[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38720.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e5dA.bssp"
#ERROR : Can't open dsspfile "3e0rA.bssp"
#ERROR : Can't open dsspfile "1bylA.bssp"
#ERROR : Can't open dsspfile "2a4wA.bssp"
#ERROR : Can't open dsspfile "2a4wB.bssp"
#ERROR : Can't open dsspfile "1bh5B.bssp"
#ERROR : Can't open dsspfile "3ct8A.bssp"
#ERROR : Can't open dsspfile "2a4xA.bssp"
#ERROR : Can't open dsspfile "3bt3A.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"
#ERROR : Can't open dsspfile "1cjxA.bssp"
#ERROR : Can't open dsspfile "3ecjB.bssp"
#ERROR : Can't open dsspfile "2c21A.bssp"
#ERROR : Can't open dsspfile "3e0rB.bssp"
#ERROR : Can't open dsspfile "2ehzA.bssp"
#ERROR : Can't open dsspfile "3b59A.bssp"
#ERROR : Can't open dsspfile "2ei3A.bssp"
#ERROR : Can't open dsspfile "2ei1A.bssp"
#ERROR : Can't open dsspfile "2ei2A.bssp"
#ERROR : Can't open dsspfile "2ei0A.bssp"
#ERROR : Can't open dsspfile "1dhyA.bssp"
#ERROR : Can't open dsspfile "3e0rC.bssp"
#ERROR : Can't open dsspfile "3bqxA.bssp"
#ERROR : Can't open dsspfile "1ecsA.bssp"
#ERROR : Can't open dsspfile "3e0rD.bssp"

## Summary of PDB Search
:180
    6e-16  17%  3e5dA  [x.x.x] PUTATIVE GLYOXALASE I
    1e-15  15%  3e0rA  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
    2e-15   9%  1bylA  [d.32.1] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
    3e-15  17%  2a4wA  [x.x.x] MITOMYCIN-BINDING PROTEIN
    7e-15  17%  2a4wB  [x.x.x] MITOMYCIN-BINDING PROTEIN
    8e-15  19%  1bh5B  [d.32.1] LACTOYLGLUTATHIONE LYASE
    9e-15  13%  3ct8A  [x.x.x] PUTATIVE GLYOXALASE
    2e-14  17%  2a4xA  [x.x.x] MITOMYCIN-BINDING PROTEIN
    5e-14  17%  3bt3A  [x.x.x] GLYOXALASE-RELATED ENZYME, ARAC TYPE
    9e-14  21%  1bh5A  [d.32.1] LACTOYLGLUTATHIONE LYASE
    1e-13  12%  1cjxA  [d.32.1 - d.32.1] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
    1e-13  16%  3ecjB  [x.x.x] PROTEIN (HOMOPROTOCATECHUATE 2,3-DIOXYGENASE)
    1e-13  20%  2c21A  [x.x.x] TRYPANOTHIONE-DEPENDENT GLYOXALASE I
    2e-13  15%  3e0rB  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
    5e-13  12%  2ehzA  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    5e-13  15%  3b59A  [x.x.x] GLYOXALASE/BLEOMYCIN RESISTANCE
    6e-13  12%  2ei3A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    8e-13  14%  2ei1A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    7e-12  12%  2ei2A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    1e-11  14%  2ei0A  [x.x.x] 1,2-DIHYDROXYNAPHTHALENE DIOXYGENASE
    1e-11  10%  1dhyA  [x.x.x] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-11  15%  3e0rC  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
    3e-11  19%  3bqxA  [x.x.x] GLYOXALASE-RELATED ENZYME
    2e-10  14%  1ecsA  [d.32.1] BLEOMYCIN RESISTANCE PROTEIN
    1e-07  16%  3e0rD  [x.x.x] C3-DEGRADING PROTEINASE (CPPA PROTEIN)
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
3e5dA           ----KIEHVALWTTNLEQKQFYV-TYFGATANDLYENK-------TKGFNSYFLSFEDGARLEISRTDVT
3e0rA           VNQIVRIIPTLKANNRKLNETFYIETLGKALLEESA----------------FLSLGDQTGLEKLVLEEA
1bylA           MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRD--------------FVEDDFAGVVRDDVTLFISAVQDQ
2a4wA           ----RISLFAVVVEDMAKSLEFYRKLGVEIPAE----------ADSAPHTEAVLDGGIRLAWDTVETVRS
2a4wB           ----RISLFAVVVEDMAKSLEFYRKLGVEIPAE----------ADSAPHTEAVLDGGIRLAWDTVETVRS
1bh5B           TKDFLLQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDELTHNWGTED
3ct8A           LYFQGLHHVEINVDHLEESIAFWDWLLGELGYEDYQ--------SWSRGKSYKHGKTYLVFVQTEDRFQT
2a4xA           ----RISLFAVVVEDMAKSLEFYRKLGVEIPA----------EADSAPHTEAVLDGGIRLAWDTVETVRS
3bt3A           --VVRENGPVYFTKDMDKTVKWFEEILGWSGDI----------VARDDEGFGDYGCVFDYPSEVAVAHPF
1bh5A           TKDFLLQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYKDEKIAWALSRKATLELTHNWGTED
1cjxA           MGLMGFEFIEFASPTPGTLEPIFEIMGFTKV-------------ATHRSKNVHLYRQGEINLILNNEPNS
3ecjB           PDILRCAYAELVVTDLAKSRNFYVDVLGLHVS-------------YEDENQIYLRSFEEFIHHNLVLTKG
2c21A           ---RRMLHTMIRVGDLDRSIKFYTERLGMKVLRKWDVP-------EDKYTLVFLGYGPEMSSTVLELTYN
3e0rB           VNQIVRIIPTLKANNRKLNETFYIETLGKALL----------------EESAFLSLGDQTGLEKLVLEEA
2ehzA           TGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDV-----------EYRIPLPNGMTAELSFMHCNARDHSIA
3b59A           -RVTEIRYVGYGVKDFDAEKAFYADVWGLEPV-----------GEDANNAWFKAQGADEHHVVQLRRADE
2ei3A           TGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDV-----------EYRIPLPNGMTAELSFMHCNARDHSIA
2ei1A           TGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDVEYR----------IPTAELSFMHCNARDHSIAFGAMP-
2ei2A           TGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDV-----------EYRIPLPNGMTAELSFMHCNARDHSIA
2ei0A           TGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDVE----------YRIPTAELSFMHCNARDHSIAFGAMPA
1dhyA           --IERLGYLGFAVKDVPAWDHFLTKSVGLMAA------------GSAGDAALYRADQRAWRIAVQPGELD
3e0rC           -----RIIPTLKANNRKLNETFYIETLGKALL----------------EESAFLSLGDQTGLEKLVLEEA
3bqxA           --LQQVAVITLGIGDLEASARFYGEGFGWAPV-----------FRNPEIIFYQNGFVLATWLVQNLQEDV
1ecsA           ----DQATPNLPSRDFDSTAAFY-ERLGF-------------GIVFRDAGWMILQRGDLMLEFFAHPGLD
3e0rD           VNQIVRIIPTLKANNRKLNETFYIETLGKALLEESA----------------FLSLGDQTGLEKLVLEEA


                         .         .         *         .         .         .         .:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTAT
3e5dA           GKTTGENLGWAHIAISTGTKEAVDELT---EKLRQDGFAIAEPRTGDGYYESVVLDPEGNRIEIT-----
3e0rA           PSRTRKVEGRKKLARLIVKVENPLEI----EGILSKTDSIHRLYKGQNGYAFEIFSPEDDLILIHAEDD-
1bylA           VVPDNTLAWVWVRGLDELYAEWSEVVS---TNFRDASGPAMEIGEQPWGREFALRDPAGNCVHF------
2a4wA           YDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWRYAIVKDPDGNVVDLFAP---
2a4wB           YDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWRYAIVKDPDGNVVDLFA----
1bh5B           DETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKPDDGKMKGLAFIQDPDGYWIQILN----
3ct8A           PTFHRKRTGLNHLAFHAASREKVDELTQKLKERGDLYEDRHPFAGGPNHYAVFCEDPNRIKVEI------
2a4xA           YDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWRYAIVKDPDGNVVDLFA----
3bt3A           RGFHLFKGEPIKGVAGFMMIEGIDALH---KYVKENGWDQISDTQPWGARECSITTTDGCILRF------
1bh5A           DETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKPDDGKMKGLAFIQDPDGYWIQILN----
1cjxA           IASYFAAEHGPSVCGMAFRVKDSQKAY---NRALELGAQPIIDTGPMELNLPAIKGIGGAPLYLIDRFGE
3ecjB           PVAA-----LKAMAFRVRTPEDVDKAEAYYQELGCRTERRKDGFVKGIGDALRVEDPLGFPYEFFFETTH
2c21A           YGVTSYK-HDEAYGHIAIGVEDVKELV---ADMRKHDVPIDYEDESG--FMAFVVDPDGYYIELLN----
3e0rB           PSRTRKVEGRKKLARLIVKVENPLEI----EGILSKTDSIHRLYKGQNGYAFEIFSPEDDLILIHA----
2ehzA           FGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKALTFYGATPSGWLIEPGWRGAT
3b59A           NRIDV-------IALAADSRSDVDA---LRASVEAAGCKVASEATPGGGYGFRFFSPDGLLFEVSSDVAK
2ei3A           FGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKALTFYGATPSGWLIEPGWRGAT
2ei1A           -----AAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKALTFYGATPSGWLIEPGWRGAT
2ei2A           FGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKALTFYGATPSGWLIEPGWRGAT
2ei0A           AKRLN------HLMLEYTHMEDLGYTHQQFVKNEIDIALQLGIHANDKALTFYGATPSGWLIEPGWRGAT
1dhyA           DLAY--------AGLEVDDAAALERMA---DKLRQAGVAFTRMQQRKVMGLLCLQDPFGLPLEIYYGPAE
3e0rC           PSRTRKVEGRKKLARLIVKVENPLEI----EGILSKTDSIHRLYKGQNGYAFEIFSPEDDLILI------
3bqxA           GV--AVTSRPGSALAHNVRAETEVA---PLERLVAAGGQLLRPADAPPHLRGYVADPDGHIWEIAF----
1ecsA           PLASWF--------SCCLRLDDLAECKSVGIQETSSGYPRIHAPELQGWTMAALVDPDGTLLRLIQ----
3e0rD           PSRTRKVEGRKKLARLIVKVENPL----EIEGILSKTDSIHRLYKGQNGYAFEIFSPEDDLILIHA----


                         +         .         .         .         .         *         .:210
query           PQQLAQMKDVAHAMVDEWAETKKPPRHTAWLHQKEFxxxx
3e5dA           ----------------------------------------
3e0rA           ----------------------------------------
1bylA           ----------------------------------------
2a4wA           ----------------------------------------
2a4wB           ----------------------------------------
1bh5B           ----------------------------------------
3ct8A           ----------------------------------------
2a4xA           ----------------------------------------
3bt3A           ----------------------------------------
1bh5A           ----------------------------------------
1cjxA           GSSIYDIDFVYLEGVERNPVGAGLKVI-------------
3ecjB           VERLHMRYDLYSAGELVR----------------------
2c21A           ----------------------------------------
3e0rB           ----------------------------------------
2ehzA           AI-----DEAEYYVGDIFGHGVEAT---------------
3b59A           GAKRDLARWEGVPVKISHIVLHSPNHQDVKFFTDVL----
2ei3A           A-----IDEAEYYVGDIFGHGVEATGYGLD----------
2ei1A           A-----IDEAEYYVGDIFGHGVEAT---------------
2ei2A           AI-----DEAEYYVGDIFGHGVEATGYGLDV---------
2ei0A           A-----IDEAEYYVGDIFGHGVEATGY-------------
1dhyA           IFHEPFLPSAPVSGFVTG----------------------
3e0rC           ----------------------------------------
3bqxA           ----------------------------------------
1ecsA           ----------------------------------------
3e0rD           ----------------------------------------