[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38488.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "1bxzA.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "2dg2A.bssp"
#ERROR : Can't open dsspfile "2ebjA.bssp"
#ERROR : Can't open dsspfile "1dlgA.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"
#ERROR : Can't open dsspfile "3dwgA.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "2eguA.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "3dwiA.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "3c85D.bssp"
#ERROR : Can't open dsspfile "3dwgB.bssp"
#ERROR : Can't open dsspfile "3e8wA.bssp"
#ERROR : Can't open dsspfile "3dkiA.bssp"
#ERROR : Can't open dsspfile "3dwiB.bssp"
#ERROR : Can't open dsspfile "3dkiB.bssp"
#ERROR : Can't open dsspfile "2bhtD.bssp"
#ERROR : Can't open dsspfile "3c3pC.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "1ch6A.bssp"
#ERROR : Can't open dsspfile "2b4qB.bssp"
#ERROR : Can't open dsspfile "3dezB.bssp"
#ERROR : Can't open dsspfile "1d6sA.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "2ae1A.bssp"
#ERROR : Can't open dsspfile "2e37E.bssp"
#ERROR : Can't open dsspfile "3dezA.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "1b8pA.bssp"
#ERROR : Can't open dsspfile "3e9qA.bssp"
#ERROR : Can't open dsspfile "3ce6D.bssp"
#ERROR : Can't open dsspfile "3c85B.bssp"
#ERROR : Can't open dsspfile "2c5eA.bssp"
#ERROR : Can't open dsspfile "2d1yB.bssp"
#ERROR : Can't open dsspfile "2c29F.bssp"
#ERROR : Can't open dsspfile "2d1yD.bssp"
#ERROR : Can't open dsspfile "2cnbA.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2bllA.bssp"
#ERROR : Can't open dsspfile "2d1yA.bssp"
#ERROR : Can't open dsspfile "3ctmF.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "3c3pA.bssp"
#ERROR : Can't open dsspfile "2belC.bssp"
#ERROR : Can't open dsspfile "2d1yC.bssp"
#ERROR : Can't open dsspfile "3c3xA.bssp"
#ERROR : Can't open dsspfile "3e48B.bssp"
#ERROR : Can't open dsspfile "1dohB.bssp"
#ERROR : Can't open dsspfile "3ed8C.bssp"
#ERROR : Can't open dsspfile "1cwuA.bssp"
#ERROR : Can't open dsspfile "3bywC.bssp"
#ERROR : Can't open dsspfile "2eggB.bssp"
#ERROR : Can't open dsspfile "1cg1A.bssp"
#ERROR : Can't open dsspfile "3c6kB.bssp"
#ERROR : Can't open dsspfile "1buaA.bssp"
#ERROR : Can't open dsspfile "3ch6B.bssp"
#ERROR : Can't open dsspfile "1a9zA.bssp"
#ERROR : Can't open dsspfile "3a25A.bssp"
#ERROR : Can't open dsspfile "3edmB.bssp"
#ERROR : Can't open dsspfile "2cnbC.bssp"
#ERROR : Can't open dsspfile "1cg3A.bssp"
#ERROR : Can't open dsspfile "3d5tC.bssp"
#ERROR : Can't open dsspfile "2bgkA.bssp"
#ERROR : Can't open dsspfile "2an3B.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"

## Summary of PDB Search
:339
    6e-55  36%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    8e-51  24%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-47  15%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-46  24%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    5e-46  24%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    4e-45  20%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    5e-45  16%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-44  24%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    4e-44  23%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    6e-44  16%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    6e-44  17%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    6e-44  24%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    2e-43  17%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    3e-43  21%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    3e-43  21%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    6e-43  19%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    6e-43  14%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    1e-42  13%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-42  12%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-42  18%  3b70A  [x.x.x] ENOYL REDUCTASE
    3e-42  16%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    3e-42  19%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    4e-42  13%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-41  15%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    9e-40  13%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    9e-40  15%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    1e-39  19%  3b6zA  [x.x.x] ENOYL REDUCTASE
    2e-39  12%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    2e-39  13%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    4e-39  14%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    4e-39  20%  1bxzA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-38  13%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-37  16%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    2e-37  15%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    9e-37  19%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-36  16%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-35  16%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    4e-35  16%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    6e-29  13%  2dg2A  [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
    8e-26  14%  2ebjA  [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
    6e-25  11%  1dlgA  [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
    2e-18  10%  3c3pB  [x.x.x] METHYLTRANSFERASE
    4e-18  10%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
    2e-16  12%  3dwgA  [x.x.x] CYSTEINE SYNTHASE B
    4e-16  11%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    6e-16  16%  2eguA  [x.x.x] CYSTEINE SYNTHASE
    2e-15  11%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    2e-14  13%  3dwiA  [x.x.x] CYSTEINE SYNTHASE B
    6e-14  10%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    8e-14  12%  3c85D  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-13  14%  3dwgB  [x.x.x] CYSTEINE SYNTHASE B
    1e-13   9%  3e8wA  [x.x.x] TAKEOUT-LIKE PROTEIN 1
    5e-13  12%  3dkiA  [x.x.x] CYSTEINE SYNTHASE B
    2e-12  12%  3dwiB  [x.x.x] CYSTEINE SYNTHASE B
    1e-11  15%  3dkiB  [x.x.x] CYSTEINE SYNTHASE B
    2e-11  14%  2bhtD  [x.x.x] CYSTEINE SYNTHASE B
    4e-11   9%  3c3pC  [x.x.x] METHYLTRANSFERASE
    2e-09  12%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    3e-09   7%  1ch6A  [x.x.x] GLUTAMATE DEHYDROGENASE
    3e-06  20%  2b4qB  [x.x.x] RHAMNOLIPIDS BIOSYNTHESIS 3-OXOACYL-[ACYL-
    3e-06  21%  3dezB  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    4e-06  18%  1d6sA  [c.79.1] O-ACETYLSERINE SULFHYDRYLASE
    5e-06  11%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    7e-06  18%  2ae1A  [x.x.x] TROPINONE REDUCTASE-II
    7e-06  12%  2e37E  [x.x.x] L-LACTATE DEHYDROGENASE
    1e-05  23%  3dezA  [x.x.x] OROTATE PHOSPHORIBOSYLTRANSFERASE
    1e-05  14%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    2e-05   9%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    2e-05   9%  1b8pA  [c.2.1 - d.162.1] PROTEIN (MALATE DEHYDROGENASE)
    3e-05  14%  3e9qA  [x.x.x] SHORT-CHAIN DEHYDROGENASE
    3e-05  14%  3ce6D  [x.x.x] ADENOSYLHOMOCYSTEINASE
    3e-05  14%  3c85B  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    3e-05  13%  2c5eA  [x.x.x] GDP-MANNOSE-3', 5'-EPIMERASE
    6e-05  27%  2d1yB  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    7e-05  18%  2c29F  [x.x.x] DIHYDROFLAVONOL 4-REDUCTASE
    9e-05  27%  2d1yD  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    9e-05  16%  2cnbA  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    1e-04  11%  1bxkA  [c.2.1] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    1e-04  14%  2bllA  [x.x.x] PROTEIN YFBG
    1e-04  27%  2d1yA  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-04  18%  3ctmF  [x.x.x] CARBONYL REDUCTASE
    2e-04  17%  1a27A  [c.2.1 (1i5rA)] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    2e-04  10%  3c3pA  [x.x.x] METHYLTRANSFERASE
    2e-04  23%  2belC  [c.2.1] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    2e-04  29%  2d1yC  [x.x.x] HYPOTHETICAL PROTEIN TT0321
    2e-04  17%  3c3xA  [x.x.x] EUGENOL SYNTHASE 1
    3e-04  13%  3e48B  [x.x.x] PUTATIVE NUCLEOSIDE-DIPHOSPHATE-SUGAR EPIMERASE
    3e-04  14%  1dohB  [c.2.1] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-04   8%  3ed8C  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    3e-04  21%  1cwuA  [c.2.1] ENOYL ACP REDUCTASE
    3e-04   6%  3bywC  [x.x.x] PUTATIVE ARABINOFURANOSYLTRANSFERASE
    3e-04   6%  2eggB  [x.x.x] SHIKIMATE 5-DEHYDROGENASE
    3e-04  11%  1cg1A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    3e-04  17%  3c6kB  [x.x.x] SPERMINE SYNTHASE
    6e-04   6%  1buaA  [c.52.1] ENDONUCLEASE ECORV
    7e-04  25%  3ch6B  [x.x.x] CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
    7e-04  15%  1a9zA  [x.x.x] UDP-GALACTOSE 4-EPIMERASE
    7e-04  19%  3a25A  [x.x.x] UNCHARACTERIZED PROTEIN PH0793
    8e-04  17%  3edmB  [x.x.x] SHORT CHAIN DEHYDROGENASE
    8e-04  18%  2cnbC  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    9e-04  21%  1cg3A  [c.37.1] PROTEIN (ADENYLOSUCCINATE SYNTHETASE)
    9e-04  15%  3d5tC  [x.x.x] MALATE DEHYDROGENASE
    0.001  23%  2bgkA  [x.x.x] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
    0.001  16%  2an3B  [x.x.x] PHENYLETHANOLAMINE N-METHYLTRANSFERASE
    0.001   8%  1eamA  [c.66.1] PROTEIN (VP39)
:339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXX
2eihA           MRAVVMRARGGPEVLEVA-DLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLPLPHVLGADGSGVV
2eerB           MRAMRLVEIGKPLKLE---DIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLVKLPVTLGHEIAGRI
1ee2A           CKAAVLWEQKKPFSIE---EVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVAP--LPVIAGHEAAGIV
2d8aA           -KVAIKTKPGYGAELV---EVDVPKPGPGEVLIKVLATSICGTDLHIYEWNWAQSRIKPPQIGHEVAGEV
2c0cA           MQKLVVTRLSPNFREAVTLDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEV
2dm6A           AKSWTLKKHFTQSDFELK-TVELPPLKNGEVLLEALFLSVDPYMRIASKRLK----EGAVMMGQQVARVV
1axeA           CKAAVLWEEKKPFSIE---EVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTP--LPVIAGHEAAGIV
2eerA           MRAMRLVEIGKPLKLE---DIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGLGVKLPVTLGHEIAGRI
2c0cB           MQKLVVTRLSPNFREAVTLDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEV
1a71A           CKAAVLWEEKKPFSIE---EVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTP--LPVIAGHEAAGIV
1d1sA           CKAAVLWEQKQPFSIE---EIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS--KFPVIVGHEATGIV
2dfvA           -KVAIKTKPGYGAELV---EVDVPKPGPGEVLIKVLATSICGTDLHIYEWNWAQSRIKPPQIGHEVAGEV
1d1tA           CKAAVLWEQKQPFSIE---EIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS--KFPVIVGHEATGIV
2dq4A           MRALAKLAPEEGLTLV---DRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARIRPPLVTGHEFSGVV
2cf5A           TTGWAARDPSGILSPY---TYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGM-SNYPMVPGHEVVGEV
2dphA           NKSVVYHGTRDLRVETVPYLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFI--VPKGHVLGHEITGEV
1axgA           CKAAVLWEEKKPFSIE---EVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTP--LPVIAGHEAAGIV
2cd9B           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGTDREIVNGKLTL-GKDFLVLGHEAIGVV
1cdoA           CKAAVAWEANKPLVIE---EIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKD-GFPVVLGHEGAGIV
3b70A           QTALTVNDHDEVTVWN---AAPCPMLPRDQVYVRVEAVAINPSDTKMRGQF----ATPWAFLGTDYAGTV
3cosA           CKAAIAWEAGKPLCIE---EVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEG-LAFPVIVGHEAAGIV
1e3jA           LSAVL----YKQNDLRLE-QRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIAIVKDPMVIGHEASGTV
2cdaB           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGTDREIVNGKL---GKDFLVLGHEAIGVV
2b5wA           MKAIAVKRGEDRPVVI---EKPRPEPESGEALVRTLRVGVCGTDHEVIAGGHGGFPEGEDHLVLGHEAVG
2cdaA           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGTDREIVNGKL--KGKDFLVLGHEAIGVV
1e3eA           ----------------------------------------------------------------------
3b6zA           QTALTVNDHDEVTVWN---AAPCPMLPRDQVYVRVEAVAINPSDTKMRGQFA----TPWAFLGTDYAGTV
2cdbC           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGADREIVNGKL----KDFLVLGHEAIGVV
2cdbA           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGADREIVNGKLKG--KDFLVLGHEAIGVV
2cdbB           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGADREIVNGKL---GKDFLVLGHEAIGVV
1bxzA           MKGFAMLSIGKVGWI----EKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGE-RHNMILGHEAVGEV
2cd9A           MKAIIVKPPNAGVQVK---DVDEKKLSYGKIKIRTIYNGICGTDREIVNGKLTLSKGK--DFLVLGHEAI
3cosD           ----------------------------------------------------------------------
1e3lB           CKAAIAWKTGSPLCIE---EIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVV-----------
2b83A           MKGFAMLGINKLGW----IEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEG-ALGDRKNMILGHEAVGEV
2b5vA           MKAIAV-KRGRPVVI----EKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVG
1e3lA           CKAAIAWKTGSPLCIE---EIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFP-------------
1e3eB           CKAAIAWKTGSPLCIE---EIEVSPPKACEVRIQVIATCVCPTDINATDPKKK--ALFPVVLG-------
2dg2A           ----------------------------------------------------------------------
2ebjA           ----------------------------------------------------------------------
1dlgA           ---------------------LGTKVERGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQV
3c3pB           ----------------------------------------------------------------------
3eeqB           ----------------------------------------------------------------------
3dwgA           ----------------------------------------------------------------------
1dl5B           ----------------------------------------------------------------------
2eguA           ----------------------------------------------------------------------
1dl5A           ----------------------------------------------------------------------
3dwiA           ----------------------------------------------------------------------
3d3jA           ----------------------------------------------------------------------
3c85D           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------
3e8wA           ----------------------------------------------------------------------
3dkiA           ----------------------------------------------------------------------
3dwiB           ----------------------------------------------------------------------
3dkiB           ----------------------------------------------------------------------
2bhtD           ----------------------------------------------------------------------
3c3pC           ----------------------------------------------------------------------
3c85C           ----------------------------------------------------------------------
1ch6A           RVRGILRIIKPCNHVL---SLSFPIRRDDGSWEVIEGYRAQHSHQRTPCKGGIRYSTSLMTYKCAVVDVP
2b4qB           ----------------------------------------------------------------------
3dezB           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3dulB           ----------------------------------------------------------------------
2ae1A           ----------------------------------------------------------------------
2e37E           ----------------------------------------------------------------------
3dezA           ----------------------------------------------------------------------
2cnbB           ----------------------------------------------------------------------
3dulA           ----------------------------------------------------------------------
1b8pA           ----------------------------------------------------------------------
3e9qA           ----------------------------------------------------------------------
3ce6D           ----------------------------------------------------------------------
3c85B           ----------------------------------------------------------------------
2c5eA           ----------------------------------------------------------------------
2d1yB           ----------------------------------------------------------------------
2c29F           ----------------------------------------------------------------------
2d1yD           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
2d1yA           ----------------------------------------------------------------------
3ctmF           ----------------------------------------------------------------------
1a27A           ----------------------------------------------------------------------
3c3pA           ----------------------------------------------------------------------
2belC           ----------------------------------------------------------------------
2d1yC           ----------------------------------------------------------------------
3c3xA           ----------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
1dohB           ----------------------------------------------------------------------
3ed8C           ----------------------------------------------------------------------
1cwuA           ----------------------------------------------------------------------
3bywC           ----------------------------------------------------------------------
2eggB           ----------------------------------------------------------------------
1cg1A           ----------------------------------------------------------------------
3c6kB           ----------------------------------------------------------------------
1buaA           ----------------------------------------------------------------------
3ch6B           ----------------------------------------------------------------------
1a9zA           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3edmB           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
1cg3A           ----------------------------------------------------------------------
3d5tC           ----------------------------------------------------------------------
2bgkA           ----------------------------------------------------------------------
2an3B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTA
2eihA           DAVGPGVEGFAPGDEVVIEDNLCPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTA
2eerB           EEVGDEVVGYSKGDLVAVEEHLCDSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTT
1ee2A           ESIGEGVTTVRPGDKVIPLFIPQCGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTG
2d8aA           VEIGPGVEGIEVGDYVSVETHIKCYTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAV
2c0cA           VALGLSASARYTVGQAVAYM------------APGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYI
2dm6A           ESKNSAFPAGSIVLAQSGWT-------------THFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTA
1axeA           ESIGEGVTTVRPGDKVIPLWTLSMPRGTMQDLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
2eerA           EEVGDEVVGYSKGDLVAVEEHLCDSPRWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTT
2c0cB           VALGLSASAR------------YTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYI
1a71A           ESIGEGVTTVRPGDKVIPLWTLSMPRGTMQDGTTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
1d1sA           ESIGEGVTTVKPGDKVIPLFLPQCRKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTG
2dfvA           VEIGPGVEGIEVGDYVSVETHGKCYACRRGQYHDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAV
1d1tA           ESIGEGVTTVKPGDKVIPLFFTCKGKPVHHFLNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTG
2dq4A           EAVGPGVRRPQVGDHVSLNYHVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAV
2cf5A           VEVGSDVSKFTVGDIVGVGCLVGCCGGCNGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTV
2dphA           VEKGSDVELMDIGDLVSVPFADLGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLIS
1axgA           ESIGEGVTTVRPGDKVIPLFFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTG
2cd9B           EESYHGFSQGDLVMPVNRRGCGICRGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
1cdoA           ESVGPGVTEFQPGEKVIPLFFTCKGRKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTG
3b70A           VAVGSDVTHIQVGDRVYGAQ----NEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTA
3cosA           ESIGPGVTNVKPGDKVIPLYAPLLMEDVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTG
1e3jA           VKVGKNVKHLKKGDRVAVYNLCPDLTFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGV
2cdaB           EESYHGFSQGDLVMPVNRRGCGICRGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLAEVQK
2b5wA           VVVDPNDTELEEGDIVVPTVRRPPASGRGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEK
2cdaA           EESYHGFSQGDLVMPVNRRGCGICRGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
1e3eA           ----------------------------YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
3b6zA           VAVGSDVTHIQVGDRVYGAQ----NEMCPRTPDQGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTA
2cdbC           EESYHGFSQGDLVMPVNRRGCGICRGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
2cdbA           EESYHGFSQGDLVMPVNRRGCGICRGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
2cdbB           EESYHGFSQGDLVMPVNRRGCGICRGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLAVQKR
1bxzA           VEVGSEVKDFKPGDRVVVPAITPDWRTSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTG
2cd9A           GVVEESYHGFSQGDLVMPVNRTGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEK
3cosD           ----------------------------YHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTG
1e3lB           ----------------------------YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
2b83A           VEVGSEVKDFKPGDRVIVPCTGMLAGWKFSNFKDGVFGEYFHVNDADLAILPKDMPLENAVMITDMMTTG
2b5vA           VVVDPNDTELEEGDIVVPTVRRPPASGRGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEK
1e3lA           ----------------------------YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
1e3eB           ----------------------------YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSG
2dg2A           ----------------------------------LSQEEAQAVDQELFNEYQFSVDQLELAGLSCATAIA
2ebjA           ---------------------------VTGFEPFGSLEHNPSQALLDLLPSEVDGKPLRKAVLPVDAEAL
1dlgA           SLPG--------------GSAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGA
3c3pB           --------------------------------VDSRIGAYLDGLLPEADPVVAAEQIARERNIPIVDRQT
3eeqB           ----------------------RYKDAEIETIWKCYDAIVFVMALEGATRIVCKYAKEDPAIVCIDDKIN
3dwgA           -----------------------------LQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMI
1dl5B           --------------------VSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQPSL
2eguA           --------------------------ELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMI
1dl5A           --------------------VSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQPSL
3dwiA           -----------------------------LQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMI
3d3jA           ----------------------------------IVPSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLT
3c85D           ---------------------------------------------------------ILGGRIGTGAYDE
3dwgB           -----------------------------LQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMI
3e8wA           ----------------------------------------------------------------------
3dkiA           -----------------------------LQRLSPRWDDGRDGPHVRLWAKLE--DRNPTGSIDRPAVRM
3dwiB           ---------------------------------PRWDDGRDGPHVRLWAKLEDR-NPTGSIKDRPAVRMI
3dkiB           --------------------------------LSPRWDDGRDGPHVRLWAKLEDRNPTGSIDRPAV--RM
2bhtD           ---------------------------LEQTIGNTPLVKLQRMGPDNGSEVWLLEGNNPAGSVDRAALSM
3c3pC           --------------------------------VDSRIGAYLDGLLPEADPVVAAEQIARERNIPIVDRQT
3c85C           ----------------------------------------------------------------------
1ch6A           FGGAKAGVKINPKNYTDEDLEKIPGVDVPAPNMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQG
2b4qB           ----------------------------------------------------------------------
3dezB           ------------------------------------FVETIKEAFPEVEVI---AGTA-TAGIPHGAIIA
1d6sA           ------------------------------------LVRLNRIGNGRILAKVESRNPSFSVACRIGANMI
3dulB           ------------------------------------------IPKDSTLEEVLQVNAAANLPAHDVSPTQ
2ae1A           ----------------------------------------------------------------------
2e37E           ----------------------------------------------------------------------
3dezA           --------------------------------------------------------------LPLAYIRS
2cnbB           ----------------------------------------------------------------------
3dulA           ------------------------------------------IPKDSTLEEVLQVNAAANLPAHDVSPTQ
1b8pA           ----------------------------------------------------------------------
3e9qA           ----------------------------------------------------------------------
3ce6D           --------------------------------------AAAGDLAFPAINVNDSVTKSKFDNKYGTRHSL
3c85B           ----------------------------------------------------------------------
2c5eA           --------------------------------------------------------------------TY
2d1yB           ----------------------------------------------------------------------
2c29F           ----------------------------------------------------------------------
2d1yD           ----------------------------------------------------------------------
2cnbA           ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
2bllA           ----------------------------------------------------------------------
2d1yA           ----------------------------------------------------------------------
3ctmF           ----------------------------------------------------------------------
1a27A           ----------------------------------------------------------------------
3c3pA           --------------------------------VDSRIGAYLDGLLPEADPVVAAEQIARERNIPIVDRQT
2belC           ----------------------------------------------------------------------
2d1yC           ----------------------------------------------------------------------
3c3xA           ----------------------------------------------------------------------
3e48B           ----------------------------------------------------------------------
1dohB           --------------------------------------------------------------------IP
3ed8C           ---------------------------------------------------------CTTGKLPVPWPTL
1cwuA           ----------------------------------------------------------------------
3bywC           -------------------------------------SSVSWPQNGSLNSVSAPLSYTPISFDAKIPVAS
2eggB           -------------------------------------------------------------GYNTDGLGY
1cg1A           ---------------------------------AALMKEMKELEDRG-IPVRERLLLSEACPLILDYHVA
3c6kB           -----------------------------------------------------------DVNLAESDLAY
1buaA           ----------------------------------------------------------------------
3ch6B           ------------------------------------------------------ASMTGGQQMGRGSNEE
1a9zA           ----------------------------------------------------------------------
3a25A           ----------------------------------------------------------------------
3edmB           ----------------------------------------------------------------------
2cnbC           ----------------------------------------------------------------------
1cg3A           -----------------------------------ALMKEMKELEDRGIPVRERLLLSEACPLILDYHVA
3d5tC           ----------------------------------------------------------------------
2bgkA           ----------------------------------------------------------------------
2an3B           ----------------------------------------------------------------------
1eamA           ----------------------------------------------------PAKKLPYQGQLKLLLG--


                         +         .         .         .         .         *         .:210
query           HRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
2eihA           WQMVVDKLGVRPGDDVLVMAAGSGVSVAAIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPDWP
2eerB           YRAVRKASLDP-SKTLVVIGAGGGLGTMAIQIAKAVSGATIIGVDVREEAEAAKRAGADYVINASSQDPV
1ee2A           YGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKP
2d8aA           DTVL---AGPISGKSVLITGA-GPLGLLGIAVAKASGAPVIVSEPSDFRRELAKKVGADYVINPFEEDVV
2c0cA           SLKE--LGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVG
2dm6A           YFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
1axeA           YGSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKP
2eerA           YRAVRKASLDP-SKTLVVIGAGGGLGTMAIQIAKAVSGATIIGVDVREALEAAKRAGADYVINASSQDPV
2c0cB           SLKELGG--LSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVG
1a71A           YGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKP
1d1sA           YGAAVKTGKVKPGSTCVVFGL-GGVGLSVIMGCKSAGARIIGIDLNKDKFEKAMAVGATECISPKDSTKP
2dfvA           DTVL---AGPISGKSVLITGA-GPLGLLGIAVAKASGAYPIVSEPSDFRRELAKKVGADYVINPFEEDVV
1d1tA           YGAAVKTGKVKPGSTCVVFGL-GGVGLSVIMGCKSAGARIIGIDLNKDKFEKAMAVGATECISPKDSTKP
2dq4A           HTVYAGSGV---SGKSVLITGAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDLL
2cf5A           YSPLSHFGLKQPGLRGGILGL-GGVGHMGVKIAKAMGHHVTVISSSNKKREEAQDLGADDYVIGSDQAKM
2dphA           DILPTVSAGVKPGSHVYIAG-AGPVGRCAAAGARLLGAAVIVGDQNPERLKLLSDAGFETIDLRNSAPLR
1axgA           YGSAVKVAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKP
2cd9B           SIEEITCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
1cdoA           FGAAVNTAKVEPGSTCAVFGL-GAVGLAAVMCHSAGAKRIIAVDLNPDKFEKAKVFGATDFVNPNDHSEP
3b70A           GLSADQPPTHSKPVYVLVYGGSTATATVTMQMLRL-SGYIPIATCSPHNFDLAKSRGAEEVFDYRAPNLA
3cosA           YGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHKP
1e3jA           HACRRAGVQ---LGTTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAK--
2cdaB           RVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
2b5wA           ALEHAYSAFDWDPSSAFVLGN-GSLGLLTLAMLKVDDKGYENCLGRRDRPDPTIDIIEELDATYVDSRQT
2cdaA           SIEEILCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
1e3eA           YGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKP
3b6zA           GLAMKLPPTHSKPVYVLVYGGSTATATVTMQMLRLSGYIPIATC-SPHNFDLAKSRGAEEVFDYRAPNLA
2cdbC           SIEEILCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
2cdbA           SIEEILEVQGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
2cdbB           VPVWTCDDGTLNCRKVLVVGT-GPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
1bxzA           FHGAEL-ADIELGATVAVLGI-GPVGLMAVAGAKLRGAGRIIAVGSPVCVDAAKYYGATDIVNYKDGPIE
2cd9A           SIEEILCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY
3cosD           YGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHKP
1e3lB           YGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKP
2b83A           FHGAEL-ADIQMGSSVVVIGI-GAVGLMGIAGAKLRGAGIIGVGSRPICVEAAKFYGATDILNYKNGHIV
2b5vA           ALEASRSAFDWDPSSAFVLGN-GSLGLLTLAMLKVDDKGYENLYGRRDRPDPTIDIIEELDATYVDSRQT
1e3lA           YGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKP
1e3eB           YGAAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKP
2dg2A           K--AYPPTSSKSPPTVLVICGPGNNGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKDIPFLGEP
2ebjA           GEALEDLHREGPKAVLHLGLAEDRPVLTLERLAVNLLDFRPDNRGRVLEDLPIVPGGPLA---LPARFPV
1dlgA           TVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVRLGGGVYRVLPDRIETG
3c3pB           GRLLYLLARIKQPQLVVVPGD-GLGCASWWFARAISISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVG
3eeqB           YVIP-------------LLGGHWGANDIARELSVILNSTPIITKLSIERIANILIAKIINPENIVKINAA
3dwgA           EQAE-ADGLLRPGATILEPTS-GNTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAAEGGSN
1dl5B           MALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCG
2eguA           EAAE-KAGKLKPGDTIVE-PTSGNTGIGLAMVAAAKGYKAVLVMPSLERRNLLRAYGAELVLTPGAQGMR
1dl5A           MALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCG
3dwiA           EQAEAD-GLLRPGATILEPTS-GNTGISLAMAARLKGYRLICVMPEVERRQLLELYGAQIIFSAGGNTAV
3d3jA           LERRLEMTGVCAVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVS
3c85D           ISLGIEINVISGDVKLVLLAPHHQGNQTALEQLQRRNYQIAAIAEYPDQLEGLLESGVDAAFNIYSEAGS
3dwgB           EQAE-ADGLLRPGATILEPTSG-NTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAANTAVA
3e8wA           ---------------------GLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDAKGHYTAGGRI
3dkiA           IEQAEADGLLRPGATILEPTS-GNTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAAEGGSN
3dwiB           EQAEAD-GLLRPGATILEPTSGN-TGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAASNTAV
3dkiB           IEQAEADGLLRPGATILEPTSG-NTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIF--------
2bhtD           IVEAEKRGRIKPGDVLIEATS-GNTGIALAMIAALKGYRMKLL-MPDERRAAMRAYGAELIMEGARDLAL
3c3pC           GRLLYLLARIKQPQLVVVPGD--GLGCASWWFARAISSSRVVIDPDRDNVEHARRLHDNGLIDRVELQVG
3c85C           ---------INPGHAQVLILG-GRIGTGAYDELRARYKISLGIEIREEAAQQHRSEGRNVISGD--ATDP
1ch6A           GIHG-RISATGRGVFHGIENFIENASYMS-----------------------------------------
2b4qB           ---MHPYFSLA-GRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQA---IP
3dezB           DKMSQIEGRVTKGQKMVIIESTGGSVLDAVAAAQREGADVLGVVELPKATANFEKASVKLVTLSNYSELI
1d6sA           WDA-EKRGVLKPGV-ELVEPTNGNTGIALAYVAAARGYKLTLTMPSIERRKLLKALGANLVLTEGAKGM-
3dulB           GKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADI-----ARSNIERANLNDR
2ae1A           -----------EGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNDCLTQWRSK--GFKVEASV
2e37E           --------------KVGIVGSGVGSATAYALALLGVAREVVLVDLDRKLAQAHAEATPFAHPVWVRAGSY
3dezA           KPKNQIEGRVTKGQKMVIIESTGGSVLDAVAAAQREGADVLGVVELPKATANFEKASVKLVTLSNYSELI
2cnbB           -----------SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSDQQSDGPKPPWADRYA
3dulA           GKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANL-----NDR
1b8pA           ----------KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMM-EID
3e9qA           -----------NDRIILVTGASDGIGREAATYARYGATVILLGRNEEKLRQVASHINEETGRQPQWFILD
3ce6D           IDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGARVSVTEIDPINALQAMMEGFDVVTVEEAIGDA
3c85B           ---------INPGHAQVLILG-GRIGTGAYDELRARGKISLGIEIREEAAQQHRSEGRNVISGDATDP--
2c5eA           KELEREQYWPSENLKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMEN
2d1yB           -----------AGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDEFV
2c29F           --------------TVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHWKADLADEGSFDEAI
2d1yD           -----------AGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDEFV
2cnbA           -----------SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTHGKSD---------------
1bxkA           ---------------ILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVA------QSER
2bllA           --------------RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIH
2d1yA           -----------AGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDEFV
3ctmF           -----------KGKVASVTGSSGGIGWAVAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGV--HSKAYK
1a27A           -----------ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
3c3pA           GRLLYLLARIKQPQLVVVPGD--GLGCASWWFARAISISSRVVIDPDR----------------------
2belC           -HMEFRPEMLQ-GKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVS-HCLELGAASAHYIA
2d1yC           -----------AGKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDEFV
3c3xA           --------------KILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDQSLGAIIVKGELDEH
3e48B           ----------------ILTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGKVSVRQLDYFNQE
1dohB           GPLGPQSASLE-GKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKNGS-DAACVK
3ed8C           LQCFARYPDHMKQHDFFKSA-MPEGYVQERTISFKDDGKYKTRAVKFEGDTLVNRIELKGTDFKEDGNIL
1cwuA           -----------RGKRAFIAGIADDNGYVAKSLAA-AGAEILVGTWVPALNIFETS---------------
3bywC           VDKLRKDQDL-----ILGTLPANSEDAGARGLFVRANDDGLQITSGELVLDLSKRATIAISATEDETTAG
2eggB           VQALEEEMNITLDGKRSDIIYNQNGVGMLVYQGALAFEKWTGQWPDVNRMKQLVI---------------
1cg1A           LDNAREKARGAK----AIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKA
3c6kB           TRAIMGSGEDYTGKDVLILG--GGDGGILCEIVKLKPKMVTMVEIDQMYMRKVLDNLKGDCYQVLIEDCI
1buaA           HWIIGYVYTRVKTYNINELNEIPKPYKVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDS
3ch6B           FRPEMLQGKK-----VIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQK------------------
1a9zA           --------------RVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKR--SVLPVIERLGGKHPTFV
3a25A           ---------AKPDELVVDMFA--GIGHLSLPIAVYGKAKVIAIEKDPYTFKFLVENKVEDRMSAYNMDNR
3edmB           -----------TNRTIVVAGAGRDIGRACAIRFAQEGANVVLTYNGAAEGEIEKLGRSALAIKADLTNAA
2cnbC           -----------SHMRVLVCGGAGYIGSHFVRALLRDTNHSVVIVDSLVGTH-------------------
1cg3A           LDNARE----KARGAKAIGTTGRGIGPAYEDKVALRGLRVGDLFDKETFAEKLKEV--------------
3d5tC           ----------KPAKRVAVTGAAGQIAYSLLFRIANGDLLGKDQP--------------------------
2bgkA           -----------QDKVAIITGGAGGIGTTAKLFVR-YGAKVVIADIADDHGQKVCN---------------
2an3B           -LAQTFATGEVSGRTLIDIGS--GPTVYQLLSACSHFEDITMTDFLEVNGRWLQEEPGAFNWSMYSQHAC
1eamA           ELFFLSKLQRHGILDGATVVYIG-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
2eihA           KEVRRLTGGK-----------GADKVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFYRQ
2eerB           SEIRRITQGKG-----------ADAVIDLNNSEKTLSYPYVLAKQGKYVMVGLFGADLKY-HAPLITLNE
1ee2A           IQEVLTE----------MSNGGVDFSFEVIGRLDTMVASCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSG
2d8aA           KEVDITDG-----------NGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKA
2c0cA           TVLKQEYPE------------GVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTLPAKLLKKS
2dm6A           EEALKKAS-----------PDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMDSPESIIYKQ
1axeA           IQEVLTEM----------SNGGVDFSFEVIGRLTMVTALSCCQEAYGVSVIVGVPPDSQNLMNPMLLLSG
2eerA           SEIRRITQGKG-----------ADAVIDLNNSEKTLSYPYVLAKQGKYVMVGLFGADLKY-HAPLITLNE
2c0cB           TVLKQEYP------------EGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPASVQG
1a71A           IQEVLTE----------MSNGGVDFSFEVIGRLDTMVLSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSG
1d1sA           ISEVLSEMTG----------NNVGYTFEVIGHLEIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTG
2dfvA           KEVDITDG------------NGVDVFLEFSGAPKALEGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKA
1d1tA           ISEVLSEMTGNNV--------GYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTG
2dq4A           EVVRRVTG-----------SGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIRFDLAGELVMRG
2cf5A           SELADS----------------LDYVIDTVPVHHALEPYLSLKLDGKLI-LMGVINNPLQFLTPLLMLGR
2dphA           DQIDQILGGVDAVGF---EAHGLGDEANTETPGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNGKMWTKS
1axgA           IQEVLTE----------MSNGGVDFSFEVIGRLDTMVTLSCCQEAYGVSVIVGVPPDSQNLMNPMLLLSG
2cd9B           DKLKDSVG-----------KFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKEIVHTN
1cdoA           ISQVLSKMTN---------GGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGWTDLHDVATRPIQLIAG
3b70A           QTIRTYTK------------NNLRYALDCITNVETFCFAAIGRAGGHYVSLNPFPETRKMVTTDWTLGPT
3cosA           IQEVIIE----------LTKGGVDFALDCAGGSETMKALDCTTAGWGSCTFIGVAAGSKGLVFPEELIIG
1e3jA           ---EEESSIIERI--RSAIGDLPNVTIDCSGNEKCITGINITRTGGTL-MLVGMGSQMVTVPLVNACARE
2cdaB           DKLKDSVG-----------KFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKEIVHTN
2b5wA           PVEDVPDV-----------YEQMDFIYEATGPKHAIQSVQALAPNGVGALLGVPSDWDAGAFHREMVLHN
2cdaA           DKLKDSVGKF-----------DVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKEIVHTN
1e3eA           VQDVITELTA----------GGVDYSLDCAGAQTLKAAVDCTVLGWGSCTVVGAKVDEMT-IPTVDVILG
3b6zA           QTIRTYT------------KNNLRYALDCITNVETFCFAAIGRAGGHYVSLNPFPRKMVTTDWTLAPYGR
2cdbC           DKLKDSVG-----------KFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKEIVHTN
2cdbA           DKLKDSVG-----------KFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKEIVHTN
2cdbB           DKLKDSVG-----------KFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKEIVHTN
1bxzA           SQIMNLTE-----------GKGVDAAIIAGGADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEW-GC
2cd9A           DKLKDSVG-----------KFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDLQEIVHTN
3cosD           IQEVIIELTK----------GGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTPEELIIG
1e3lB           VQDVITE----------LTAGGVDYSLDCAGTATLKAAVDCTVLGWGSCTVVGAKVDEMT-IPTVDVILG
2b83A           DQVMKLTN-----------GKGVDRVIMAGGGSETLSAVSMVKPGGIISNINYHGSGDALLEWGCGMAHK
2b5vA           PVEDVPDV-----------YEQMDFIYEATGFPHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAMVLHN
1e3lA           VQDVITELTA----------GGVDYSLDCAGTAQTLKAVDCTVLGWGSCTVVGAKVDEMT-IPTVDVILG
1e3eB           VQDVITEL----------TAGGVDYSLDCAGTAQTLKAVDCTVLGWGSCTVVGAKVDEMTIPTVDVI-LG
2dg2A           PEPV---------------DELYELVVDAIFGFSFKGDVRLSGLTVPIASIDIPSGWDVEKGNPSGIQPD
2ebjA           KPVLARWR-----------EAGIPGRPSLSAGSYLCNSLYRLPEEVPVGFLHLPPDETLALKRRPYVPLE
1dlgA           TFLVAAAI------------SGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPK---A
3c3pB           DPLGI-----------AAGQRDIDILFDCDVFADVLERNRCLAKNALLIAVNALRREFNHHLSRRRDFFT
3eeqB           LL----------------RDESICIDGINVNFPENIKVCSYIISLRDKEYKDKIVVWLKPLKISIGIGSK
3dwgA           TAVA----------------TAKELAATNPSWVMLYQYGNPANTDSHYCGTG------------------
1dl5B           DGYYGVP-----------EFSPYDVIFTVGVDEVPETWFTQLKEGGRVIVPINLKLSRR-QPAFLFKKKD
2eguA           GAIAK-----------------------------------------------------------------
1dl5A           DGYYGVP-----------EFSPYDVIFTVGVDEVPETWFTQLKEGGRVIVPINLKL-SRRQPAFLFKKKD
3dwiA           ATAKEL-----------AATNPSWVMLYQYGNPANTDS--------------------------------
3d3jA           SLKDLPTSP-------------VDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDP-------
3c85D           GFARHKQLEPQFT---------------------------------------------------------
3dwgB           T---------------------------------------------------------------------
3e8wA           LILP-------ITGDGQ----MKLKLKNIHIHLVVSYEMEKDAEGVDHVIFKKYTVTFDVKDNAQFGLTN
3dkiA           TAVAT----------------AKELAATNPSWVMLYQYGNPANTDSHYCGTGP-----------------
3dwiB           ATAKELAAT-------NPSWVMLYQYGNPANTDSHYCGT-------------------------------
3dkiB           ----------------------------------------------------------------------
2bhtD           EMANRGE---------------------------------------------------------------
3c3pC           DPLGIAAGQRDI---------DILFDCDVFNGADVLERNRCLAKNALLIA--VNALRRGLREFNHHL---
3c85C           DFWERILD-----------TGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEGLLESGVD
1ch6A           ----------------------------------------------------------------------
2b4qB           ADLSSEAGARRLAQALGELSARLDILVNNAGTSPV-----------------------------------
3dezB           KVAKV-----------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3dulB           VEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYLKLSRPGTVIIG--DNVVREGEVIIRRFYELI
2ae1A           CDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEA-------------------------------
2e37E           GDL--EGARAVVLAAGVAGETRLQLLDRNAQVFAQVVPR-------------------------------
3dezA           KVAKV-----------------------------------------------------------------
2cnbB           ALEVGDVRNEDFLNGVFTRHGPIDAVVHMCA---------------------------------------
3dulA           VEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFKLSRPGTVIIGDNVVR--IRRFYELIAAEPR
1b8pA           DCAFPLLAGMTAHADPMTAFKDADVALLVGAR--------------------------------------
3e9qA           LLTCTSENCQQLAQRIVVNYPRLDGVLHNAGLL-------------------------------------
3ce6D           DIVVTATGNKDIIMLEHIKAMKDHAILGNIG---------------------------------------
3c85B           DFWERILD------------TGHVKLVLLAPHQGNQTALEQLQRRNYKGQIAAIAEYPDQLEG-------
2c5eA           CLKVTEGVDHVFNMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVS--
2d1yB           EEAAYALGR-------------VDVLVNNAAIAAP-----------------------------------
2c29F           KGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFT-------------------
2d1yD           EEAAYALGR-------------VDVLVNNAAIAAP-----------------------------------
2cnbA           ----------------------------------------------------------------------
1bxkA           FAFEKVDICDRAELARVFTEHQPDCVMHLAAESHVDRSI-------------------------------
2bllA           SEWIEYH---------------------------------------------------------------
2d1yA           EEAAYALGR-------------VDVLVNNAAIAAP-----------------------------------
3ctmF           CNISDPKSVEETISQQEKDFGTIDVFVANAGVTW------------------------------------
1a27A           ETLQLDVRDSKSVAAAREREGRVDVLVC------------------------------------------
3c3pA           ----------------------------------------------------------------------
2belC           GTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTS-----------------------------------
2d1yC           EEAAYALGR-------------VDVLVNNAA---------------------------------------
3c3xA           EKLVELMKKV------------------------------------------------------------
3e48B           SVEAFKG---------------------------------------------------------------
1dohB           ANVGVVEDIVRMFEEAVKIFGKLDIVCSNSGV--------------------------------------
3ed8C           G---------------------------------------------------------------------
1cwuA           ----------------------------------------------------------------------
3bywC           IEGDD-----STTETVERDVRPIIGIYTELESN-------------------------------------
2eggB           ----------------------------------------------------------------------
1cg1A           EAYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGV--
3c6kB           PVLKRYAKEGREFDYVINDLTAVPISTSPSTWEFLRLILKVLKQDGKYFT--QGNCVNLTEALSLYEEQ-
1buaA           EDEFLDYWRNYERTS-----QLRNDKYN------------------------------------------
3ch6B           ----------------------------------------------------------------------
1a9zA           EGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEY-----------------------------
3a25A           DF--------------PGENIADRILMGVRTHEFIPKALSIAKDGAIIHYHNTVPEKLMPREPFETF---
3edmB           EV-------EAAISAAADKFGEIHGLVHVAGGLIA-----------------------------------
2cnbC           ----------------------------------------------------------------------
1cg3A           ----------------------------------------------------------------------
3d5tC           ----------------------------------------------------------------------
2bgkA           ----------------------------------------------------------------------
2an3B           LIEGKGECQPQPLGAGSPAPLPADALVSAFCLEAVSPDLTLLRPGGHLLL--IGALEESWYLAGEARLTV
1eamA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQVRGSNGWERDDIEKLFALLASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP
2eihA           LSILGSTMASKSRLFPILRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVLQ-
2eerB           VQFIGSLVGNQSDFLGIMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVLVP
1ee2A           RTWKGAIFGSKDSVPKLVADFMAKALDPLITHVLPFEKINEGFDLLRSGKSIRTILT--
2d8aA           LTIYGITGRHWETWYTVSRLLQSGKLNLDTHKYKGFDKYEEAFELRAGKT--GKVVF--
2c0cA           ASVQGFFLNHQAAMSHLLEMCVSGDLLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVE-
2dm6A           LRIEGFIVYRWQALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
1axeA           RTWKGGGFKSKDSVPKLVADFMAKALDPLITHVLPFEKINEGFDLLRSGESIRTILT--
2eerA           VQFIGSLVGNQSDFLGIMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVL--
2c0cB           FFLNHYLSKYQAAMSHLLEMCVSGDDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVE-
1a71A           RTWKGGGFKSKDSVPKLVADFMAKKLDPLITHVLPFEKINEGFDLLRSGESIRTILT--
1d1sA           RTWKGCVFGSRDDVPKLVTEFLAKKFDQLITHVLPFKKISEGFELLNSGQSIRTVLT--
2dfvA           LTIYGITGRHWETWYTVSRLLQSGKLNLDTHKYKGFDKYEEAFELRAGKTG-KVVFL--
1d1tA           RTWKGCVFGSRDDVPKLVTEFLAKKFDQLITHVLPFKKISEGFELLNSGQSIRTVLT--
2dq4A           ITAFGIARRLWQTWMQGTALVYSGRVDLSLTHRLPLSRYREAFGLLASGQA-VKVILDP
2cf5A           KVITGSFIGSMKETEEMLEFCKEKGLSSIIEV-VKMDYVNTAFERLEKNDVRYRFVVDV
2dphA           IRIMTGMAPVTNYNRHLTEAILWDQSKVMNIEVITLDQAPDGYAKFDKGSP-AKFVIDP
1axgA           RTWKGAIFGGFKSKDSVPKLVAKFALDPLITHVLPFEKINEGFDLLRSGESIRTILT--
2cd9B           KTIIGLVNGQKPHFQQSWKTLYPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
1cdoA           RTWKGSMFGGKDGVPKMVKAYLDKKVKEFITHRMPLESVNDAIDLMKHGKC-IRTVLS-
3b70A           IFGEGSTWFGEDLWRIAGQLVEDGRLVHHRVVQGGFDHIKQGMELVRKGELSGEKLVV-
3cosA           RTINGGGWKSVDSIPKLVTDYKNKKFDALVTHTLPFDKISEAFDLMNQGKSIRTILI--
1e3jA           IDIKSVFRYCNDYPIALMVASGRCNVKQLVTHSFKLEQTVDAFEAARKKADTIKVMISC
2cdaB           KTIIGLVNGQKPHFQQSWKTLYPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
2b5wA           KALVGVNSHVEHFEAATVTFTKLPFLEDLVTGVHPLSEFEAA---FDDDDTTIKTAIE-
2cdaA           KTIIGLVNGQKPHFQQSWKTLYPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
1e3eA           RSINGTGWKSVDSVPNLVSDYKNKDLDLLVTHALPFESINDAIDLMKEGKSIRTILT--
3b6zA           PGSEEERQFGEDLWRIAGQLVEDGRLVHHRVVQGGFDHIKQGMELVRKGELSGEKLV--
2cdbC           KTIIGLVNGQKPHFQQSWKTLYPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
2cdbA           KTIIGLVNGQKPHFQQAVVHLAPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
2cdbB           KTIIGLVNGQKPHFQQSWKTLYPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
1bxzA           GMAHKTIKGGRLRMERLIDLVFYKRVDPSTHVFRGFDNIEKAFMLMKDPKDLIKPVVI-
2cd9A           KTIIGLVNGQKPHFQQSWKTLYPKAAKMLITKTVSINDEKELLKVLREKEGEIKIRIL-
3cosD           RTINGTFFGSVDSIPKLVTDYKNKKLDALVTHTLPFDKISEAFDLMNQGKSIRTILI--
1e3lB           RSINGTGWKSVDSVPNLVSDYKNKDLDLLVTHALPFESINDAIDLMKEGKSIRTILT--
2b83A           TIKGGLCPGGRLRAEMLRDMVVYNRVDLSTHVYHGFDHIEEALLMKDKPKDLIKAVVI-
2b5vA           KALVGSVNSHVEHFEATFTKLPKWFLEDLVTGVHPLSEFEAA---FDDDDTTIKTAIE-
1e3lA           RSINGTGWKSVDSVPNLVSDYKNKDLDLLVTHALPFESINDAIDLMKEGKSIRTILT--
1e3eB           RSINGTFFKSVDSVPNLVSDYKNKKFDLLVTHALPFESINDAIDLMKEGKSIRTILT--
2dg2A           LLISLTAPKKSATHFTGRYHYLGGRVPPALEKKYQLNLPSYPDTECVYR----------
2ebjA           VQARA------------------------------------------------------
1dlgA           VTVRTAPHPAPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIE---
3c3pB           TIVPVGNGVLL------------------------------------------------
3eeqB           KDVKMEEIRDGIYKVLERLNLKRERIGIINPCLTPPKGVAEISALIAGGR-NSKLILR-
3dwgA           -----------------------------------------------------------
1dl5B           PYLVGNYKLE-------------------------------------------------
2eguA           -----------------------------------------------------------
1dl5A           PYLVGNYKLE-------------------------------------------------
3dwiA           -----------------------------------------------------------
3d3jA           -----------------------------------------------------------
3c85D           -----------------------------------------------------------
3dwgB           -----------------------------------------------------------
3e8wA           LFNGNMLTFLNQNWKQVSEEFGKPVMEAAAK--KIFKNIKHFLAKVPIAEIA-------
3dkiA           -----------------------------------------------------------
3dwiB           -----------------------------------------------------------
3dkiB           -----------------------------------------------------------
2bhtD           -----------------------------------------------------------
3c3pC           -----------------------------------------------------------
3c85C           AAFNIYS----------------------------------------------------
1ch6A           -----------------------------------------------------------
2b4qB           -----------------------------------------------------------
3dezB           -----------------------------------------------------------
1d6sA           -----------------------------------------------------------
3dulB           AAEPRVSATASKGYDGFIAV---------------------------------------
2ae1A           -----------------------------------------------------------
2e37E           -----------------------------------------------------------
3dezA           -----------------------------------------------------------
2cnbB           -----------------------------------------------------------
3dulA           VSATALQTVGSKGYDGFIAV---------------------------------------
1b8pA           -----------------------------------------------------------
3e9qA           -----------------------------------------------------------
3ce6D           -----------------------------------------------------------
3c85B           -----------------------------------------------------------
2c5eA           -----------------------------------------------------------
2d1yB           -----------------------------------------------------------
2c29F           -----------------------------------------------------------
2d1yD           -----------------------------------------------------------
2cnbA           -----------------------------------------------------------
1bxkA           -----------------------------------------------------------
2bllA           -----------------------------------------------------------
2d1yA           -----------------------------------------------------------
3ctmF           -----------------------------------------------------------
1a27A           -----------------------------------------------------------
3c3pA           -----------------------------------------------------------
2belC           -----------------------------------------------------------
2d1yC           -----------------------------------------------------------
3c3xA           -----------------------------------------------------------
3e48B           -----------------------------------------------------------
1dohB           -----------------------------------------------------------
3ed8C           -----------------------------------------------------------
1cwuA           -----------------------------------------------------------
3bywC           -----------------------------------------------------------
2eggB           -----------------------------------------------------------
1cg1A           -----------------------------------------------------------
3c6kB           LGRLYCPVEFSKEIVCVPSYL--------------------------------------
1buaA           -----------------------------------------------------------
3ch6B           -----------------------------------------------------------
1a9zA           -----------------------------------------------------------
3a25A           -----------------------------------------------------------
3edmB           -----------------------------------------------------------
2cnbC           -----------------------------------------------------------
1cg3A           -----------------------------------------------------------
3d5tC           -----------------------------------------------------------
2bgkA           -----------------------------------------------------------
2an3B           VEALVRSGYKVRDLRTYI-----------------------------------------
1eamA           -----------------------------------------------------------