[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38586.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c5lA.bssp"
#ERROR : Can't open dsspfile "2a9uA.bssp"
#ERROR : Can't open dsspfile "1cqzB.bssp"
#ERROR : Can't open dsspfile "3e3aB.bssp"
#ERROR : Can't open dsspfile "3ef3A.bssp"

## Summary of PDB Search
:586
    4e-42  13%  3c5lA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    1e-19  10%  2a9uA  [x.x.x] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8
    7e-07   9%  1cqzB  [c.108.1 - c.69.1] EPOXIDE HYDROLASE
    4e-06  17%  3e3aB  [x.x.x] POSSIBLE PEROXIDASE BPOC
    5e-06  12%  3ef3A  [x.x.x] CUTINASE-1
:586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5lA           ----------------------------------------------------------------------
2a9uA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5lA           ----------------------------------------------------------------------
2a9uA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVAV
3c5lA           ------------------------------------------------------------------DMLQ
2a9uA           ----------------------------------------------------------------------
1cqzB           ----------------------------------------------------------------------
3e3aB           ----------------------------------------------------------------------
3ef3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TPGKVVYSNDLIELIQYAPATGEVRPEPILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPT
3c5lA           QLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDDSTRLILYNDGDSLQYIERDGTESYLTVSSHPN
2a9uA           ----------KKTEVKPEKISTKSYVHSALKIFKTAEECRLDRD-EERA---YVLYKYVTVYNLIKKRPD
1cqzB           ---------------------------------------------------PALAQAGFRVLAIDMKGYG
3e3aB           ----------------------------------------------HPHQVPAFLAAGYRCITFDNRGAT
3ef3A           ----------------INGNSASCADVIFIYARGSTENLGTLGPSIASNLESAFGKDGVWIQGVGGAYRA


                         .         *         .         .         .         .         +:350
query           AKHRDLTLEDYRRLGVMAAIETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRDGDDRLRSITLFAAQTD
3c5lA           SLMKKITLRNYMSEHLLKAGANITPREGRLP-YLRTWFRTRSAIILHLS----NGSVQINFFQ-DHTKLI
2a9uA           FKQQDYFHSILGPGNIKKAVEEAERLSESLKLR-------------------------------------
1cqzB           DSSSPPEIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAG----VMVWNMALFYPERVRAVASLNTPFM
3e3aB           ENAEGFTTQTM-----VADTAALIETLDIAPARVVGVSMGAFI----AQELMVVAPELVSSAVLMATRGR
3ef3A           TLGDNALPRGTSSAAILGLFQQANTKCPDATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGY---


                         .         .         .         .         *         .         .:420
query           FTEAGELTLFINESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWN
3c5lA           LCPLMAAVTYIDEKRDSLLEEYGCCKELAS--RLRYARTMVDK---------------------------
2a9uA           ----------------------------------------------------------------------
1cqzB           P--PDPDVSPMKVIRSIPVFNYQLYFQEPGVAEAELEKNMSRTFKSFFRASDETGFIAVHKATEIGGILV
3e3aB           LDRARQ---FFNKAEAELYDSGVQLPPTYDA----------------RARLLENFSRKTLNDDVAVGDWI
3ef3A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADATRMPYRMHSEYLRKLFLDNDLAEGRYTVDDRAIALSDIHTPMFVVGTLRDHVAPWRSTFKIHLLADA
3c5lA           ----------------------------------------------------------------------
2a9uA           ----------------------------------------------------------------------
1cqzB           NTPEDPNLSKITTEEEIEFYIQQFKKTGNWKWSCKGLGRKILVPALMVTAEKDIVLRPEMSKNMEKWIPF
3e3aB           AMFSMWPIKSTPGLRCQLDCAPQT--------NRLPAYRNIAAPVLVIGFADDVVTPPYLGREVAALPNG
3ef3A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EITFCLTGGGHNAGIVSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c5lA           ----------------------------------------------------------------------
2a9uA           ----------------------------------------------------------------------
1cqzB           LKRGHIEDCGHWT---------------------------------------------------------
3e3aB           RYL-QIPDAGHLGFFERP----------------------------------------------------
3ef3A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
3c5lA           --------------------------
2a9uA           --------------------------
1cqzB           --------------------------
3e3aB           --------------------------
3ef3A           --------------------------