[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38511.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "2apoA.bssp"
#ERROR : Can't open dsspfile "2ausA.bssp"
#ERROR : Can't open dsspfile "3dpuB.bssp"
#ERROR : Can't open dsspfile "1c05A.bssp"
#ERROR : Can't open dsspfile "3bbnD.bssp"
#ERROR : Can't open dsspfile "1dm9A.bssp"
#ERROR : Can't open dsspfile "2ab4A.bssp"
#ERROR : Can't open dsspfile "2cqjA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"

## Summary of PDB Search
:795
    2e-28  23%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    3e-27  23%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    4e-26  26%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    2e-18  14%  2apoA  [x.x.x] PROBABLE TRNA PSEUDOURIDINE SYNTHASE B
    3e-16  13%  2ausA  [x.x.x] PSEUDOURIDINE SYNTHASE
    9e-16   6%  3dpuB  [x.x.x] RAB FAMILY PROTEIN
    2e-14  24%  1c05A  [d.66.1] RIBOSOMAL PROTEIN S4 DELTA 41
    5e-10  17%  3bbnD  [x.x.x] RIBOSOMAL PROTEIN S4
    2e-08  13%  1dm9A  [d.66.1] HYPOTHETICAL 15.5 KD PROTEIN IN MRCA-PCKA
    3e-08  15%  2ab4A  [x.x.x] TRNA PSEUDOURIDINE SYNTHASE B
    5e-06  21%  2cqjA  [x.x.x] U3 SMALL NUCLEOLAR RIBONUCLEOPROTEIN PROTEIN
    1e-04  14%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
:795

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRDDRPKFERRERTGDWHEHPRNEGPSSDRPRSRDNGE
3dh3A           ----------------------------------------------------------------------
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           --------------------------------SRYRGPRFKKIRRLG------ALPGLTNKRPRAGSDLR
1dm9A           ----------------------------------------------------------------------
2ab4A           ----------------------------------------------------------------------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RGFDRPRRENEDESKIFAKRPAFGGRGAYRERPKTDRSKTERRXXXXXXXXXXXGDRIAKVVARAGLCSR
3dh3A           ------------------------------------------------------SVRLNKYISESGICSR
3dh3C           ------------------------------------------------------SVRLNKYISESGICSR
3dh3B           ------------------------------------------------------SVRLNKYISESGICSR
2apoA           ----------------------------------------------------------------------
2ausA           --------------------------------------------------------------------AD
3dpuB           ------------------------------------------------------YRIINSSKTKNGHLNT
1c05A           --------------------------------------------------------RLDNLVYRLGLATR
3bbnD           NQSRSGKRSQYRIRLEEKQKLRFHYGITERQLLKYVRIARKAKGSTGQVLLQLLEMRLDNILFRLGMATI
1dm9A           --------------------------------------------------------RLDKWLWAARFYKT
2ab4A           ----------------------------------------------------------------------
2cqjA           --------------------------------------------------------RLPTVLLKLRMAHL
2ausC           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLYHKPRGLMTTHADPEGRPTVF
3dh3A           READRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALNKPVGIVSTTEDGERDNIV
3dh3C           READRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIEPREAEDLVLIALNKPV-GIVSTTEDGERDNI
3dh3B           READRYIEQGNVFLNGKRATIGDVKPGDVVKVNGQLIEPREAEDLVLIALNKPVGIVSTTEDGERDNIVD
2apoA           ----------ELIVKEEVETNWD-----YGCNPYERKIE-DLIKYGVVVVDKPRGPTSHEVSTWVKKILN
2ausA           IKREVIVKDDKAETNPK------------WGFPPDKRPIELHIQYGVINLDKPPGPTSHEVVAWIK----
3dpuB           SALGYILNEENNKFTYTLLEQRYL-LDIMKQFELCYDEGKGLFIIPSNRFIMKYDYLPSTIIPRLMIAMQ
1c05A           RQARQLVTHGHILVDGSRVNIPSYRVKPGQTIAVREKSRNYIPDYLSFDPEKMEGTYTRLPERSELPAEI
3bbnD           PGARQLVNHRHILVNGRIVDIPSYRCKPQDTIMARDEQKSIALIQNSLDLSPREEKHLTLNPFPYKGLVN
1dm9A           RAAREMIEGGKVHYNGQRSKPSKIVELNTLTLRQGNDERTVIVKAITEQRPASEAALLYEETAESVEKRE
2ab4A           ----------------------------------------------ILVAYKPKGPTSH--------DVV
2cqjA           QAAVAFVEQGHVRVGPDVVTDPAVTRSMEDFVTWVDSSKISGPS--------------------------
2ausC           -------------IKREVIKDDKAETNPKWGFPPDKRPIELHIQYGVINLDKPPGPTSHEVVAWIK----


                         .         .         .         *         .         .         .:630
query           DNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPETGWLRRYRVRAHGEVTQAQLDQLASGVEVD
3dh3A           DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPIL
3dh3C           VDFVNHSKRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGV---
3dh3B           FVNHS--KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPIL
2apoA           L------DKAGHGGTLDPKVTGVLPVALERATKTIPMWHIPP--KEYVCLMHLHRDASEEDILRVFKEFT
2ausA           --RILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDKIRAVMKEFEGE
3dpuB           HQILDQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCEYLSIIWYEIKKINANFTNLDVKE--
1c05A           NEA-------------------------------------------------------------------
3bbnD           --------QIIDSKWVGLKINELLV---------------------------------------------
1dm9A           KM--------------------------------------------------------------------
2ab4A           DEVRKKLKKVGHGGTLDPFACGVLIIGVNQGTRIL--EFYKDLKKVFWVKMRLGLITETFDLAREGKIIN
2cqjA           ----------------------------------------------------------------------
2ausC           --RILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHLHGDVPEDKIRAVMKEFEGE


                         .         +         .         .         .         .         *:700
query           GVKYGPIEAKLERDQGANVWLVFAIREGKNREVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVKT
3dh3A           GTVTKKCKVK----KEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIMNVSLSGIPLGEWRDLTD
3dh3C           -PILGTVTKKCKVKKEAPFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIMNVSLSGIPLGEWRDLTD
3dh3B           GTVTKKCKVKKE----APFVFRITLVQGLNRQIRRMCEHFGYEVKKLERTRIMNVSLSGIPLGEWRDLTD
2apoA           GRIYQRRIRELELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEALGTSAHMQELR----------------
2ausA           IIQRKVYYIEILEIDGRDVLFRVGVEAGTYIRSLIHHIG-------------------------------
3dpuB           ---FIPL-PGHPDELVEYKELLGLEKMGRDRYVSKLEKVFS-----------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           LPPKRVKIFKIWDVNIEGRDVSFRVEVSPGTYIRSLCMDIGYTAVELVRESVGPHTIESLNVFEAAPEEI
2cqjA           ----------------------------------------------------------------------
2ausC           IIQRTRKVYYIEILEIDGRDVLFRVGVEAGTYIRSLIHHI------------------------------


                         .         .         .         .         +         .         .:770
query           RVLREQLGEKIIKLAEADFGGPSPSETRPKPRPGKPVAAEDGPAPKKKAVVKRGAVEDRKGRxxxxxxxx
3dh3A           DELI------------------------------------------------------------------
3dh3C           DELI------------------------------------------------------------------
3dh3B           DELI------------------------------------------------------------------
2apoA           ----------------------------------------------------------------------
2ausA           ----------------------------------------------------------------------
3dpuB           ----------------------------------------------------------------------
1c05A           ----------------------------------------------------------------------
3bbnD           ----------------------------------------------------------------------
1dm9A           ----------------------------------------------------------------------
2ab4A           ENRIIPLEKCLEWLPRVVV---HQESTK-MILNGSQIHLEMLKEWDGFKKGEVVRVFNEEGR--------
2cqjA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxx
3dh3A           -------------------------
3dh3C           -------------------------
3dh3B           -------------------------
2apoA           -------------------------
2ausA           -------------------------
3dpuB           -------------------------
1c05A           -------------------------
3bbnD           -------------------------
1dm9A           -------------------------
2ab4A           -------------------------
2cqjA           -------------------------
2ausC           -------------------------