[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38555.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2biwA.bssp"
#ERROR : Can't open dsspfile "1e1hA.bssp"
#ERROR : Can't open dsspfile "3dseA.bssp"
#ERROR : Can't open dsspfile "3c88A.bssp"
#ERROR : Can't open dsspfile "3bwiA.bssp"
#ERROR : Can't open dsspfile "3booA.bssp"
#ERROR : Can't open dsspfile "3btaA.bssp"

## Summary of PDB Search
:467
    e-124  31%  2biwA  [x.x.x] APOCAROTENOID-CLEAVING OXYGENASE
    2e-37  13%  1e1hA  [d.92.1] BOTULINUM NEUROTOXIN TYPE A LIGHT CHAIN
    4e-35  14%  3dseA  [x.x.x] BOTULINUM NEUROTOXIN TYPE A
    1e-20  18%  3c88A  [x.x.x] BOTULINUM NEUROTOXIN A LIGHT CHAIN
    2e-19  18%  3bwiA  [x.x.x] BOTULINUM NEUROTOXIN A LIGHT CHAIN
    8e-13  15%  3booA  [x.x.x] NEUROTOXIN A
    8e-08  13%  3btaA  [d.92.1 - h.4.2 - b.29.1 - b.42.4] PROTEIN (BOTULINUM
:467

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxNLAPIPMECDAPSLPIKGELPRELNGTLYRNGANPQFASPNAHWFFGDGMLHAFRLEN
2biwA           ------------GYQSQPQEWDYWVEDVEGSIPPDLQGTLYRNGPGLLEIRPLKHPFDGDGMVTAFKFPD
1e1hA           ----------------------------------------------------------------------
3dseA           ----------------------------------------------------------------------
3c88A           ----------------------------------------------------------------------
3bwiA           ----------------------------------------------------------------------
3booA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GRASYRNRWVRTPKWLAEHAAGRPLYGEFNLKLPDAPRSAPDDGNVANTNIVFHAGRLLALEEAHLPIEI
2biwA           GRVHFQSKFVRTQGYVEEQKAGKMIYGVFGSQPAGGWLKTIFDLNIANTNITYWGDRLLALWEGGQPHRL
1e1hA           ----------------------------------------------------------------------
3dseA           ----------------------------------------------------------------------
3c88A           ----------------------------------------------------------------------
3bwiA           ----------------------------------------------------------------------
3booA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ERDTLATRGYCDYGGALKGPFTAHPKIDPVTGEMLFFGYNAAGPLKRTMSFGAIDASGHVTRFEYFKAPY
2biwA           EPSNLATIGLDDLGGILGQPLSAHPRIDPASTFPCYVTFSIKSSLSSTLTLLELDPQGKLLRQKTETFPG
1e1hA           ----------------------------------------------------------------------
3dseA           ----------------------------------------------------------------------
3c88A           ----------------------------------------------------------------------
3bwiA           ----------------------------------------------------------------------
3booA           ----------------------------------------------------------------------
3btaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AAMVHDFIVTENYVLFPILPLTGSIWRAMRGRPPYAWDPGKGSYVGVMKRTGTTRDIRWFRGDACFVFHV
2biwA           FAFIHDFAITPHYAIFLQNNVTPYLFGLRGAGECVQFHPDKPAQIILVPRDG--GEIKRIPVQAGFVFHH
1e1hA           -------------------------------------------------------DIAYIKIPNAGQMQP
3dseA           --------------------------------------PFVNKQFNYKDPV-NGVDIAYIKIPNAGQMQP
3c88A           ------------------------------------------------------VDIAYIKIPNAGQMQP
3bwiA           ------------------------------------------------------VDIAYIKIPNAGQMQP
3booA           -------------------------------------------------------DIAYIKIPNVGQMQP
3btaA           ------------------------------------------------------VDIAYIKIPNVGQMQP


                         .         *         .         .         .         .         +:350
query           MNAWEDGTKIVADVMQSEEAPLFTHPDGRRTDPEKGRARLCRWSFDLAGNTNAFKRSYLDDISGEFPRID
2biwA           ANAFEENGKIILDSICYNSLPQV-DTDGDFRSTNFDPGQLWRFTIDPA--AATVEKQLMVSRCCEFPVVH
1e1hA           VKAFKIHNKIWVIPERDTFTNPE-EGDLNPPPEAKQVPVSYYDSTYLS--TDNEKDNYLKGVTKLFERIY
3dseA           VKAFKIHNKIWVIPERDTFTNPE-EGDLNPPPEAKQVPVSYYDSTYL--STDNEKDNYLKGVTKLFERIY
3c88A           VKAFKIHNKIWVIPER-DTFTNPEEGDLNPPPEAKQVPVSYYDSTYL--STDNEKDNYLKGVTKLFERIY
3bwiA           VKAFKIHNKIWVIPE-RDTFTNPEEGDLNPPPEAKQVPVSYYDSTYL--STDNEKDNYLKGVTKLFERIY
3booA           VKAFKIHNKIW------VIPERDTFTNPEEGDLNPVPVSYYDSTY---LSTDNEKDNYLKGVTKLFERIY
3btaA           VKAFKIHNKIWVIPERDTFTNPEEGDLNPPP----EAKQVPVSYYDSTYLSTDNEKNYLKGVTK----LF


                         .         .         .         .         *         .         .:420
query           ERRAGLRSGHGWYACASPETPMLGMLTGLVHVDGNGHRRARYLLPTGDTIGEPVFVPRKPDSAEADGWLL
2biwA           PQQVGRPYRYVYMGAAHHSTGN-APLQAILKVDLESGTETLRSFAPHGFAGEPIFVPRPGGVAEDDGWLL
1e1hA           STDLGRMLLT-SIVRGIPFWDTELKVIDTNCIRSEELNLVIIGPSADIIQFECKSFGHDVLTRNGYGSDF
3dseA           STDLGRMLLTS-IVRGI---PFWGG-STIDTELVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQECK
3c88A           STDLGRMLLTSIV---------------------------------------------------------
3bwiA           STDLGRMLLTSIV---------------------------------------------------------
3booA           STDLGRMLLTSIVRGIPFWGGSTIDT--------------------------------------------
3btaA           ERIYSTDLGRMLLTSIVRGIPFWGGSTCINVIQPDGSYRSEELIIGPSADI-------------------


                         .         .         +         .         .         .         .:490
query           TVIWRSCENRSDLAVFNAADIAGGPIALVQLGHRVPDGFHGNWVAAx
2biwA           CLIYKADLHRSELVILDAQDITAPAIATLKLKHHIPYPLHGSWA---
1e1hA           TFGFEESLGAGKFATDPA-------VTLAHELIHAEHRLYGIAINP-
3dseA           SFGHEVLNLTRNTFGFEEGAGKFATDPAVTLAHELIHAGHRLYG---
3c88A           -----------------------------------------------
3bwiA           -----------------------------------------------
3booA           -----------------------------------------------
3btaA           -----------------------------------------------