-VVVNMASLGDAANVSADGRYVDAGGEQVWI
3d2hA           PGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDPFILIDLMNLNRV-SIDLESETAWVESGSTLG
3d2dA           PGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDPFILIDLMNLNRV-SIDLESETAWVESGSTLG
2bvfA           CLSAGDVAKSVRYACDNGLEISVRSGGHNPNGYATN-DGGIVLDLRLMNSI-HIDTAGSRARIGGGVISG
3d2jA           PGSKEELSNTIRCIRKGSWTIRLRSGGHSYEGLSYTSDPFILIDLMNLNRV-SIDLESETAWVESGSTLG
3e0tA           PRSTEDIAAAVQCGLDAGVQISAKGGGHSYGSGFGGEDGHLMLELDRMYRV-SVDDNNVATIQGGARLGY
3dq0A           PSSTADLVALLSAANSTPYTIAFRGRGHSLMGQAFAPGG-VVVNMASLGDPPRINVSADGRYVDAGGEQV
2ckjB           ASTLKELLDLKAQHPDAKL--VVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFGAACPLS
2ckjC           ASTLKELLDLKAQHPDAKL--VVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFGAACPLS
2e3tA           ASTMEELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLF--PLIVCPAWIPELNSVVHGPEGISFGASCPLS
2e1qA           ASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFK--NMLFPMIVCPAWIPELNSVEHGPDGISFGAACPLS
3bdjA           ASTLKELLDLKAQHPEAKLVVGNTEIGIEMKFKN--QLFPMIICPAWIPELNAVEHGPEGISFGAACALS
2e3tB           ASTMEELLDLKAQHPDAKLVVGNTEIGIEMKFK--NMLFPLIVCPAWIPELNSVVHGPEGISFGASCPLS
2ckjD           ASTLKELLDLKAQHPDAKL--VVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFGAACPLS
2ckjA           ASTLKELLDLKAQHPDAKL----VVGNTEIGIEMKFMLFPMIVCPAWIPELNSVEHGPDGISFGAACPLS
2e67A           ----------------------------------------------------------------------
3c0qA           DERLWNVEEVLKAAEALGVPVVVDTLHHALNPGRLPLEEALRLAFPTW-RGRPVHLASQDPKKRPGAHAF
3c52A           ----------------------------------------------------------------------
3cwcA           TAIEQGFREIWPDADYLKLPLADGGEGTVEAVEATAGRIVHV-----EVTGPLGHRVNAFYGLSGDARSA


                         +         .         .         .         .         *         .:210
query           HAQERAASVDRLFPLSLGAQGSCTIGGNLSTNXXXXXXXXXXXXRDMALGLEVVLADGRILNLLSKLKKD
1e8gA           DLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTMGLKPED
3bw7A           DVLRASLA-RGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTC-----SK
1ahuA           DLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTMGLKPED
1e0yA           DLHNYLEANNLRDKLWLDVPSLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTMGLKPED
1dznA           DLHNYLEANNLRDKLWLDVPSLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTMGLKPED
1e8fA           DLHNYLEANNLRDKLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGAHLF
3c0pA           DVLRASLA-RGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTC-----SK
3d2hA           ELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDR-----QA
3d2dA           ELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDR-----QA
2bvfA           DLVKEAAKFGLAAVTGMH--PKVGFCGLALNGGVGFLTPKYGLASDNILGATLVTATGDVIY-----CSD
3d2jA           ELYYAITESSSKLGFTAGWCPTVGTGGHISGGGFGMMSRKYGLAADNVVDAILIDANGAILDR-----QA
3e0tA           TALELLDQGNRALSH--GTAPAVGVGGHVLGGGYGFATHTHGLTLDWLIGATVVLADASIVHV-----SE
3dq0A           WIDVLRASLARVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNAD
2ckjB           IVEKTLVDAVAKLPAQKTEKSVASVGGNIITASPISDLNPV----FMASGAKLTLVSRGTRRFFPGYRKT
2ckjC           IVEKTLVDAVAKLPAGKQVKSVASVGGNIITASPISDLNPVF----MASGAKLTLVSRGTRRTVQMDHTF
2e3tA           LVESVLAEEIAKLPEQKTEVFRGALAGKQVKSVASIGGNIITASSDLNPVFMASGAKLTLVSRGTRRTVR
2e1qA           IVEKTLVDAVAKLPAGKQVKSVASVGGNIITA----SPISDLNPVFMASGAKLTLVSRGT------RRTV
3bdjA           SVEKTLLEAVAKLPTQKTEVFRASLGGNIITA----SPISDLNPVFMASGTKLTIVSRGTRRTVPMDHTF
2e3tB           LVESVLAEEIAKLPEQKTEVFR-GVMEQLRALAGKQVKSVASIGSDLNPVFMASGAKLTLVSRGTRRTVR
2ckjD           IVEKTLVDAVAKLPAQKTEVSVASVGGNIITASPISDLNPV----FMASGAKLTLVSRGTLSIEIPYSRE
2ckjA           IVEKTLVDAVAKLPAGKQVKSVASVGGNIITA----SPISDLNPVFMASGAKLTLVSRGTR---------
2e67A           ----------------------------------------------------------------------
3c0qA           RVTREDWERLLSALPGPADVMVEAKGKEQG----------------------------------------
3c52A           -----------------------------------------------------MLVKGNEILLKAHKE--
3cwcA           FIEAAASGLEQVPPTGELIRHALDAGVEHIIIGIGGSATNDGGAGVQALGARLRDAQGNDIAQGGIGLET


                         .         .         .         +         .         .         .:280
query           NTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAE
1e8gA           QPWSKIAHLFLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMAQNVPTIRH
3bw7A           QLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQELTAPRSFGPMSYVEGSVF
1ahuA           QPWSKIAIDGLFSQSNMGIVTKIGIWLMPNPRGYQSYLITLPKDGDLKQAVDIIRPLRLGMAQNVPTIRH
1e0yA           QPWSKIAHLFLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMAQNVPTIRH
1dznA           QPWSGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGALQNVPTIRH
1e8fA           PYGFGPYIDGLFSQSNMGIVTKIGIWLMPNPGGYQSYLITLPKDGDLKQAVDIIRPLRLGMAQNVPTIRH
3c0pA           QLNADLFDAVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQERLTAPRSFGPMSY-VEGS
3d2hA           MGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVAIDEATSLLHKWQFVAEELEEDFTLS-
3d2dA           MGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVAIDEATSL-LHKWQFVAEELEEDFTLS
2bvfA           DERPELFWAVRGAGPNFGVVTEVEVQLYELPRKMLAGFITWAPSVSELAGLLTSLLDAL-----NEMADH
3d2jA           MGEDVFWAIRGGGGGVWGAIYAWKIKLLPVPEKVTVFRVTKNVAIDEATSL-LHKWQFVAEELEEDFTLS
3e0tA           TENADLFWALRGGGGGFAIVSEFEFNTFEAPEIITTYQVTTTWNRKQHVAGLKALQDWAQNTMPRELSMR
3dq0A           LFD-----AVLGGLGQFGVITRARIAVEPAPARARWVRLVYTDFAAFSADQERLTAPRAS-FGPMSYVEG
2ckjB           LLSPEEILLSIEIPYSREGEYFSAFKQASRREDDIAKVTSGMRVLFKPGTTEVQELCYGGMANRTISALK
2ckjC           FPGYRKEEILLSIEYSREGEYFSAFKQASRREAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALK-
2e3tA           MDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSL
2e1qA           QMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSAFKQASRRAKVTSGMRVLFKPGTTEVQELALCYG
3bdjA           FPSYRKTLLGPE-----EILLSIEIPYSREDEFFSAFKQASRREDDIAKVTCGMRVLF------QPGSMQ
2e3tB           MDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAFKQASRREDDIAKVTSGMRVLLCFGGMADRTISA
2ckjD           GEYFSAFKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKEELLQ
2ckjA           -RTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSAFKQASDIAKVTSGMRVLF-----KPGTTE
2e67A           ---------------------------------------------------AQNGAYQALGLPTSVMVPG
3c0qA           ----------------------------------------------------------------------
3c52A           --GYGVGANFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHG
3cwcA           LASIDISGLDKRSACHIEVACDVTNPLTGKEGASAVFGPQKGATPEIERLDTALTRYAHLIARDLHVDVL


                         .         *         .         .         .         .         +:350
query           IALDFSVRHGHNRDPLQSRHPWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKL
1e8gA           ILLDAAVLGDKRSYSSRTEPSDEELDKIAKQLNLGRWNFYGALYKDAFSAIPGVKFYFPEDTPENSVLRV
3bw7A           VNQSLAT--DLANTGFFTDADVARIVALAGERNAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDR
1ahuA           ILLDAAVLGKRSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYGPEPIAIPGVKFYFPEDTPENSVLRV
1e0yA           ILLDAAVLGDKRYSSRTEPLSDEELDKIAKYGPEPIRRVLWETIKDAFSAIPGVKFYFPEDTPENSVLRV
1dznA           ILLDAAVLGDKRYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYKDAFSAIPGVKFYFPEDTPENSVLRV
1e8fA           ILLDAAVLGKRSYSSRTEPLSDEELDKIAKQLNLGRWNFYGALYGDAFSAIPGVKFYFPEDTPENSVLRV
3c0pA           VFVNQSLATDLANTGFFTDADVARIVALAGERNAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFLDR
3d2hA           ----VLGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNN
3d2dA           VLGGADEKQVWLTMLGFHFGLKTVAKSTFDLLFPELGLVEED----YLEMSWGESFAYLAGLETVSQLNN
2bvfA           IYPSVFVGVDENRAPS-----VTVCVGHLGGLDIAERDIARLRGLGRTVSDSIAVRS-----YDEVVALN
3d2jA           VLGGADEKQ----VWLTMLGFHFGLKTVAKSTFDLLFPELGLVEEDYLEMSWGESFAYLAGLETVSQLNN
3e0tA           LEINLNWEGNFFGNAKDLKKILQPIMKKAGGKSTISKVETDWYGQINTYLYGADLNITYNYDVHEYFYAN
3dq0A           SVVNQSLATDLANTGFFTDADVARIVALAGERNAAAAAVDQELASVLGTLSYVEGFAFQRDVAYAAFVHG
2ckjB           TTQRQLSKLWKEELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGK
2ckjC           --TTQRQLSKLWKEELLQDVCAGLAEELHLPPDAPGGMVDFRLTLSFFFKFYLTVLQKLGQENLEDKCGK
2e3tA           CFGGMADRTISALKTTPKQLSKSWNEELLQSVCAGLAEELQLAPDAPGGMVEFRRTLTLSFFFKFYLTVL
2e1qA           GMANRTISALKTTQRQLSKLWKEELLQVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLG
3bdjA           VKELALCYGGMADRTISALKTTQKQLSKFWNEKLLQDVCAGLAELSLSPDAPGGMIEFRRTLTLSFFFKF
2e3tB           LKTTPKQLSKSWNEELLQSVCAGLAEEL-QLAPDAPGGMVEFRRTLTLSFFFKFYLTVLQKLGRADLPTF
2ckjD           DVCAGLAEELH------------LPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLDPD
2ckjA           VQELALCYGGMANRTISALKTTQRQLSKLWKEELLQDVCAGLAEEPDAPGGMVDFRCTLTLSFFFKFYLT
2e67A           AWASGVKGEDLGHLVLTSEWPAPRMRPLT-------EGESLRDEAGYFPESLEALWRKARAEEVERELKA
3c0qA           ----------------------------------------------------------------------
3c52A           TTFESCEKAVKAGFTSVMIDASHHAFE--ENLELTSKVVKMAHNAGVSVEAELGRLMGIVLVNPKEAEQF
3cwcA           DL--------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           REEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA
1e8gA           RDKTMQGIPTYDELFSPIAKVSGEDAMMQYAVTKKRCQE--AGLDFIGTFTVGMREMHHIVCIVFNKKDL
3bw7A           VHGEEVALLWRVPHPWLNMFVPRSRIADFDRGVFKGILQ-GTDIVGPLIVYPLNKSMFYAVSLLFSSVAP
1ahuA           RDKTMQGIPTYDELKWPIAKVSGEDAMMQYAVTKKRCQ--EAGLDFIGTFTVGMREMHHIVCIVFNKKDL
1e0yA           RDKTMQGIPTYDELKWPIAKVSGEDAMMQYAVTKKRCQ--EAGLDFIGEFTVGMREMHHIVCIVFNKKDL
1dznA           RDKTMQGIPTYDELKWIIAKVSGEDAMMQYAVTKKRCQ--EAGLDFIGTFTVGMREMHHIVCIVFNKKDL
1e8fA           RDKTMQGIPTYDELFSPIAKVSGEDAMMQYAVTKKRCQ--EAGLDFIGTFTVGMREMHHIVCIVFNKKDL
3c0pA           VHGEEVALLWRVPHPWLNMFVPRSRIADFDRGVFKGILQ-GTDIVGPLIVYPLNKSVFYAVSLLFSSVAP
3d2hA           RFLKFDERAFKTKVDLTKEPLPSKAFYGLLERLSKEALNGFGGQMSKISFPHRSGTRLMVEYIVKVYEFM
3d2dA           RFLKFDERAFKTKVDLTKEPLPSKAFYGLLERLSKEPNGFIKISSDFTPFPHRSGTRLMVEYIVKVYEFM
2bvfA           AEVGSFEDGMSNLWIDREIAMPNARFAEAIAGNLDKFVSEPASGGSVKLEIEGMPFGNPKRTPARGSEKY
3d2jA           RFLKFDERAFKTKVDLTKEPLPSKAFYGLLERLSKEPNGFIKISSDFTPFPHRSGTRLMVEYIVFMKPFV
3e0tA           SLTAPRAIQAFVDYKFDNSSVRPGRGWWIQWDFHGGKNSALVSNDETAYAH-RDQLWLWQFYDSIYDYEN
3dq0A           EEVALNKLGLRVPHPWLNMFVPRSRIADFDRGDIVGPLIVYPLNKSMWDDGMSSEDVFYAVSLLFSSVAP
2ckjB           LDPTFASATDVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAH--
2ckjC           LDPTFASATDVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRYENELSLRLVTSTRAHAT
2e3tA           QKLGRADLEDMCGKLDPTFASATLLFQKDPPANVQLFQEVPKDQSEEDMVGRPLPHLAANMQASGEAVYC
2e1qA           QENLEDKCGKLDPTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDD--
3bdjA           YLTVLKKLGKLDPTYTSATLLFQKHPPANIQL-FQEVPNGQSKEDTVGRPLPHLAAAMQASGEAVYCD--
2e3tB           ASATLDPPANVQLFQEVPKDQSEEDMVGRPLPHLAANMQASGEAVYCDDIPRYENELSLRLVTSTRA---
2ckjD           VQLFQEVPKGQSEEDMVGRPLPHLAADMQAS----------GEAVYCDDIPRYENELSLRLVTSTRAH--
2ckjA           VLQKLGQENLEVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGAVYCDDIPRYENELSLRLVTSTRAHAT
2e67A           QIQAAAKL---FSPTHLDAHQGAVLRPDLAEVYLR-LAEAYRLVPLVPESLEGLGVPPPFLPELERLLYE
3c0qA           ----------------------------------------------------------------------
3c52A           VKESQVDYLAPAIGTSHGAFKFKGEPKLDFER--LQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGD--
3cwcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKVL
1e8gA           IQKRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGKSG
3bw7A           NDLARLQEQNRRILRF-CDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDI
1ahuA           IQKRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGKSG
1e0yA           IQKRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGKSG
1dznA           IQKRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGKSG
1e8fA           IQKRKVQWLMRTLIDDCAANGWGEYRTHLAFMDQIMETYNWNNSSFLRFNEVLKNAVDPNGIIAPGKSG
3c0pA           NDLARLQEQNRRILRF-CDLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQDI
3d2hA           KPFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNNAIEISRSWGESSNYERLIRAKTLIDPNNVFNHPQSI
3d2dA           KPFVSKNPRLGYVNHIDLDLGGIDWGNKTVVNNASRSWGESYFLSNYERLIRAKTLIDPNNVFNHPQSI
2bvfA           PELARELDAALLRAGVTTSGFGLLNNNSEVT---AEMVAEVYKPEVYSRLAAVKREYDPENRFRHNYNI
3d2jA           SKNPRLGYVNHIDLDLGGIDWGNKTVVNNAIEISRSWGES-YFLSNYERLIRAKTLIDPNNVFNHPQSI
3e0tA           NTSPYPESGFEFMQGFVATIRKGKYFNYADTTLTKEEAQKLYWRGNLEKLQAIKAKYDPEDVFGNVVSV
3dq0A           NDLARLQEQNRRILRFC-DLAGIQYKTYLARHTDRSDWVRHFGAAKWNRFVEMKNKYDPKRLLSPGQ--
2ckjB           ---AKIKSIDTSEAKKVPGFVCFISADDVPGSNITDKVTCVGHIIGAVVADTPEHTQRA----------
2ckjC           SEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRA----------
2e3tA           DDIPRYENELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAEDVPNSN-ATGLFNDETVFAKDEV-
2e1qA           --IPRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCF-ISADDVPGSNITGICNDETVFAKDK--
3bdjA           -DIPRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLF-NDETVFAKDTV-
2e3tB           --HAKITSIDTSEAKKVPGFVCFLTAEDVPNSNATDEVTCVGHIIGAVVADTPEHAQRA----------
2ckjD           ---AKIKSIDTSEAKKVPGFVCFISADDVPGVFAKDKVTCVGHIIGAVVADTPPAIITIEDAIKNNSFY
2ckjA           SEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVAD------------------
2e67A           TPFPQVRFLDPYGLPPEERLGFYLDLAHLPPGLYYL-----VHHSALPTPEGRALPDWPTREADYFALS
3c0qA           ---------------------------------------------------------------------
3c52A           -LKGSKGVPFEFLQESVK---------GGINKVNTDDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQL-
3cwcA           ---------------------------------------------------------------------