[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38755.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2axnA.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "3e70C.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "1d2zD.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "3cd9A.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "3cddE.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "3dmdA.bssp"
#ERROR : Can't open dsspfile "3dvlC.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "2c1lA.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "1e1dA.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"

## Summary of PDB Search
:253
    2e-41  20%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    5e-41  22%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-39  23%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-38  13%  3cmvG  [x.x.x] PROTEIN RECA
    4e-38   8%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    5e-37   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    9e-36  11%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-35   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    6e-35  14%  3cmvH  [x.x.x] PROTEIN RECA
    1e-34   6%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-33  14%  3cmvC  [x.x.x] PROTEIN RECA
    1e-33   7%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    4e-33  15%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    4e-33   9%  4dcgA  [x.x.x] VP39
    7e-33   9%  2akaB  [x.x.x] DYNAMIN-1
    2e-32   9%  2bifA  [c.37.1 - c.60.1] PROTEIN
    4e-32  10%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    4e-32  12%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    8e-32  14%  3cmvA  [x.x.x] PROTEIN RECA
    1e-31  16%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-31   6%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    3e-31   7%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    6e-31  12%  2b8tA  [x.x.x] THYMIDINE KINASE
    1e-30  13%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-30  16%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    1e-30  12%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-30   8%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    3e-30  10%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-28   9%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    3e-28  16%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    4e-28  14%  3cmxA  [x.x.x] PROTEIN RECA
    4e-28  12%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    5e-28   8%  1e98A  [c.37.1] THYMIDYLATE KINASE
    1e-27  17%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-27  21%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-26  12%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    2e-26   9%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-26   7%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    2e-26  10%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    3e-26   9%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-26  12%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    4e-26   9%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    6e-26  21%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-26  12%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-25   8%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    1e-25  12%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-25   9%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    2e-25  26%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-25   6%  2ctsA  [x.x.x] CITRATE SYNTHASE
    2e-25  15%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-25  12%  2cgtH  [x.x.x] 60 KDA GROEL
    3e-25  13%  3c8uA  [x.x.x] FRUCTOKINASE
    3e-25   6%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    5e-25   5%  1aroP  [e.8.1] T7 RNA POLYMERASE
    5e-25   8%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    2e-24  12%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-24  21%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-24  22%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-24   9%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-24  25%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    4e-24   9%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-24  10%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    6e-24  13%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    7e-24  10%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    7e-24  12%  3cmtD  [x.x.x] PROTEIN RECA
    1e-23   9%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-23  11%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-23  11%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-23  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    1e-23   8%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-23  10%  1e0jB  [c.37.1] DNA HELICASE
    2e-23   9%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-23  19%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-23  24%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-23   9%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    4e-23  10%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    5e-23  10%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    5e-23  12%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    6e-23  13%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    8e-23   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    9e-23   9%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-23   9%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    1e-22  21%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-22  22%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-22  13%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-22  21%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-22  23%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-22   7%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    5e-22   8%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-22   8%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-22  12%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    6e-22  12%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    7e-22  12%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    9e-22  12%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-21  11%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-21  12%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    1e-21  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-21  10%  3da4A  [x.x.x] COLICIN-M
    2e-21   7%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    2e-21  10%  1e0jA  [c.37.1] DNA HELICASE
    2e-21  17%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-21  15%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    5e-21   8%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-21  12%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    8e-21  13%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    8e-21   8%  2cckB  [x.x.x] THYMIDYLATE KINASE
    1e-20  12%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    1e-20  13%  3cmvE  [x.x.x] PROTEIN RECA
    2e-20   8%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-20  10%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    2e-20   7%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-20   7%  2axzC  [x.x.x] PRGX
    4e-20   8%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    4e-20   9%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-20  11%  2b8tC  [x.x.x] THYMIDINE KINASE
    5e-20  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    5e-20  18%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-20   8%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-20  24%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-19  14%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-19  10%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    2e-19  12%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    3e-19   8%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-19   6%  2bx2L  [x.x.x] RIBONUCLEASE E
    7e-19  11%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-18  15%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    1e-18  10%  2bdtA  [x.x.x] BH3686
    1e-18  10%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    1e-18  12%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-18  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    3e-18  11%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    3e-18  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    3e-18  12%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-18   6%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    5e-18   9%  3adkA  [x.x.x] ADENYLATE KINASE
    6e-18  10%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    6e-18   7%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-18   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    8e-18   8%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    8e-18  11%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    9e-18  13%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    1e-17  11%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    1e-17  14%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-17   9%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    1e-17   7%  421pA  [x.x.x] H-RAS P21 PROTEIN
    1e-17   7%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-17  11%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-17   9%  2b8tB  [x.x.x] THYMIDINE KINASE
    2e-17   6%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    2e-17  10%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-17  14%  3cmwC  [x.x.x] PROTEIN RECA
    2e-17  12%  1e6cA  [c.37.1] SHIKIMATE KINASE
    2e-17   9%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    2e-17  11%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    2e-17  12%  2a1fF  [x.x.x] URIDYLATE KINASE
    3e-17  15%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    3e-17  12%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-17  12%  2a1fD  [x.x.x] URIDYLATE KINASE
    4e-17  12%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-17  15%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    5e-17  25%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    5e-17   7%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    5e-17  13%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    7e-17  15%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    8e-17  14%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    8e-17  13%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-17  13%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    1e-16   8%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    1e-16  10%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    1e-16  11%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-16  11%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-16  10%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-16   6%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    2e-16   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    2e-16  11%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    2e-16  10%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    2e-16  12%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-16  10%  3be4A  [x.x.x] ADENYLATE KINASE
    3e-16  11%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    4e-16   4%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    4e-16  10%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    5e-16  12%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    9e-16   9%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-16   8%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-15   8%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-15   9%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    2e-15   9%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-15  12%  2c9oC  [x.x.x] RUVB-LIKE 1
    2e-15  12%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-15  10%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15   5%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-15   9%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    2e-15  12%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-15  19%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-15  15%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-15  14%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-15  11%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-15   3%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    5e-15  15%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    5e-15   9%  2c0bL  [x.x.x] RIBONUCLEASE E
    6e-15   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    6e-15  13%  2c9gA  [x.x.x] PENTON PROTEIN
    6e-15  12%  2a1fE  [x.x.x] URIDYLATE KINASE
    7e-15  10%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    7e-15  10%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    7e-15  10%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    8e-15  11%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    8e-15  14%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-14  14%  1adoA  [c.1.10] ALDOLASE
    1e-14  13%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-14  13%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-14   8%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    1e-14  12%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    2e-14  10%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-14   7%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-14   9%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-14  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-14   9%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    3e-14   8%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-14  11%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-14  12%  3a00A  [x.x.x] GUANYLATE KINASE
    4e-14  13%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-14  11%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    5e-14   9%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    5e-14   6%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    6e-14  10%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-14  13%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-14   3%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    7e-14  13%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-14  14%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13   9%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    1e-13   8%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-13  13%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13  14%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-13  16%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-13  13%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13  13%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-13  12%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-13  13%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    2e-13  15%  3cmvB  [x.x.x] PROTEIN RECA
    2e-13  15%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    3e-13  12%  2bhvD  [x.x.x] COMB10
    3e-13  13%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    3e-13   9%  3dlbB  [x.x.x] ARGONAUTE
    3e-13  15%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-13  15%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    5e-13  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    5e-13  15%  3cmuA  [x.x.x] PROTEIN RECA
    5e-13  15%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    6e-13  13%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    6e-13  13%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-13  13%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    6e-13  13%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    8e-13  14%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    8e-13   8%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    8e-13  13%  1e2kA  [c.37.1] THYMIDINE KINASE
    9e-13   2%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    1e-12  11%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    1e-12  13%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    1e-12  13%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-12   9%  3bczC  [x.x.x] PROTEIN MEMO1
    1e-12  13%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    1e-12   8%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-12  14%  2ancB  [x.x.x] GUANYLATE KINASE
    2e-12   4%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    2e-12  14%  2anbA  [x.x.x] GUANYLATE KINASE
    2e-12   9%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    2e-12  12%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-12  12%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-12  14%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    3e-12  13%  3ec1A  [x.x.x] YQEH GTPASE
    3e-12  13%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    4e-12  13%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-12  11%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    4e-12   7%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    5e-12  13%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    6e-12  16%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    7e-12  12%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    8e-12  11%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    8e-12  15%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    1e-11  15%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-11   7%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-11   9%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    2e-11   8%  1eamA  [c.66.1] PROTEIN (VP39)
    2e-11  16%  2dftA  [x.x.x] SHIKIMATE KINASE
    2e-11  13%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    2e-11   8%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    2e-11  10%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    2e-11  12%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-11  14%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-11  11%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    4e-11  17%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-11  14%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-11  10%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-11  10%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    7e-11  10%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    1e-10  17%  2c5mD  [x.x.x] CTP SYNTHASE
    1e-10  11%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    2e-10  14%  2bhvA  [x.x.x] COMB10
    2e-10   6%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-10  12%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    2e-10  11%  1e2iA  [c.37.1] THYMIDINE KINASE
    4e-10  11%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-10  11%  2b8tD  [x.x.x] THYMIDINE KINASE
    4e-10   7%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    5e-10   5%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    5e-10  11%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-10  12%  2dftC  [x.x.x] SHIKIMATE KINASE
    6e-10  13%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-10  13%  1e2mB  [c.37.1] THYMIDINE KINASE
    6e-10   8%  2axnA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    1e-09  10%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    1e-09  13%  1e2jA  [c.37.1] THYMIDINE KINASE
    1e-09  13%  1chdA  [x.x.x] CHEB METHYLESTERASE
    1e-09   6%  3dfdA  [x.x.x] PROTEIN YQBN
    1e-09   6%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-09   7%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    2e-09  12%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    2e-09   8%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-08  13%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    1e-08  17%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    2e-08  20%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-08  11%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-08  16%  3dkvA  [x.x.x] ADENYLATE KINASE
    3e-08  10%  3a00B  [x.x.x] GUANYLATE KINASE
    3e-08  15%  1e2iB  [c.37.1] THYMIDINE KINASE
    3e-08   6%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    4e-08  16%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    5e-08  11%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    5e-08  14%  1e2lB  [c.37.1] THYMIDINE KINASE
    5e-08  14%  3bm2B  [x.x.x] PROTEIN YDJA
    5e-08  11%  1e2lA  [c.37.1] THYMIDINE KINASE
    6e-08   9%  3e70C  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-08  15%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-08  14%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    7e-08  12%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    7e-08  11%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-07  21%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-07  13%  2cdnA  [x.x.x] ADENYLATE KINASE
    3e-07   7%  1d2zD  [a.77.1] DEATH DOMAIN OF TUBE
    4e-07  13%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    5e-07  11%  1e2nB  [c.37.1] THYMIDINE KINASE
    9e-07   5%  3cd9A  [x.x.x] GREEN FLUORESCENT PROTEIN
    9e-07  12%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    9e-07   9%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    1e-06  15%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-06   9%  3cddE  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-06  15%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    3e-06  11%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    3e-06  14%  1e2mA  [c.37.1] THYMIDINE KINASE
    5e-06  15%  1e2jB  [c.37.1] THYMIDINE KINASE
    6e-06  18%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    7e-06  11%  3dmdA  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    7e-06  17%  3dvlC  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    1e-05  12%  1e2nA  [c.37.1] THYMIDINE KINASE
    2e-05  10%  2c1lA  [x.x.x] RESTRICTION ENDONUCLEASE
    3e-05  10%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    5e-05   9%  1e2kB  [c.37.1] THYMIDINE KINASE
    5e-05   4%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    7e-05  13%  1e2hA  [c.37.1] THYMIDINE KINASE
    7e-05  13%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    1e-04  12%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    2e-04   9%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    3e-04  15%  1e1dA  [e.26.1] HYDROXYLAMINE REDUCTASE[MASQUE : MEMB(X) 45 /
    3e-04  19%  2bwjD  [x.x.x] ADENYLATE KINASE 5
:253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL
3b60A           -GDLEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREY
2d3wB           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEGKDLLAL
3b5jA           --DITFRNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3cmvG           -----VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3dmdC           ---KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
2c61B           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2dwpA           -----------------RVQKIWVPVDHRTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
2dwoA           LTQSRVQKIWVPVDHR-PSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRR
3cmvH           LGEDRSMDVETISTGSLSLDIALGALPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL-
3eiuA           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
3cmvC           LGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3c95A           ----ENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDN
2ccgA           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
4dcgA           ----------------------------ILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
2akaB           --MEDLIPLVNRLQDAFSAIGQNADLD-LPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQ
2bifA           ------------------------------LIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
2b8wA           -PMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
2c03B           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
3cmvA           -----VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2awnD           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
3eiuB           ---YARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
3dmdB           ---KEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
2b8tA           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTR
1e69A           ---------KLYLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
2ccjB           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3czpB           ----------AEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEE
1bifA           ----------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRR
2czvA           --------------GGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAIL
3dm5A           ---IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRP
2ccgB           ----------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
3cmxA           ----TISTGSLSLDIALG----AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHAL-
1cr4A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
1e98A           ---------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2bbsA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2d62A           -AEVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPE
2dr3A           ------------TGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2bc9A           -PMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3b2qB           -------PPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
1e3aB           ----------QEWTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPF
2b92B           -PMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
1d1cA           KGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQIL
1e9cA           ---------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2awnB           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2c03A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
2c61A           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMG
2a2zD           ---------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
1e9fA           ---------------------------RGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERST
3dhwC           --MIKLSNITKVFHTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
2ctsA           ---------ASSTNLKDILADLIPKERIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEG
2c9yA           ----------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVAS
2cgtH           VLDKSFGAPTITKDGVSVAREIELEDFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAA
3c8uA           ---------TLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEV--------
1e2dA           ---------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
1aroP           ----------------------------------------------------------------------
3bpbA           ----IARTPARSLVDGLHLGKPDYAKALEQHNAYIRALQVDITLLPPFPDSVFVEDPVLCTSRCAIITRP
2c04A           ---VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRP
2d3wA           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKDLL
2awoC           ---------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1e9sD           ---GKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1b0uA           --KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
1e9sG           ---GKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2d4hB           -PMCLIENTNGRLMALKILSAITQPMV---VVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGL
2a30B           ---------------------------RIKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVL
3b85A           ------------RPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEA
3cmtD           ----------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3b2qA           MNPYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAM-
2cckA           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
1e9sF           -SGGKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2dr3E           ---------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2a5gA           ---------------------------KEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTY
1e0jB           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
1e9rA           -SGGKLKRMTREKAKQVTVAGVPMPRDAEPHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2d2eA           -SQLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLD-----
2awnC           ---------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLGVGMVF------------
1e9dA           ---------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
2d4hA           -PMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWC
2akaA           ---------PHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQ
1cr0A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKK---------V
2a30D           ---------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
1e3mA           --------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRHP
1e9sJ           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2axpA           ------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGN
2awoA           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2d3wD           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDLLAL
3d7wA           ----YVSSGSFSNNIP-LLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSD
2d2fA           -SQLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENIL
2d3wC           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVEFKGKLAL
3bo6B           --FHSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDK
3dt2A           CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
1dhjA           ----------------------------------------------------------------------
3d3kA           --------------KKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTV----ALLCGPHVKGA
1bg0A           ----SIKNKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYH-----GGFKLTDK
2a2zB           ---------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3czpA           -----------------GLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEE
3bb1F           -GWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
1cr2A           -HLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLA---MLE
3cddD           -------EIVLKAGGKIYQGWTKIGITRSL-----EASGAFDLET----YKFNDAQYKAFIEPI--KQGQ
3da4A           --LVLHPGISVYDAYH---FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLK
3ch4B           --------------------MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQ
1e0jA           IREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESV
2bbsB           -----TEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
2cjwB           -----------------------FGMTYYRV-VLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATII
1e9rE           -SGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGD--
3a1wA           ---------------------------------LAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGV
2a30A           ---------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
2cckB           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPT
2d4uA           ---------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWV
3cmvE           LGEDRSMDVETISTGSLSLDIALGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
3cddF           ---GYVDDWVPSYDETISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPF
2a2zA           ---------------------------RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ
3dt4A           CFALRIASRLAKEEGHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2axzC           ----------------------------------------------------------------------
3bh0A           ---SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
1e4yA           ---------------------------------LLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
2b8tC           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSR
2dr3B           ---------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2bbtB           --GELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
3dt7A           CFALRIASRLAKEAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2awnA           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1e3mB           --------------------------------------------LVNLAERAYTLNYTCPTFID--KPGI
3d3qA           ---------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
1cr1A           EHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAML----
3dt4C           CFALRIASRLAKEEGWLLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
2bx2L           ----------------------------------------------------------------------
3bb1B           -GWSGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVS
2bjbA           -ALQTLGLRVDGVGSELTVSGRIEPGPGARV--DCGLAG----TVLRFVPPLAALGSVPVTFDGDQARGR
2bdtA           ------------------------------LYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGG
3cr7C           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3cddC           ---------------------------------AGGKIYQGWTKIGITRSLETYKFQYKAFIEPIKQ-GQ
2dflA           ---ERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYID
1ai4B           -----------------AKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPDWKGLLPFEMNPKVY
2bwjA           ---------------------FMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG---ELLEEL
3cr7D           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
3dtbB           ----------GWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFD
3adkA           ----------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSS
1d6jB           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVH------AYRL
1e9rD           -SGGKLKRMTREKAKQVTVAGVPMPRDAPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2eg5G           --AYNQLVLAKVKCVRELLRANLPNINKCIKVADLGCASGPNTLLTQSIDKVGQLERPTIQIFLNDLFPN
2d0kA           ----------------------------------------------------------------------
2ausC           ----------------------------------------------------------------------
2a5jA           --------------------GLVPRGSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDG
2c7cH           RNVVLDKSFGAPTDGVSVAREIELDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAA
3bb1E           -GWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGER-VVSISPFQSEGPRPVM
1dg3A           -PMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPG
421pA           ---------------------------TEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
2b8wB           -PMCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIW
3bgwA           --------ITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2b8tB           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFK------
2bhjA           ---------------------------------------------------IKNWGSGEILHDTLHHKAT
1e59A           -----------------------VLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFD
3cmwC           -----VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
1e6cA           ------------------------------PIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGM
1e2gA           ---------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPE---
2dr3D           ---------TRRVGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPV
2a1fF           ----------------------------------------------------------------------
2bv7A           --TGPFLEAVSHLPPFFCLGSPVFTPIKAKIKAVYDTNPTKFRTLQNILEVEKEMYGAEWPKVGATLALM
2awoD           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGE------
2a1fD           ----------------------------------------------------------------------
3bb1C           -GWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
1cfrA           ---------------------------------IISKSGEGNKYTINSAIAFVAYATTEFSKVLSGLRDF
3d31A           --MIEIESLSRKWKNF-SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
1afrA           --------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGF
1eilA           ----------------------------------------------------------------------
3bjdB           ------------------------------------------TRNFSL-PQLQNLPIEEARIVAD---AL
3d3qB           ---------------------------KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIG
5dfrA           ----------------------------------------------------------------------
3dffA           -----------------------------------------------LLAISPHLDDAVLSFGAGLAQ--
3bgwD           ----------GVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKK
2boeX           ----------------------------------------------------------------------
1e9sB           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2bkhA           -------MPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
1e9sH           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2ck3C           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1dkiA           KSLLDSKGIHYNQGNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNN
2bkiA           IKSYQGKSLPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEA
2dr3C           -----------------------------------RRVKTGIPGVDEILHGGIPERNVVLLSGGP-GTGK
3cm0A           ----------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVAR
3be4A           -------------------------NSKKHNLILIGAPGSGKGTQCEFIKKEYGLAHLSTGDMLREAIKN
2dr3F           -----------KTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVAL-EEHP
3dymA           ----------------------------------------------------------------------
1e9sL           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1d6jA           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHA---YRLDGD
1draA           ----------------------------------------------------------------------
1dhiA           ----------------------------------------------------------------------
1bmfC           PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1e2fA           ---------------------------RGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERST
1drbA           ----------------------------------------------------------------------
2c9oC           -------------ACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
3ecpA           -------------------------------------------------------------------SAL
1e9rG           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2c4rL           -----------------------------------PEGMGLIVRTAGVGKSAEALQWDLSFRLKHWEAIK
1av6A           --FMYFEEIDNELDYEPESANEVAKKLPILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
3cr7A           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
2bbtA           ---EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
3bb1A           -GWSGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
3dfpC           ----------------------------------------------------------------------
1e9sM           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1bglA           ----------------------------------------------------------------------
2dpyA           FNPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
2c0bL           -----AALTTFISLAGSYLVLMPNNPRAGGISRRIELKEALASLELPLIVRTAGVGKSAEALQWDLSFRL
1cjaA           -----------------------------------------TTSAPEVLTKSTMQQLGSLMALD------
2c9gA           ARVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYLKVGRQNGVLESDIG-------
2a1fE           ----------------------------------------------------------------------
4atjA           --------------------------------------------------------DPRIAASILRLHFE
3cioD           -------------------HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRG
1e1qB           -------SVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
3di4A           -------------VLVPPREGRCFEVKAGQFFRISSVEGPQVGDLN-----LHNLHDLTERFFSGKTRAL
3cnlA           -----------HKGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILD
1adoA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           FNPLQRTPIEHVLDTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREV
2ahwD           -----VKPPRINGRVVLSAQEAVNYIPDEATLCVLGAGLEATTLITALALSIISPTGLGDRADRGISPLA
1ak2A           ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
3dm9B           -------------TSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
1e2hB           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
3b55A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3clvA           ------------------------EKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGASFCTYV
2drcA           ----------------------------------------------------------------------
1cs4C           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
3a00A           ---------------------------------ISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
3dfqA           ----------------------------------------------------------------------
2cvfA           -------------------SLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPER
3dauA           ----------------------------------------------------------------------
3c15C           ---------------------------ATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1e9sI           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
1e9sE           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
1dp0A           ----------------------------------------------------------------------
1e9rF           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
3dfnD           ----------------------------------------------------------------------
3brwA           KVKLECNPTARIFLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLLLRTKCRTY-------------
1cjtC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
3dfoD           ----------------------------------------------------------------------
2cbzA           ---ITVRNATFTWARPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMD----------------
3d1mA           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
3cr7B           ---------------------------RGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIR
2a1fC           ----------------------------------------------------------------------
3cbnA           ---------------------------------------------------------YTLRARGHPNV--
3cmvB           LGEDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
2d7vA           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTL---QQL
2bhvD           ----------------------------------------------------------------------
2bkeA           LEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYID
3dlbB           ------------------------WVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSG------------
3bb1G           -GWSGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPF----------
2d7vB           AFVAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTL---QQL
1accA           ------------ETTARIIFNGKDLNLVERRIAAVNPSTTKPDMALKIAFGFNEPN-GNLQYQGKDI---
3cmuA           -----VETISTGSLSLDIA-LGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALD
1akeA           ---------------------------------LLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKS
2aunB           ----------------------------------------------------------------------
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2d4uB           ----------------------------------------------------------------------
1culC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKE
1e2kA           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGAS
3czjA           ----------------------------------------------------------------------
2ahvA           -------------VPVLSAQEAVNYIPDEATLCVLGAGGGATTLITALADSIISPTGLGDRADRGISPLA
2aumA           ----------------------------------------------------------------------
3dftC           ----------------------------------------------------------------------
3bczC           ---------------REASHAGSWYT-----ASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGY-TYCG
1aldA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancB           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYD-------------
3dyoA           ----------------------------------------------------------------------
2anbA           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSV--------
2bofX           --------------------------------------------------------------SSAEWVRN
2an9A           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPR
1dvrA           ---------------------------ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAK
3dfoC           ----------------------------------------------------------------------
3ec1A           -----------------KVMEAINRYREGGDVYVVGCTNVGKSTFINRIIEEATGKGNVITTSYFPGTTL
3d1mB           ----------------------------------------------------------------------
3dfqC           ----------------------------------------------------------------------
1c9kC           ------------------------------MILVTGGARSGKSRHAEALIGDAPQVLYIAT-----SQIL
3dm5B           ---IIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVG---------
3crmA           ----------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALIYRGMD
2ccjA           ------------------------------FITFEGPEGSGKTTVINEVYHRLVKDYDVIM---------
3c7kA           ---------------------------------LLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTI
2aunA           ----------------------------------------------------------------------
3dvlD           ----EHQAIAKMRTMIEGFDDISHGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETP
2ancD           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLY--------------
1dekB           ------------------------------LIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPI------
3cueF           -------------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDG
1eamA           ---MDVVSLDKPFNELDYEPAKKLPRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHH
2dftA           ---------------------------------LVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGR
6aldA           ----------------------------------------------------------------------
2czvB           -------------MDIRDKEAYELAKEWFDVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRD
3bjqB           ----------------------------------------------------------------------
1e4vA           -------------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVK-
2ancF           ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
1e9sA           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2bboA           --EVVMENVTAFWEGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCS
3bv4A           ----------------------------------------------------------------------
4dfrA           ----------------------------------------------------------------------
1dyhA           ----------------------------------------------------------------------
1ckvA           ---AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGY
2c5mD           ----------------------------------------------------------------------
3bb1D           ---SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2bhvA           ----------------------------------------------------------------------
3e8aC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1ek0A           ---------------------------------LLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQR
1e2iA           ---------------------------TLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASE-----TI
3bb1H           -GWSGINTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMV
2b8tD           ----------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKSIRN
1dw9A           IQSQINRNIRLDLADAI----LLSKAKKDLSFAIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLD
2aexA           ----------------------------------------------------------------------
1e9rB           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2dftC           ---------------------------------LVGLPGSGKSTIGRRLAKALGVGLLDTDVAIE-----
3cnnA           ------------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDT
1e2mB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
2axnA           LTQSRVQKIWVPVD-HRPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWI--------------
3ed8A           ---IELKGTDFKEDGN-ILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQQNT
1e2jA           ---------------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLTIAN
1chdA           ----------------------------------------------------------------------
3dfdA           ---IDAEEVEVPISVDKEGNVVPFIFKTTDRIDELEKENTTKEL-------DSQRFYARIAVETTVYPTF
3c14C           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
1azsC           -------------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
3bwdD           ---------------------------RFIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGE
1dekA           ---------------------------------LSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAY
3ci2A           ----------------------------------------------------------------------
3do6A           ---LYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLREPSLG-
2e85A           ----------------------------------------------------------------------
2aumB           ----------------------------------------------------------------------
3dkvA           ---------------------------------LMGLPGAGKGTQAERIVEKYGI--PHISTGDMFRAAM
3a00B           ------------------------------PIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1e2iB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVY---------V
1cjuC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLK
2a5vA           -------------SAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RDVVERV
3cqcA           -ALKQGNAIMRKFKKHEAAKEVFVKIPQDSIAEIYLPAEDDNAIREHLCIRAYLEA--------------
1e2lB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSR--DDIVYVPEPMTY-
3bm2B           ----------------------------------------------------------------------
1e2lA           -------------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETI
3e70C           --KEAVSEILETSRRI-DLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRA
1dwmA           ----------------------------------------------------------------------
3b9qA           --IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNE--------------
3b85B           -------------------KHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILT------
1e9sK           ----KLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDML
2e85B           ----------------------------------------------------------------------
2cdnA           ----------------------------HMRVLLLGPPGAGKGTQAVKLAEKLGIP--QISTGELFRRNI
1d2zD           ---PAEIKKGFKYTDVFQIDEAANRLPPMIDEWKTSGKLNERPTVGVLLQLLVLFSAADFVALDFLNEST
1bccF           ---------------------------------------------------------------------L
1e2nB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEYWRVLGA
3cd9A           ---IELKGIDFKEDGLGHKLEYNYNCESNVYIMADKQKNGIKANFKTRHNIEDGSVQLADHYQQNTPIGD
1d8jA           ----------------------------------------------------------------------
1cjvC           ----------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEA
3c85A           ---------------------------------------------------LINPGHAQVLILGGRIGTG
3cddE           -------------------------KIYQGWTKIGITRSLEASGAFDLETYK---FLGNDAQYKAIEPIK
2a5vB           --------------AVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYV---RDVVERV
3cddA           --------------------------IYQGWTKIGITRSLEASGAFDLETY--KFLGNDAQYKAFIEPIK
1e2mA           ---------------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV----L
1e2jB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
2bwjB           ----------------------MEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG---------
3dmdA           --VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNH--------------
3dvlC           ------------------------------------------------IAKMRTMIEGDDISHGGLPIGR
1e2nA           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYPEPMTYWRVL
2c1lA           ------------NGGVRFYETFTEHINQGGRVIAILGGSTSQRLSSRQVVEELLNRGVEVH----IINRK
2a78A           ---------------------------------MVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKV
1e2kB           ---------------------------TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
2dx7A           ----------------------------------------------------------------------
1e2hA           ---------------------------TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRV----L
3cphA           ---------------------------------LIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKT
3cbqA           ---------------------------------LVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERR
3cr8B           ----------------------------------------------------------------------
1e1dA           ----------------------------------------------------------------------
2bwjD           -------------------------LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTG---------


                         .         .         *         .         .         .         .:140
query           APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYVG
3b60A           TLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQI-----------EEAARMAYAMDFINKMDNG
2d3wB           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTA------LNAVRSYRGQETLDRFDFQDLMEEKIALLKMP
3b5jA           DPNWLRRQ---VGVVLQDNVLLNRSIIDNISLA---------NPGMSVEKVIYAAKLAGAHDFISELREG
3cmvG           PIY---ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAV-------------DVIVVDSVAPKAEIEG
3dmdC           GAIEQLEE-HAKRIGVKVIKHSYGAD--------------------------------PAAVAYDAIQHA
2c61B           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIAYEHGMHVLVILTDITNYAEALRQMGYPGYMYT
2dwpA           EAVKQYSSYNFFRPDNEEAMKVRKQCA--------------------------------LAALRDVKSYL
2dwoA           EAVKQYSSYNFFRPDNEEAMKVRKQCAL--------------------------------AALRDVKSYL
3cmvH           --DPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAV--DVIVVDSVAALTPKAEI--------EG
3eiuA           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAAAEYLAYEHGMHVLVILTDITNYAEALRQMGPGYMYT
3cmvC           PIYARKLGVD---IDNLLCSQPDTGEQALEICDALARSGAV-------------DVIVVDSVAAL---TP
3c95A           LKILRENPQVREKVVAIFDNVDAQLYNGFFSDADRAAMKI-----VLETEPRNLPALDITFVDKRIEKLL
2ccgA           GEEIRKIVLEGNDMDIRTEAM--------------------LFAASRREHLVLKVIPALKEGKVVL----
4dcgA           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSLISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRC
2akaB           LVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDR-----VTGTNKGISPVPINLRVYSPHVLNLTLVDL
2bifA           DMVKTYKSFEFFLPDNEEGLKIRKQCALA--------------------------------ALNDVRKFL
2b8wA           CVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIF---ALAVLLSSTFVYNSIGTINQQAMDQLYYVTEL
2c03B           AAREQLRLLGEKVGVPVLEVMDGES---------------------------------PESIRRRVEEKA
3cmvA           PIY---ARKLGVDIDNLLCSQPDTGEQA----------------------LEICDALARSGAVDVIVV--
2awnD           PPAERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEI---------------SRLHKRLGRTMIYVTHDQV
3eiuB           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPRMALTATDITNYAEALRQMGAAGYPGYMYT
3dmdB           GAIEQLE--EHAKRIGVKVIKHSYGAD-------------------------------PAAVAYDAIQHA
2b8tA           -SIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQF--FDDRICEVANILAENGFVVI
1e69A           GSAYVELVVRLKDIRDRFAGTGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIR
2ccjB           GEEIRKIVLE---GNDMDIRTEAMLFAASRREHL---------------------VLKVIPALKEGKVVL
3czpB           RAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVER----------IEGFCAPADWLRAYGEINDFEEQLSE
1bifA           DMVKTYKSFEFFLPDNEEGLKIRKQCAL--------------------------------AALNDVRKFL
2czvA           LSNPKPSLVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVFSL
3dm5A           GAYHQLRQLLDRYHIEVFGNPQE---------------------------------KDAIKLAKEGVDYF
2ccgB           GEEIR---KIVLEGNDMDIRTEAMLFAASR---------------------REHLVLKVIPALKEGKVVL
3cmxA           --DPIYARKLGVDIDNLLCSQPDTGEQALEICDALAVDVIVVDSVAAL-TPKAEARMMSQAMRKLAGNLK
1cr4A           EET---AEDLIGLHNRVRLRQSDSLKREIIENG-------------------------KFDQWFDELFGN
1e98A           EIGKLLSS----YLQKKSDVEDHSVHLLFSANRWEQ---------------VPLIKEKLSQGVTLVVDRY
2bbsA           QNSWIMPGTIKENIIGVSYDEYRYRSV-------------------------------IKACQLEEDISK
2d62A           KGVFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVRE----------------VAELG
2dr3A           QVRQN-MAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLT------------------------
2bc9A           MWCVPHPKKPGHILVLLDTEGLGDVEKGDN------------------------------QNDSWIFALA
3b2qB           ITNEEAQYFMSDFEKT-GALERAVVFLNLADDPAVERIHGMHVLVILTDITNYAEALRQMGRGYPGYMYT
1e3aB           EMNPKVYNPQSGYIANWNNSPQKDYPASDLFAFLWGGADRVTEIDRLLETADQAWDVIRQTSRQDLNLRL
2b92B           MWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELT
1d1cA           QANPILE---AFGNAKTTRNNNSSRFGKFIEIQ-----------FNNAGFISGASIQSYLLEKSRVVFQS
1e9cA           EIGKL----LSSYLQKKSDVEDHSVHLLFSANRWE---------------QVPLIKEKLSQGVTLVVDRY
2awnB           PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVI------------------NQRVNQVAEVLQ
2c03A           AAREQLRLLGEKVGVPVLEVMDGES---------------------------------PESIRRRVEEKA
2c61A           ITNEEAQYFMSDFEKTGALERAVVFLNLADDPAVERI-------------VTPRMALTAAEYLAY---EH
2a2zD           STNVLQMERWSFTFQTYACLSRIRAQLASLNEKPV---------------LFFERSVYSDRYIFASNLYE
1e9fA           EIGK----LLSSYLQKKSDVEDHSVHLLFSANRWEQ---------------VPLIKEKLSQGVTLVVDRY
3dhwC           SESELTKARRQIGMIFQHFNLLSSRTVFGNVALP-------------LELDNTPKDEVKRRVTELLSLVG
2ctsA           IRFRGYSIPCQKMLPKAKGGEEPLPEGLFWLLVTGQIPT-----------EEQVSWLSKEWAKRAALPSH
2c9yA           GSEL--GKKLKATMDAGKLVSDEMVVELIEKNLETPLCKN----------GFLLDGFPRTVRQAEMLDDL
2cgtH           GMNPMDLKRGIDKAVTLSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVTVEDGTGLQDELD
3c8uA           --VPDGFHLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKH-------QERVIYPLFDRARDIAI---
1e2dA           EIGKLLS---SYLQKKSDVEDHSVHLLFSANRWEQ---------------VPLIKEKLSQGVTLVVDRYA
1aroP           ---------------------------------------------IELAAIPFNTLADHYGERLAREQLA
3bpbA           GAESRRGETEIIEETVQRFYPGKVERIEAPGT------------------VEAG----DIMMVGDHFYIG
2c04A           AAREQLRLLGEKVGVPVLEVMDGES---------------------------------PESIRRRVEEKA
2d3wA           ALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRS----YRGQETLDRFDFQDLMEEKIALLKMP
2awoC           PPAERGVGMVALYPHLSVAENMSFGLKLAGAKKEVI----------------------NQRVNQVAEVLQ
1e9sD           SKFG---RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT---------------------
1b0uA           RDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLEN-VMEAPIQVLGLSKHDARERALKYLAKVGI
1e9sG           SKFGR-DKDIILNPYDQRT--KGWSFFNEIRN------------------DYDWQRYALSVVPR------
2d4hB           GQNDSWIFLSSTFVYNSIGTINQQAMDQLYYV-------------TELTHRIRSKSSDSADFVSFFPDFV
2a30B           QMMYEKPERWSFTFQTYACLSRIRAQLASLNDAEK-------------PVLFFERSVYSDRYIFASNLYE
3b85A           GEKLGFLPGDPYLRPLHDALRDVEPEVIPKL-------------EAGIVEVAPLAYRGRTLNDAFVILDE
3cmtD           PIY---ARKLGVDIDNLLCSQPDTGEQALEICRSGAVDVIVVDSVTPKAEMGLAARMMSQAMRKLAGNLK
3b2qA           GITNEEAQYFMSDFEKTGALERAVVFLNLA--------------DDPAVERIVTPRMALTAAEYLAYEHG
2cckA           GEEIRKIVLEDMDIRTEAMLFAASRREHLV------------------------------LKVIPALKEG
1e9sF           SKFGR-DKDIILNPYDQRT--KGWSFFNEIRNDYDWQRY-------------------------------
2dr3E           -QVRQNMAQFGWDVKPYEEKGMFA------------------------------------MVDAFTAGIG
2a5gA           KNVKFNVWDVGGLDKIRPLWRHYYTGTQGLI---------FVVDCADRDRIDEARQELHRIINDREMRDA
1e0jB           EET---AEDLIGLHNRVRLRQSDSLKREIIENGK------------------FDQWFDELFGNDTFHLYD
1e9rA           SKFGRDKD---IILNPYDQRTKGWSFFNEIRND---------------YDWQRYALSVVPRGKTDEAEEW
2d2eA           GENILELSPDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALE--------L
2awnC           --------------QSYALYPHLSVAENMSFGLKLA---------------GAKKEVINQRVNQVAEVLQ
1e9dA           EIGKLLS----SYLQKKSDVEDHSVHLLFSANRWE---------------QVPLIKEKLSQGVTLVVDRY
2d4hA           VPHPKKPGHILVLLDTEGLGDVENQNDSWIFALA----------VLLSSTFVYNSIGTINQQAMDQLYYV
2akaA           QILQANPILEAFGNAKTTRNNNSSRFGKFIEIQF----------NSAGFISGASIQSYLLEKSRVVFQSE
1cr0A           GLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAE--------
2a30D           STNVLQPERWSFTFQTYACLSRIRAQLASLNGK---------------PVLFFERSVYSDRYIFASNLYE
1e3mA           VVEQVLNEPF--IANPLNLSPQRRLIITGPNGGKSTYRQT---------------ALIALAYIGSYVPAQ
1e9sJ           SKF---GRDKDIILNPYDQRTKGWSFFNEIRN-------------------------DYDWQRYALSVVP
2axpA           EKLFEHLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFI-------EDKIKAKAKVVYLHADPSVI
2awoA           PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVI------------------NQRVNQVAEVLQ
2d3wD           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLM------EEKIALLKMP
3d7wA           APAGAETQDFSGTTSSSQPFNGS-------------------------------YPDLERYAGHRDQIPL
2d2fA           SPDERARKGLFLAFQYPVEVPGVTIANFLRLALQ----------AKLGREVGVAEFWTKVKKALELLDWD
2d3wC           SPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALN------AVRSYRGQETLDRFDFQDLMEEKIALLKMP
3bo6B           FHISVQREQVPQAFQALSGLLFSVDSPIDK--------------WKVTDMERVDQQSRVAVGAQFTLYVK
3dt2A           AQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTI------------QKNTIFTNVAETSDGGVYWEGID
1dhjA           ---------------------------------------------LIAALAVDRVIGMENAMPWNLPASL
3d3kA           QGISCGRHLANHDVQVILFLPNFVKMLESITNE-----------LSLFSKTQGQQVSSLKDLPTSPVDLV
1bg0A           HPPKQWGDINTLVGLDPAGQFIISTRVRCG--------RSLQGYPFNPCLTAEQYKEMEEKVSSTLSSME
2a2zB           STNVLQMMYEKPERWSFTFQTYIRAQLASLNGEK--------------PVLFFERSVYSDRYIFASNLYE
3czpA           RAQPYLWRFWRHIPARRQFTIFDRSWYGRV----------LVERIEGFCAPADWLRAYGEINDFEEQLSE
3bb1F           SRSRA-GFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITD--
1cr2A           ESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKF--------------------------DQWFDELFG
3cddD           ACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFG
3da4A           ISPMKINQGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLTISANGSWTYNGVYDFNASTHRGI
3ch4B           -YAQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFF---CRKIVEGISQPIWLVSDTRRVSDIQWFREAYG
1e0jA           -EETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLY--------------------D
2bbsB           QNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISK-----------------------------FA
2cjwB           LLDMW-ENHDHMQVGDAYLIVYSITDRASFEKASE---------------LRIQLRRARQTEDIPIILVG
1e9rE           -MLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRY-------------------------------
3a1wA           FTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGD-------------ADLVILVADSVNPEQSLYLL
2a30A           STNVLQMERWSFTFQTYACLSRIRAQLASLNGKLKDAEK---------PVLFFERSVYSDRYIFASNLYE
2cckB           GEEIRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRA
2d4uA           ALLQTNRAGIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEA------------LPRDPRQSTA
3cmvE           PIYA---RKLGVDIDNLLCSQPDTGEQALEIC-------------DALARSGAVDVIVVDSVAALT---P
3cddF           QRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLI---------LGDNVKAARGRF
2a2zA           STNVLQMMYEKPERWSFTFQTYA---------------CLSRIRAQLASLNGKEKPVLFFERSVYS----
3dt4A           AQGN--LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAET------------SDGGVYWEGID
2axzC           ----------------------------------------------------------KRTTFFGIDYEI
3bh0A           ENIKRLIVTAGSINAQKIKAARR---------------------DFASEDWGKLSMAIGEISNSNINIFD
1e4yA           GSELGKQAKDIMDAGKLVTDELVIALVKER-------------------------------------IAQ
2b8tC           TGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVAN-----------ILAENGFVVI
2dr3B           QVRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGEK-----------------------------------
2bbtB           QNSWIMPGTIKENIIGVSYDEYRYRSVI------------------------------KACQLEEDISKF
3dt7A           AQGNLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVY------------WEGID
2awnA           PPAERGVGMVFQSYALEVINQRV-----------------------------------------------
1e3mB           RITEGRHPVVEQVLNEPFIPLNLSPQRRLIITG-----PNGGKSTYR----QTALIALAYIGSYVPAQK-
3d3qA           TAKVTTEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDITRRG---KVPIIAGGTGLYIQSLLYNYAFEI
1cr1A           ---------------EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDT-------
3dt4C           AQGN--LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNT------------IFTNVAETSDGGVYWEGID
2bx2L           -----------------------------------------------------------RQHIAALGRPD
3bb1B           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFG-
2bjbA           PIAPLALRELGVAVDGTGLPFRVRGNGSLA------------------GGTVAIDASASSQFVSGLLLSA
2bdtA           YRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYI-------AFPDEAEALAQTVQAKVDDVEIRFII
3cr7C           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDR----DTARQLHEVGLPFVEVYVD
3cddC           ACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFG
2dflA           TEGTFRWERIENMAKALGLDIDNVMNNI--------------------------------YYIRAINTDH
1ai4B           NPQSGYIANWNNSPQKDYPASDL--FAFLWGGADRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRL
2bwjA           ASESERSKLIRDIMERGDLVPSGIVLELLK-------------EAMVASLGDTRGFLIDGYPREVKQGEE
3cr7D           FGLNK-DLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVAEEPFVEVYVDVP
3dtbB           AQGN--LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNT------------IFTNVAETSDGGVYWEGID
3adkA           GSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKV---------------DTSKGFLIDGYPREVKQGEE
1d6jB           DGDNIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETG
1e9rD           SKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAE--------------------
2eg5G           DFNSVFKLLPSFYRKL-EKENGRKIGSCLIGAMPGSFYSRLFPEESM-----HFLHSCYCLQWLSQVPSG
2d0kA           ---------------------------------------------------------NENALPWNLPADL
2ausC           -----------------------------------------IVKDDKAETNPKWGFPPDKRPIELHIQYG
2a5jA           KQIKL--------------QIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETNHLTSWLEDARQHSS
2c7cH           GMNDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVIVEDGTGLQDELD
3bb1E           VSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKS----------FLLDKTIDVLLYVDRLDAYRVDNLDK
1dg3A           HILV-LLDTEGLGDVEKGDNQNDSWIFALAVLLS----------STFVYNSIGTINQQAMDQLYYVTELT
421pA           VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINN---------TKSFEDIHQYREQIKRVKD
2b8wB           MWCVPHPKKPGHILVLLDTEGLG------------------DVEKGDNQNDSWIFALAVLLSSTFVYNSI
3bgwA           ENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNI-------------------------
2b8tB           -------PKILPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDR-----ICEVANILAENGFVVI
2bhjA           SCLIMNPKSLTRGPRDKPTPLEELLPHAIEFINQYYG-----------SFKEAKIEEHLARLEAVTKEIE
1e59A           FAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQ--------W
3cmwC           PIY---ARKLGVDIDNLLCSQPDTGEQALEICDALA-------------RSGAVDVIVVDSVAALT--PK
1e6cA           TVADVVEGWPGFRRRESEALQAVATPNRVVATGGGMVLLE------QNRQFMRAHGTVVYLFAPAEELAL
1e2gA           -RSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQ---------------VPLIKEKLSQGVTLVVDRY
2dr3D           QVRQNMA-QFGWDVKPYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDL-----------------------
2a1fF           ----------------------------------------------------------------------
2bv7A           WLKR-------------GLRFIQVFLQSICDGER------------------------DENHPNLIRVNA
2awoD           KRMNDTPPAERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVL
2a1fD           ----------------------------------------------------------------------
3bb1C           -SRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITD--
1cfrA           INDEAIRLGGKISDGSFNKCNGLIGIRAI----EFFLESETNFIVVKMPNATSYKSCLSEFIYDLRSKLS
3d31A           SPEKHDIAFVYQNYSLFPHMNVK---------------------KNLEFGMRMKKIKDPKRVLDTARDLK
1afrA           DEQTMLNTLDGVRDETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGM--
1eilA           ---------------------------------------------------------LGYLGFAVKDVPA
3bjdB           AVHATSR-------QIDSAASKLAALAEAGLKGD-RQAYAAYQQLLYVLSLSDDVA--TAQTRRWLARAI
3d3qB           TAKVTEEEGIPHYIDILPPDASFSAYEFKKRAEKYIKDIT-----------RRGKVPIIAGGTGLYI-QS
5dfrA           --------------------------------------------MIS---LIAALAVDRVIGPWNLPADL
3dffA           AAQDGANVLVYTVFAGAAQPPYSPAAQRHTIWG------------LAPDDDAVLYR--RKEDIAALDHLR
3bgwD           ENIKRLIVTAGSINAQKIKAARRDFASEDW---------------------GKLSMAIGEISNSNINIFD
2boeX           --------------------------------------------WVRNNPNDPRTPVIRDRIASVPQGTW
1e9sB           SKFGRDKDIRTKGWSFFNEIRNDYDWQRYA----------------------------------------
2bkhA           NPLLEAFG-----NAKTVRNNNSSRFGKFVEIHF----------NEKSSVVGGFVSHYLLEKSRICVQGK
1e9sH           SKF---GRDKDIILNPYDQRTKGWSFFNEIRNDY----DWQRYALSVVPRGKTDEAEEWASYGRLLLR--
2ck3C           VAIGQ-KRSTVAQLVKRLTDADAMKYTIVVSATA------------------------------------
1dkiA           PYFNHPKNLFAAISTRQYNWNNI---------------------LPTYSGRESNVQKMAISELMADVGIS
2bkiA           NPLL-----EAFGNAKTVRNNNSSRFGKFVEIH-----------FNEKSSVVGGFVSHYLLEKSRICQGK
2dr3C           TIFSQQFLWNGLKMGEPGIYVALEEHPVQVRQNM----------AQFGWDVKPYEEKGMFAMVDAFTAGI
3cm0A           GTPL--GERVRPIMERGDLVPDDLILELIR--------EELAERVIFDGFPRTLAQ--AEALDRLLSETG
3be4A           GIGLEAKSIIESGNFVGDEIVLGLVKEKFDLGVCVNGFVLDGFPRTIPQAEGLAK--ILSEIGDSLTSVI
2dr3F           VQVRQNMAQFGWDVKPYEEKGMFAMVDAFTA----------------------------------GIGKS
3dymA           -----------------------------------------------------------GDKKQLLTPLR
1e9sL           SKFGRDK---DIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKT-------DEAEEWASYGRLLL
1d6jA           NIRFGLNKDLGFSEADRNENIRRIAEVAKLFADSNS----------------------IAITSFISPYRK
1draA           --------------------------------------------MI-SLIAALAVDRMENAMPWNLPAEL
1dhiA           --------------------------------------------MI-SLIAALAVDRMENAMPWNLPASL
1bmfC           VAIGQKRSTVAQLVKRLTDADAM----------------------------------------KYTIVVS
1e2fA           EIG----KLLSSYLQKKSDVEDHSVHLLFSA---------------NRWEQVPLIKEKLSQGVTLVVDRY
1drbA           --------------------------------------------MI-SLIAALAVDRMENAMPWNLPACL
2c9oC           EIKKT-EVLMENFRRAIGLRIKETKKKEIIQDVTLHDLD------------VAGEINKVVNKYIDQGIAE
3ecpA           HR---AADWAKSVFSSAALGDPRRTARLVNVAAQLAKYSGK--------SITISSEGSKAAQEGAYRFIR
1e9rG           SKF---GRDKDIILNPYDQRTKGWSFFNEIR------NDYDWQRYALSVVPRGKTDEAEEWASYGRLLLR
2c4rL           KAAESRPAPF--LIHQESNVIVRAFRDYLRQD-------IGEILIDNPKVLELARQHI-----AALGRPD
1av6A           DPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKI-----------------ILISDVRSPSTADLLSNYA
3cr7A           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTGLPF-VEVYVDVP
2bbtA           QNSWIMPGTIKENIIGVSYDEYRYRSVIK-----------------------------ACQLEEDISKFA
3bb1A           SRSRAGFTLN---IIDTPGLIEGGYIND-----------MALNIIKSFLLDKTIDVLLYVDRLDAYRVDN
3dfpC           ----------------------------------------------------------------------
1e9sM           SKF---GRDKDIILNPYDQRTKGWSFFNEIRNDY------------------------------------
1bglA           ----------------------------------------------------------------------
2dpyA           KDFIELGPDGRARSVVIAAPADVSPLLRMQGAAEDFRDRGQHVLLIMDSLTRYAMA-QREIALAIPATKG
2c0bL           KKKAAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILID------------NPKVLELARQHIAALGRPD
1cjaA           -VIVNNSDRLPIAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPH---GERVRELLRTLIAHPGHES
2c9gA           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
4atjA           DCFVNGCDASILLDNTTSFRTEKDAFGNANSARGFPV-------------IDRMKAAVESACPRTVSCAD
3cioD           YSHNLFTVSNEHGLSEYLAGKDELN-KVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQL--------L
1e1qB           VAIGQKRS-TVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLA
3di4A           HGTH--VTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHS-
3cnlA           TPGILYKNIFSEDLAAKLLLVGSLPVERIEDQ---------------RIFERAFEIFARSIGIESSFSEF
1adoA           ----------------------------------------------------------------------
3dfnC           ----------------------------------------------------------------------
2dpyB           KDFIENILDGRARSVVIAAPADVSPLLRMQGAAY---------------ATRIAEDFRDRGQHVLLIMDS
2ahwD           QEGL-VKWALCGHWGQSPRI-SDLAEQNKIIAYNYPQGV--LTQTLRAAAAHQPGIISDI---------G
1ak2A           GSELGKKLKATMDAGKLVSDEMVLELIEKNLETP------------PCKNGFLLDGFPRTVRQAEMLDDL
3dm9B           GAIEQLRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSET--------------------
1e2hB           LGASETIANI---YTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLI
3b55A           -------------------------------------------------------------NTNQIAKWL
3bk7A           --DNVIRAFRGNELQNYFERLKNGEIRPVVKPQYVDLLPKAVKGKVREL-LKKVDEVGKFE--EVVKELE
3clvA           VNENLCKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNT--------------LDRAKTWVNQLK
2drcA           --------------------------------------------MI-SLIAALAVDRMENAMPFNLPADL
1cs4C           AIETI-VAAMSNLVPPVE-LANPENQFRVDYILS------------------------------------
3a00A           GEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNY----------------------------YGSTVAS
3dfqA           ----------------------------------------------------------------------
2cvfA           LVQMAETRGL---NPEEALSRFILFTPSDFKE---------QRRVIGSLKKTVDSNFALVVVDSITAHYR
3dauA           --------------------------------------------MI-SLIAALAVDRMENAMPWNLPADL
3c15C           EAIETIVAAMSNLVPPVELANPENQFRVDYILSV------------------------------------
1e9sI           --LSKFGRDKDIILNPYDQRTKGWSFFNEIR----------------------------------NDYDW
1e9sE           SKFGR-DKDIILNPYDQR--TKGWSFFNEI----------------------------------------
1dp0A           ----------------------------------------------------------DKKQLLTPLRDQ
1e9rF           SKFG--RDKDIILNPYDQRTKGWSFFNEIR----------------------------------------
3dfnD           ----------------------------------------------------------------------
3brwA           -------HDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLY---------------PKASRLIVTFDE
1cjtC           AIETIVMSNLVPPVELANPENQFRVDYILSVMNV------------------------------------
3dfoD           ----------------------------------------------------------------------
2cbzA           -KVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKG
3d1mA           --------------------------------------------------------------AYKQFIPN
3dfpD           ----------------------------------------------------------------------
3cr7B           FGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFVEVYVDVP
2a1fC           ----------------------------------------------------------------------
3cbnA           ---TAGHRTTFEVTVDP----EIGETADCIIGVSS------SDSISTLPDEKRAIARESLVRVILRTENG
3cmvB           PIY---ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAV-------------DVIVVDSVAA----LT
2d7vA           EKHHL-AHENCFIANSVE----------------------------------------------------
2bhvD           ----------LRTITADKMIPAFLITPISSQIA------------GKVIAQVESD--IFAHMGKAVLIPK
2bkeA           TEGTFRWERIENAKALGLDIDNVNNIYYIR----------------------------------AINTDH
3dlbB           ---------AFLLEVDPAYRILCEM----SLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLP
3bb1G           -QSEGPRPVMVSRSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDK
2d7vB           EKHHL-AHENCFIANSVE----------------------------------------------------
1accA           --------------TEFDFNFDQQTSQNIKNQ------------------LAELNATNIYTVLDKIKLNA
3cmuA           PIY---ARKLGVDIDNLLCSQPDTGEQALEICDAL-----------------------------------
1akeA           GSEL--GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYV---
2aunB           ----------------------------------------------------------LEATLRQLEVHG
3dfnA           ----------------------------------------------------------------------
3dfqD           ----------------------------------------------------------------------
3dftD           ----------------------------------------------------------------------
2d4uB           ----LNRAGIRYMMDQNNIGSGSTVAELMESA----------SISLKQAEKNWAD--YEALPRDPRQSTA
1culC           AIETI-VAAMSNLVPPVELANPENQFRVDYILSV------------------------------------
1e2kA           ETI---ANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHP
3czjA           ----------------------------------------------------------IGDKKQLLTPLR
2ahvA           QEGLV-KWALCGHWGQSPRI-SDLAEQNKIIAYNYPQGV-----------LTQTLRAAAAHQPGIISDIG
2aumA           ---------------------------------------------IAPASAIATEV--LEATLRQLEVHG
3dftC           ----------------------------------------------------------------------
3bczC           SCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDE
1aldA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
2ancB           ------TQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATG
3dyoA           ---------AENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQ
2anbA           -----------SHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATG
2bofX           NPNDPRTP---VIRDRIASVPQGTWFAHHNPG----------QITGQVDALMSA----AQAAGKIPILVV
2an9A           PGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQ--
1dvrA           GTQLGLEAKK--IMDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQ-----
3dfoC           ----------------------------------------------------------------------
3ec1A           DMIEIPL-ESGATLYDTPGIINHHQMAHFVDARDLKI--------------ITPKREIHPRVYQLNEGQT
3d1mB           --------------------------------------------------------------AYKQFIPN
3dfqC           ----------------------------------------------------------------------
1c9kC           HHKDGRPAHWRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDPEQWDYAAMERAIDDEIQIL--
3dm5B           VVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIV--------------
3crmA           IGTAKPSR-ELLARYPHRLIDIRDPAESYSAA------------------EFRADALAAMAKATARGRIP
2ccjA           TREPGGVPTGEEIRKIVLEGNDMDIRTEAML---------------FAASRREHLVLKVIPALKEGKVVL
3c7kA           QSLAAIVRAMDTLGVEYGDKERK-----------------------------------------------
2aunA           ---------------------IDGRVALIAPAS---------------AIATEVLEATLRQLEVHGVDYH
3dvlD           QDIIKNARSFGWDLAKL----------------------------VDEGKLFILDASPDPEGQEVVGGFD
2ancD           -----DTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATG
1dekB           ------KDALAYAWGVFAANTDYPLTRKEFEG-----------------------IDYDRETNLNLTKLE
3cueF           KTVKLQIWDTAGQERFRTITSSYYRGSHGI-------------IIVYDVTDQESFNGVKMWLQEIDRYAT
1eamA           DPILNVTLVTRFVDEEYLRSIKKQLHPSKIILIS------------------------DVRSPSTADLLS
2dftA           SIADIFA--TDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRT
6aldA           ----------------------------------------------------------------------
2czvB           TVQKFKSYLIYV-ESNDLRVIRYSIEKGVDAIIS--------PWVNRKDPGIDHVLAKLMVKKNVALGFS
3bjqB           ----------------------------------------------------------------------
1e4vA           -SGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDY----
2ancF           DVFLDIDWQGAQQIRQ-KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYD--
1e9sA           SKFGRDKDIILNPYDQRTKGWS------------------------------------------------
2bboA           QFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGIT---------------
3bv4A           ----------------------------------------------------------------------
4dfrA           ---------------------IAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKP--------------
1dyhA           --------------------------------------------MI-SLIAALAVDRMENAMPWNLPADL
1ckvA           WWIKANSELLGRQFNVYDFLVDVS-STIGRAY--------------------------------------
2c5mD           ----------------------------------------------------------------------
3bb1D           SRSRAGFTEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVA
2bhvA           ----------LRTITA------DKMIPAFLITPISSQIAGKVIAQVE--------SDIFAHMGKAVLIPK
3e8aC           EAI---ETIVAAMSNLVPPVELANPENQFR----------------------------------------
1ek0A           VTINEVKFEIWDTAGQERFASLAPYYRNAQAA-------LVVYDVTKPQSFIKARHWVK--ELHEQASKD
1e2iA           ANIYTTQHRLDQGEISAGDAAVVMTSAQI----TMGMPYAVTDAVLAP--HIGGEAGPPPALTLIFDRHP
3bb1H           SRSRAGFTLN--IIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLY-----------------------
2b8tD           IQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVI-------GIDEVQFFDDRICEVANILAENGFVVI
1dw9A           EDSILLIDDRIPTDPTYRFYELQVYGTTLKALVHE---------------KFGDGIISAINFKLDVKKVA
2aexA           ----------------------------------------------------------------------
1e9rB           SKFGRDKDIILNPYDQRTKGWSF-----------------------------------------------
2dftC           -----QRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEIS
3cnnA           PGILYKNIFSEDLAAKLLLVGSLPVERIED----------------QRIFERAFEIFARSIGIESSFSEF
1e2mB           LGASETIANIYTTQHRLDQGEISAGDAAVV------MTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALT
2axnA           ------------------GVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYL
3ed8A           PIGDGPVL-----LPDNHYLSYQTVLSKDPNE--------------------------------------
1e2jA           IYTTQHRLDQGEISAGDAAVVMTSANITMG-------MPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHP
1chdA           ----------------------------------------------------------------------
3dfdA           KAKE-LREAYKTEDPVEVAKRVLSVGGEYA----------------------------------------
3c14C           EAIETIVSNLVPPVELANPENQFRVDYILS----------------------------------------
1azsC           EAIETIVAAM---SNLVPPVELANPENQFR----------------------------------------
3bwdD           DYNRLRPLSY--RGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFF----
1dekA           AWGVFAANTDYPLTRKEFEGID---YDRETNLNLTKLEVITI-------MEQAFCYLNGKSPIKGVFVFD
3ci2A           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------
2e85A           ---------------------------------------------------------MGDDGAGPLLAEK
2aumB           ---------------------IDGRVALIAPAS-------------------AIATEVLEATLRQLEVHG
3dkvA           KEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEAILEEMGRPIDYVI-
3a00B           GEVNG-KDYNFVSVDEFKSMIKN-------------------NEFIEWAQFSGNYYGSTVASVKQVSKSG
1e2iB           PEPMTYWRVLGASETIANIYTTQHRLDQGEI---------------------SAGDAAVVMTSAQITMGM
1cjuC           EAI---ETIVAAMSNLVPPVELANPENQFR----------------------------------------
2a5vA           AP------SVLLGRRDGLSRVDEFEQRHVH----ETVAI--LMARSSAISERIAGGSLAIV---------
3cqcA           -----------------HETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGI-----WKG
1e2lB           ------WRVLGASETIANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAP----------
3bm2B           --------------------------------------------------LRAGRAPDWHFFVIEGEGRE
1e2lA           ANIFTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHI---------------GGEAGSPPP
3e70C           GAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKIARVT
1dwmA           ----------------------------------------------------------------------
3b9qA           ----------------------------------------------------------------------
3b85B           RPAVEAGEKLGFLPDPYLRPLHDALRDVEPEVIPKLEA--------------------GIVEVAPLAYRG
1e9sK           SKFGRDKDIILNPYDQRTKGWSF-----------------------------------------------
2e85B           ----------------------------------------------------------------------
2cdnA           EEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLN-----------NPDAANGFILDGYPRSVEQAKALHE
1d2zD           PARPVDG---------------------------------------------------------------
1bccF           EGIRKWYYNAA-GFNKYGLMRDDTIYENDDVKEA---------------IRRLPENLYDDRMFRIKRALD
1e2nB           SETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVL-------APHIGGEAGSPPALTLI
3cd9A           GPVL-LPDNHYLSTCSALPNEKRDHMVLLEFVTAA-----------------------------------
1d8jA           ----------------------------------------------KFGVLAKIVNYMKTRHQRGDTHPL
1cjvC           IETIVANLVPPVELANPENQFRV-----------------------------------------------
3c85A           AYDEL-RARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPHHQGNQTAL
3cddE           QGQACTVDIGGETGYVDDWVPSYDESTITISVSGR-----DKTADLVDCSIDYPSGQFNNQTLTQIADIV
2a5vB           AP------SVLLGRRDGLSRVDEFEQRHVHET--------------------------------------
3cddA           QGQACTVDIGGETGYVDDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFG
1e2mA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPY--------------AVTDAVLAPHI----
1e2jB           LGASETI-ANIYTTQHRLDQGEISAGDAAVVMTSANITMGMPYAVTD-----------------------
2bwjB           ----------------------------------------------------------------------
3dmdA           ----------------------------------------------------------------------
3dvlC           STLVSGTSGTGKTLFSIQFLYNG-IIEFDEPGVFVTFEETPQDIIKNARSFGWDLAKLVDEGKLFILDAS
1e2nA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMP--------------YAVTDAVLAPHI-GGE
2c1lA           RIHAKLYGTSGESLVVSSGNFTGPGMSQNIEASLLLDNNTTQSMMISEMLNQNWHIHNMTNATDASPGWN
2a78A           VLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFL--------CVFSITEMESFAATADFREQILRVKED
1e2kB           LGASETIANIYTTQHRLDQGEISAG-DAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFD
2dx7A           ----------------------------------------------------------------------
1e2hA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRH
3cphA           VDIN-GKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL-
3cbqA           IMVDKEEVTLVVWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRS--------------------------
3cr8B           ------------------------------------------------------------YGGTLVNLID
1e1dA           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHD
3b60A           LDTIIGENGVLLSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHR
2d3wB           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSL-DIDALKVVADGVNSLRDGKRSFIIVTHY
3b5jA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAHR
3cmvG           EIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETR
3dmdC           KARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFNAVKIDGIILTKL
2c61B           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINV
2dwpA           AKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAM
2dwoA           AKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAM
3cmvH           EIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSETR
3eiuA           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINV
3cmvC           KAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEVGSETRVKVVKN
3c95A           FNYRARNFPGTLDYAEQQRWLEHRRQVFTP--EFLQGYADELQMLDDKEKVALLKALWQYADEIV-----
2ccgA           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKF
4dcgA           PFPAQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLRNKVVVNFD
2akaB           PGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALK-IAKEVDPQGQRTIGVITK
2bifA           SEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEAT
2b8wA           THRIRSKSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSKDETFNLPRLCIRKFFPKKK
2c03B           RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKL
3cmvA           -------------------DSVAALTPKAEIEGEIGDSHMGLAARMMSQARKLAGNLKQSNTLLIFINQG
2awnD           EAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVQVELPMPRQQVWLPVE
3eiuB           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVV-----ARELHRKGIYPPINV
3dmdB           KARGIDVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVEQARQFEAVKIDGIILTKL
2b8tA           ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLRK------IDGKHADYNDDIVKIGCQ
1e69A           KPGRRDQKLSLLSGGEKALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHN
2ccjB           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKV
3czpB           YGIIVVKFWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDVDAVGDVDRTSTE-IAPWTLVEAN
1bifA           SEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEAT
2czvA           RPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKAS
3dm5A           KSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEAPIGSIIVTKL
2ccgB           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSDQEDLKFHEKEGY
3cmxA           QSNTLLIFINQIRNPETTTGGNALKFYASVRLD-IRRIGAVKEGENVVGSETRVKVV-----KNKIAAPF
1cr4A           DTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLK--GFAKSTGVVLVVICHL
1e98A           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENG----AFQERALRCF
2bbsA           FAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILVTS
2d62A           LTELLNRKPRELSGGQRQRVALGRAI-IRRPKVFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHD
2dr3A           ------------DIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSILKRVLAGTGCTSIFVSQV
2bc9A           VLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADPDEYLTYSLK
3b2qB           DLATLYERAGIVKGAKGSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINV
1e3aB           FLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFD
2b92B           HR---IRSKSSFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLIRKFFPKK
1d1cA           ETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQA--MDIVGFSQEE
1e9cA           AFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA----FQERALRCF
2awnB           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIESRLHKRLGRTMIYVTHD
2c03A           RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFEKVGVTGLVLTKL
2c61A           GMHVLVILTDITNYAEALRQMGAARNVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDD
2a2zD           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIYKHESWLLHRTLK
1e9fA           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLA-----------DAAKRYENGAFQERALRCF
3dhwC           LGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRILELLKDINRRLGLTILLITHE
2ctsA           VVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELICMDLIAKLPCVAAKIYRNLYRE
2c9yA           MEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLI--RRSDDNEKA
2cgtH           VVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEVAKAGKPLLIIAEDVEGEAL
3c8uA           -------------AGAAEVGPECRVAIIEGNYLLFDAPGWRDLTAISIRLEVPADLEARLVQRWLDHGLN
1e2dA           FSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQE-----RALRCF
1aroP           LEHSYEMGEARFRKMFERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTT
3bpbA           ESARTNAEGARQMIAILEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEE
2c04A           RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKGVTGLVLTKL
2d3wA           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHY
2awoC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQRIEISRLHKRLGRTMIYVTHD
1e9sD           -------------DEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLLEGTLAESLFAGS
1b0uA           DERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHE
1e9sG           ----------GKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGS
2d4hB           WTLRDFSLDLEADGQPLTPDEYLTYSLKLKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQADFCSYIFS
2a30B           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIYKHESWLLHRTLK
3b85A           AQNTTPAQKFLTRLGFGSKVVTGDGLRLVR-HILRGVDDVHFSELTSSDVVRLVGHIVD-----------
3cmtD           QSNTLLIFINQIRMKNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVG----SETRVKVVKNKIAAPF
3b2qA           MHVLVILTDITNYAEALRQMGAAR---NEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMP
2cckA           KVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSEDLKFHEKV
1e9sF           ---ALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGS
2dr3E           KEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSILKRVLAGTGCTSIFVSQV
2a5gA           IILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS--------------
1e0jB           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKLKGFASTGVVLVVICHL
1e9rA           ASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDK
2d2eA           LDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVRGVNAMRGPNFGALVITHYQ
2awnC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHRLGRTMIYVTHD
1e9dA           AFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGA----FQERALRCF
2d4hA           TELTHRIRSKSSPDESADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKPRLCIRKFFPKKK
2akaA           TERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMD---IVGFSQEE
1cr0A           -----------AETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNL--MTKLKGFAKSTGVVLVVICHD
2a30D           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLYKHESWLLHRTLK
1e3mA           KVEIGPIDRIFTRVGFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLKIKALTLFATHY
1e9sJ           RG---------KTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFTLAESLFAGS
2axpA           KKRLRVRGDEYIEGKDIDSILELYREVSNAGLHTYSWDTGQWSSDEIAKIIFLVE---------------
2awoA           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHD
2d3wD           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDGLDIDALKVVADG-VNSLRDGKRSFIIVTHY
3d7wA           GIDQLIQSVTALRFPGGQTKTQARSILILIQM--ISEAARF------NPILWRARQYINSGASFLPDVYM
2d2fA           ESYLSRYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVRGVNAMRGPNFGALVITHYQ
2d3wC           EDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFII-VTHYQR
3bo6B           PDQENSQYSASSLHNTRQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQALRE
3dt2A           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALS
1dhjA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACGDVPEIMVIGGGRV
3d3kA           INCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHI-DAKWSLALGLPLPLGEHAGRIYLCDIGI
1bg0A           DELKGTYYLTGMSKATQQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFLHLRIISMQKGGD
2a2zB           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEESWLLHRTLK
3czpA           YGIIVVKFWLAIDKQTQERF-KEREKTPYKRYKITEEDWRNRDKWDVDAVGDVDRTSTEIAPWTLVEAND
3bb1F           --------SFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKD-IPVVLIENSG
1cr2A           NDTFHLYDSFEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTK--LKGFAKSTGVVLVVICHL
3cddD           IKVIVNTDVGEIEQGETPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSL--ILGDNVKAARGR
3da4A           IGESLTRLGAMFSGKEYQILLPGEIHIKES----------------------------------------
3ch4B           AVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFG--------------------DFDWVIENHGV
1e0jA           SFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLTKLKGFAKSTGVVLVVICHL
2bbsB           EKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TS
2cjwB           NKSDLVRREVSVSEGRAAVVFDCKFIETSAAVQHNVKE-------------------LFEGIVRQVRLRR
1e9rE           ---ALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLREGTLAESLFAGS
3a1wA           LEILEMEKKVILAMTAIDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYA------------
2a30A           SECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETGRNEEQGIPLEYLEKLYKHESWLLHRTLK
2cckB           ---------LNEFAINGLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEGYQEIRFKSVNADQP
2d4uA           AAAEIKRNYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDDIAVS-------
3cmvE           KAEIEGLAARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRGAVKEGENVVGSETRVKV
3cddF           SWRQRFSKFTIKAAGIKADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRSIGKS-NAEYTVTGWR
2a2zA           DRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGNEEQGIPLE
3dt4A           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALS
2axzC           VSNLLNVLPYEEVSSIIKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYINQIKNISINGYYD
3bh0A           KAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKARELDVVVIALSQL
1e4yA           EDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVY--HVKFNPPKV
2b8tC           ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLR-------KIDGKHADYNDDIVKIGC
2dr3B           -----YIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQV
2bbtB           AEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS-
3dt7A           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIRPAGVPLVYEALS
2awnA           ------------------------------------------------------RLHKRLGRTMIYVTHD
1e3mB           VEIGPIDRIFTRVGTFVETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACAENLKIKALTLFATHY
3d3qA           SEDKKQVKLKLKELEHLYLASFDKESAKDIHPNNRKRVLRAIEYKLLSSRKKVQQFTENYDTLLIGIESR
1cr1A           --FHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISI--RKMIDNLMTKLKGFAKSTGVVLVVICHG
3dt4C           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGRRPAGVPLVYEALS
2bx2L           FSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFN--TN
3bb1B           -----------KGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGR
2bjbA           ----------ASFTDGLTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDDSTPNRWQVRPGPAARRWDIEPD
2bdtA           LWTNREELLRRDALRKKGERCLELVE--EFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI-----
3cr7C           QRDPKGLYKKAREGVIKEFTGISAP-YEAPANPEVHVKNYELPVQD--AVKQIIDYLDTKGY--------
3cddC           IKVIVNTFQRIQIEQGETPHELLARLAKQRGVLLTSDTFGNLVITRASKTKAGVSLIL--GDNVKAARGR
2dflA           QIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLRLAEVYDIAVIITNQV
1ai4B           FLPTLQAATSGLTQSDPRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFD
2bwjA           FGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKIN
3cr7D           VEVPKGLYKKAREGVIKEFTGISAP-YEAPANPEVHVKNYELPVQD--AVKQIIDYLDTKGYLP------
3dtbB           EPLAPGVTITSWKNKEWRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGRRPAGVPLVYEALS
3adkA           FERKIGQPTLLLYVDAGPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVN
1d6jB           VEVYVDVPVEVAE---------QRAPYEAPANPEVHVKNYELPVQDAV--KQIIDYLDTKGY--------
1e9rD           -----------------EWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGS
2eg5G           LVTEIGTNKGSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAIDL
2d0kA           AWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAAAGDVPEIFVIGGGRV
2ausC           VIN-LDKPPGPTSHEVVAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKE-YVALMH
2a5jA           SNMVIMLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAINTAKEIYRKIQQGLF----
2c7cH           VVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEVAKAGKPLLIIAEDVEGEAL
3bb1E           LVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENS
1dg3A           HRIRSKSDSADFVSFFPDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLIRKFFPKKK
421pA           SDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREI------------
2b8wB           GTINQQAMDQLYYVTELTHRIRSKSSVSFFPDFVWTLRDFSLDLEDGQPLTPDEYLTYSLKLKKGTSQKD
3bgwA           --NIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDDVVVIALSQL
2b8tB           ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLR-------KIDGKHADYNDDIVKIGC
2bhjA           TTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYTNNGNIRSAIT
1e59A           RRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHG
3cmwC           AEIEGEIGDSHMGLAARMMSQAMRKLAGNL---KQSNTLLIFINQIRMKIGVMFGNP---ETTTGGNALK
1e6cA           RLQASLQAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDA--TQPPAAIVCEL-------------
1e2gA           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENG--------AFQERALRCF
2dr3D           -----------TDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQV
2a1fF           --------------------IYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGG
2bv7A           TKAYE--MALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYE
2awoD           DAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELP------MPNRQQVWLPVE
2a1fD           ------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGG
3bb1C           --------SFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSD-IPVVLIENSG
1cfrA           LN-----NVNLITSNPDFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKNFDYAELEHIKSFLS
3d31A           IEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKNKLTVLHITHD
1afrA           --DPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAA------DEKRHETAYTKI
1eilA           WDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDAALERMADKLRQAGVAFTRG
3bjdB           YRVEERFPAADLSRALSQEIAAQSRERHPSQYVFSSASRAQLQVFLRHQWFRTFRLYRDAA-DLLVNLTD
3d3qB           LLYNYAFEDKKQVKLKLKELELNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTDTLLIGIESR
5dfrA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVEIMVIGGGRV
3dffA           VHRHGRFLDSIYRKLPDGRWLTAHVEGRQKLAVNDHSPDSDHDLV-GEVADDIRSIIDEFDPTLVVTCAA
3bgwD           KAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQRDLKKMARELDVVVIALSQL
2boeX           FAHHNPGQITG---QVDALMSAAQAAGKIPILVVSNAPGRDCGGGAPSWIDEFAAGLKNRPAYIIVEPDL
1e9sB           ----------------------------------------------------------------------
2bkhA           EERNYHIFYRLCAGASEDIRERLHLSPDNFRYLNRGCTRYFANKETDKQINRKSPEYLKAGSLKDPLLDD
1e9sH           -ETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTM
2ck3C           ---SDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLL-RRPPGREAYPGDVFYLH
1dkiA           VDMDYGPSSGSAGSSRVQRALKENFGYNQSVHQINRGDFSKQDWEAQ-------IDKELSQNQPVYYQGV
2bkiA           EERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSEYLKAGSLKDPLL
2dr3C           GEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMIILQLKRVLAGTGCTSIFVSQV
3cm0A           TRLLGVVLVEVPEEELVRRILRRAELEGRSDD--NEETVRRRLEVYREKTEPLVGYYEARVLKRVDGLGT
3be4A           YFEIDDSEIIERISGRCTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVKVLDVFHKQTAPL
2dr3F           KEYEKYIVHDLTDIREFIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARLQLKRVLAGTGCTSIFVSQV
3dymA           DQFTRAPLDNDIGVSEATRIDPNAWVWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRK
1e9sL           RETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTM
1d6jA           DRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNYEVKQIIDYLDTKGY---LPAK-
1draA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACDVPEIMVIGGGRV
1dhiA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACGDVPEIMVIGGGRV
1bmfC           ATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAY-RQMSLLLRRPPGREAYPGDVFYLH
1e2fA           AFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQADAAKRGAFGHERYENGAFQE-----RALRCF
1drbA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRV
2c9oC           LVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGILDLLDRVMIIRTM
3ecpA           NPNVSAE--AIRKAGAMQTVKLAQE----FPELLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHS
1e9rG           ETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTL-AESLFAGSNEASKALTSARFVLSDKLPEHVTM
2c4rL           FSSKIKLYTGEIPLFSHYQIESQIESAFQRGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIA
1av6A           LQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSD
3cr7A           VEVPKGLYKKAREGVIKEFTGISAPYEAANPEVHVKNYELPVQDAVKQIIDYLDTK----GYLP------
2bbtA           EKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK
3bb1A           LDKLAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK--SDIPVVLIENS
3dfpC           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
1e9sM           ----------------------------------------------------------------------
1bglA           -------------------PNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRK
2dpyA           YPPSVFAKLPALVERAGNGIHGGGSITAFYTVLTEGDDQQDPIADSAAILDVLSRRLAEAGH--------
2c0bL           FSSKIKLYTGEIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSRDIEETAFNTNLEAADEIARQLRLRD
1cjaA           SQFHSIRDIITLYTGY--DVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQELSISPQAIPFILRM
2c9gA           ----------------------------------------------------------------------
2a1fE           ------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGG
4atjA           LLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFNANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFG
3cioD           EWANDHYDLVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAILNGVI
1e1qB           YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGG----GSLTALPVIETQA--GDVSAYIPT-
3di4A           NLTRALADHTGLPLHEAELVHDVLNVFCTGFQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDCSSEAS
3cnlA           FEDFARKRGLLKKGGVPDIERALMLFQGKAGRVSFERP--------------------------------
1adoA           --------PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3dfnC           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
2dpyB           LTAMAQREIALAIGEPPATKGYPPSVFAKLPALV------------------------------------
2ahwD           IGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKAIAPDIAFIRATTCDSEGYATFEDEVMYLDALV
1ak2A           MEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLISDDNKKALKIR
3dm9B           --------------------NRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARQFNEAKIDGIILTKL
1e2hB           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRR
3b55A           EAHAKPLKTTNPTASLNDL--KPLKNVGSASIVGLGEATHGAHE-VFTKHRIVKYLVSEKGFTNLVLEEG
3bk7A           LENVLDRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHD
3clvA           ISSNYIIILVANKIDKNFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKNI--------
2drcA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVEAIAACGDVPEIMVIGGGRV
1cs4C           ----------------------------------------------------------------------
3a00A           VKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYK-ELKDFIFAE-
3dfqA           --------PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
2cvfA           AEENRSGLIAELSRQKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERH
3dauA           AWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGVPEIMVIGGGRV
3c15C           ----------------------------------------------------------------------
1e9sI           QRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATLRGFLEGTLAESLFAGS
1e9sE           ----------------------------------------------------------------------
1dp0A           FTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRK
1e9rF           ----------------------------------------------------------------------
3dfnD           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3brwA           HVISNNFKFGVIYQKLGATSEEELFST-NEESPAFVEFLEFLGQKVKLQDFKGFRGGGQTGTESVYCNFR
1cjtC           ----------------------------------------------------------------------
3dfoD           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
2cbzA           VNLSGGQKQRVSLARAVYSN--------ADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTH
3d1mA           VAEKTLGASGRYEGKITRNSERFKELNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISGVKLRVTEGW
3dfpD           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3cr7B           VEV-------AEQRDPKGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELPVQDAVKQIIDYLDTKG
2a1fC           ------------------QPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGG
3cbnA           YDEIRGYGHPELTLDHPTDIVCRKSDYICSRTLIRADKAAFDLDE---NLVRDLR-----KGRELKVEII
3cmvB           PKAEIGLAARMMSQAMRKLAGNLKQ-SNTLLIFINQGGNALKFYASVRLDIRRIGAVKE-GENVVGSETR
2d7vA           ----------------------------------------------------------------------
2bhvD           GSKVIGYYSNNNKMGERLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGVPFGDYLLMQLMRQS
2bkeA           QIAIVDDLQELVSKDPSIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHHQLTRLAEVYDIAVIITNQV
3dlbB           GGLSLLDYHASKGRLQGREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALSLPEERRRRTREIASW
3bb1G           LVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLS---DIPVVLIENS
2d7vB           ----------------------------------------------------------------------
1accA           KMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDT------
3cmuA           ----------------------------------------------------------------------
1akeA           -----------LEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKTAPLIGYY
2aunB           VDYHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDI
3dfnA           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3dfqD           --------PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3dftD           --------PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
2d4uB           AAAEIKRNYDIYHNALAELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQND------------
1culC           ----------------------------------------------------------------------
1e2kA           IAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAI
3czjA           DQFTRAPLDNDIGVATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHWQHQGKTLFISRK
2ahvA           IGTFVDPRQQGGKLNEVTKEDLIKLVEFDNKEYLYYKA--------------------------------
2aumA           VDYHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI
3dftC           --------PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3bczC           D-----------EHSIEHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNRFRYSYY
1aldA           --------PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
2b0lC           ------------------------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRV
2ancB           VDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAAEYDYLIVNDD
3dyoA           FTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTAHAQHQGKTLFISRK
2anbA           VDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAHYAEYDYLIVNDD
2bofX           SNAPGRDCGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHQQEVLETMAYAGKALKAGSS
2an9A           -----------------KMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAHYAEYDYLIVNDD
1dvrA           ----GTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALV--QISDDNADA
3dfoC           --------PALTPEQKKELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
3ec1A           LFFGGLARLDYIKGGRRSFVCYMANELTVHR-TKLEKADSLYANQLGELLSPPSKRYAAE--FPPLVPRS
3d1mB           VAEKTLGASGRYEGKITRNSERFKEPNYNPDIIFKDEENTGADRLMTQRCKDKLNALMNQWPGVKLRVTE
3dfqC           --------PALTPEQKKELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
1c9kC           -----------IAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAAD---EVWLVVSG
3dm5B           -----------DTAGRHKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIITKL
3crmA           LLVGGTMLYYKALLEGLPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVEALHARSDLPSIRAVG
2ccjA           CDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSNRLQEDLKFHEKV
3c7kA           ----------------------------------------------------------------------
2aunA           LGRHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDI
3dvlD           LSALIERINYAIQKYRARRVSIDSVTS--------VFQQYDASSVVRRELFRLVARLKQIGATTVMTTER
2ancD           VDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVYAEYDYLIVNDD
1dekB           VITIMEQAFCYLNGKSPIKGVFVFDDE-GKESVNFVAFNKITDVINNIEDQWSVRRLMQALTDLIVNNFD
3cueF           STVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS-------
1eamA           NYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVT
2dftA           GGND-------RAEKYRALMAKRAPLYRRVATMRVDTN--------RRNPGAVVRHI-------------
6aldA           --------PALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
2czvB           LRPLLYNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVI---GMEIPQAKAS
3bjqB           -------------------------------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKE
1e4vA           -----------VLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRTAPLIGYY
2ancF           --YLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISK-----------------------------
1e9sA           ----------------------------------------------------------------------
2bboA           -----------LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TS
3bv4A           ---------ALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTAD
4dfrA           -----------VIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRV
1dyhA           AWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEMVIGGGRV
1ckvA           ----------------------------------------------------------------------
2c5mD           ---------------LKSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQYVINKEYLGKTVQVVPHI
3bb1D           LTHAQFSPSEALLQVVRSGASLKKDAASDIPVVLIENSGRCNDEKVLPNGIAWIPHLVQ-TITEVALNKS
2bhvA           GSKVIGYYSNNNKMGEYRDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYGSAFGDYLLMQLMRQS
3e8aC           ----------------------------------------------------------------------
1ek0A           IIIALVGNKIDLQEGGERKVARGEKLAEEKGLLFFE----------------------------------
1e2iA           IAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHLDLAMLAAIRRVYGLLANTVRY
3bb1H           ---VDRLDAYRVDNLDKLVAKAITDSFGKGIWNKAIVALTHAQFSPPDGLYDEFFSKRSEALLQVVRSGA
2b8tD           ISGLDKNFKGEPFGPIAKLFTYADKITKLTAICNECGAEATHSLR------KIDGKHADYNDDIVKIGCQ
1dw9A           DPEGGERAVITLDGKYLP----------------------------------------------------
2aexA           -----------------------------DELAHRCSSFMAPPVTDLGELRLLILETQAQCQALAQVDGG
1e9rB           ----------------------------------------------------------------------
2dftC           AAEGVRRTGGDRAEKYRALMAKRAPLYRRVATMRVDTN--------RRNPGAVVRHI-------------
3cnnA           FEDFARKRGLLKKGGVPDIERALMLFFGKAGRVSFERP--------------------------------
1e2mB           LIFDRHPIAALLCYPAARYLSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRR
2axnA           AKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAM
3ed8A           ----------------------------------------------------------------------
1e2jA           IAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAAI
1chdA           -------------------------LLSSEKLIAIGASTGGTEA-----IRHVLQPLPLSSPAVIITHMP
3dfdA           ----------------------------------------------------------------------
3c14C           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
3bwdD           -----------IDHAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVV-------------
1dekA           DEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFA-LDYLDKFNSGYDYYI
3ci2A           -------------------------------------------GKSVEEAKKVILQDKPEAQIIVLPVGT
3do6A           ----------------------------------------------------------------------
2e85A           CAAAPKGNWVVIDGGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDP-----DDIAEMFMMTTHN
2aumB           VDYHVEARYRYLAGTVEQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADI
3dkvA           ----------------------------------------------------------------------
3a00B           --------KTCILDIDMQGVKSVKAIPELNARFLFIAPPSGAHDKVIVN---DDLDKAYKELKDFIFAE-
1e2iB           PYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIALCYPAASMTPQAVLAFVALIPPTLPGTNIVLGALPE
1cjuC           ----------------------------------------------------------------------
2a5vA           ----------------------------------------------------------------------
3cqcA           HLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLL----HTILHSTGQ
1e2lB           -HIGGEAGSPPALTLIFDRHPIAALLCYPAARYLMG----SMTPQAVLAFVALIPPTLPGTNIVLGALPE
3bm2B           RFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKVPRWEQESAGCAVAQAAVAQGGIWRSGALTE
1e2lA           ALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNLPEDRHIDRLAKRQRPGERLDLA
3e70C           KPNLVIFVGDALA--------------------------------GNAIVEQARQFNEAVKIDGIILTKL
1dwmA           ------------------------------------------------MAAATVERENRNVHAIVLKEGS
3b9qA           ------------------------------------------------------------GITGLILTKL
3b85B           RTLNDAFVILDEAQNTTPAQKFLTRLGFGSKVVTGDSGLRLVRHILRGVDDVHFSELTSSVVRHQLVGHI
1e9sK           ----------------------------------------------------------------------
2e85B           CAAAPKGNWVVIDGGSAPENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDP-----DDIAEMFMMTTHN
2cdnA           MLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQ-LKTVDAVGT
1d2zD           ----------------------------------------------------------------------
1bccF           LNMRQQILPK---EQWTKYEEDVPYLEPYLKEV-------------------------------------
1e2nB           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRR
3cd9A           ----------------------------------------------------------------------
1d8jA           TLDEILDETQHLDIGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKY-------------------------
1cjvC           ----------------------------------------------------------------------
3c85A           EQLQ-------RRNYKGQIAAIAEYPD-QLEGLLESGVDAAFNIYSEAGS--------------------
3cddE           CKPFGIKVIVNTDVGEPFQHELLARLAKQRGVLLTSDT--------------------------------
2a5vB           ----------------------------------------------------------------------
3cddA           IKVIVNTDVGEIEQGETPHELLAR-LAKQRGVLLTSDTSKTKAGVSLILGDNVKAARGRFSWRQRFSKFT
1e2mA           --------GGEAGSPPALTLIFDRHPIAALLCYPAARYLMGMTPQAVLAFVALIPPTLPGTNIVLGALPE
1e2jB           ----------------------------------------------------------------------
2bwjB           ----------------------------------------------------------------------
3dmdA           ------------------------------------------------------------------LTKL
3dvlC           PDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVFQQYDASELFRLVARLKQIGATTVMTTER
1e2nA           AGSPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLAFVALPEDRHIDRLAKRQRPGERLDLAMLAAI
2c1lA           LLYDERTTNLTLDETERVTLIVTLGHADTARIQAAPGT---TAGQGTQYFWLSKYDFFPPLTIRNRRGTK
2a78A           ENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFDLMREI-------------
1e2kB           RHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAMLAAIR
2dx7A           ------------------IMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERECIIAGCTEV
1e2hA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLARQRPGERLDLAMLAAI
3cphA           -------LVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVG-
3cbqA           ----------------------------------------------------------------------
3cr8B           PEKREALKHEALS---LPSLDLDWQQQCELE-MLMTGAYSPLTGFRVESAQQLDDGSFWPSPITLTSRDR
1e1dA           ----------------------------QVNIGVGKNPGILISGHDLKDMAELLKQTEGTGVDVYTHLPA
2bwjD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLGTAA
3b60A           LSTIE-QADEIVVVEDGIIVERGTHSELLAQHGVYAQLHK---
2d3wB           RILDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWLT---
3b5jA           LS-TVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYL----
3cmvG           VKVVKN-KIAAPFKQAEFQILYGEGINFYGELV----------
3dmdC           DADARGGAALSISYVIDAPILFVGVGQGYDDLWFLERIFG---
2c61B           LPSLSRLMNSGIGAGKTREDHKAVSDQMY--------------
2dwpA           DDFMKRISCYEASY--QPLDPDKCDRDLSLIKV----------
2dwoA           DDFMKRISCYEASYQPLDPDKCDRDLSLIKVI-----------
3cmvH           VKVVPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKA-----
3eiuA           LPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY-----------
3cmvC           KIAAPFKQAEFQILYGEGINFYGELVDLGVKEKL---------
3c95A           -------------------------------------------
2ccgA           HEKVIEGYQEIIHNESQRFKADQPLENVVEDTQTIIKYL----
4dcgA           Y-----PNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQ---
2akaB           LDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQ----------
2bifA           EDFMRRIECYENSYESLD-------------------------
2b8wA           CFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNS
2c03B           DGDARGGAALSARHVTGKPIYFAGVSEKPEGLRLAGRILG---
3cmvA           GNALKFYASVRLDIRRIGAVKEGENVVGSETR-----------
2awnD           SRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNET
3eiuB           LPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY-----------
3dmdB           DADARGGAALSISYVIDAPILFVGVGQGYDDLRFLERIFG---
2b8tA           EFYSA--VCRHHHKVPNRPYLNSNSEEFIKFFK----------
1e69A           KIVME-AADLLHGV-----------------------------
2ccjB           IEGYQEIIQRFKSVNADQPLENV----VEDTYQTIIKYL----
3czpB           DKRF----ARVKVLR----------------------------
1bifA           EDFMRRIECYENSYESLDEEQDRDLSYIKIMDVGQSYV-----
2czvA           ISMYP---EIIL-------------------------------
3dm5A           DGSAKGGGALSAVAATGAPIKFIGTGEKIDDIRFVSRLLGLGD
2ccgB           QEIIHNESQRFKSVNADQPL-----ENVVEDTQTIIKYL----
3cmxA           KQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSY-----
1cr4A           GGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYM----
1e98A           HQLMKDTTLNWKMVDASKRIEAVHEEIRVLSEDAIRTATE---
2bbsA           KMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKL----
2d62A           QVEAT---GDRIAVNKGELQQVGTPDEVYYKP-----------
2dr3A           SPGVEHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHP
2bc9A           LKKGTSQKDETFNLPRLCIRKFFPKKKCFVFD-----------
3b2qB           LPSLSRLMNSGIGAGKTREDHKAVSDQMYAGY-----------
1e3aB           KWYSASGYETTQDGPTGSLNISVGAKILYEAV-----------
2b92B           KCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQ-----------
1d1cA           QMSIFKIIAGILHLGNIKFEKGAGEGAVLKDKTA---------
1e9cA           HQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI--------
2awnB           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPAD---------
2c03A           DGDARGGAALSARHVTGKPIYFAGVSEKPEGLRLAGRILG---
2c61A           ITHPI-PDLSGYITEGQIVVARELHRKGIYPP-----------
2a2zD           TNFDYLQEVPILTLDVNE-------------------------
1e9fA           HQLMKDTTLNWKMVDASKSIEAVHEDIRV--------------
3dhwC           MDVVKRICDCVAVISNGELIEQDTVSEVFSH------------
2ctsA           GSSIGAIDSKLDWSHNF--------------------------
2c9yA           LKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVF-----
2cgtH           ATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQD-----------
3c8uA           HDAAVARAQGNDLANARAIEAARLPADLT--------------
1e2dA           HQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATE---
1aroP           LACLTSADNTTVQAVASAIGRAIEDEARFGRI-----------
3bpbA           ESY----AANCIWVNERVIMPAGYPRTREKIARLGYRVIEVDT
2c04A           DGDARGGAALSARHVTGKPIYFAGVSEKPEGLELAGRILG---
2d3wA           QRLDYIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL----
2awoC           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPA----------
1e9sD           NEASKALTSARFVLSDKLPEHVTMPDGDFSIR-----------
1b0uA           MGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQSLQQFLK---
1e9sG           NEASKALTSARFVLSDKLPEHVTMPDGDFSIR-----------
2d4hB           NSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDL---------
2a30B           TNFDYLQEVPILTLDVNE-------------------------
3b85A           -------------------------------------------
3cmtD           KQAEFQILYGEGINFYGELVDLGVKEKLIEKA-----------
3b2qA           GDD-ITHPIPDLSGYIT--------------------------
2cckA           IEGYQEIIRFKSVNADQP-LEN-----VVEDTQTIIKYL----
1e9sF           NEASKALTSARFVLS----------------------------
2dr3E           SVGVEHGVDGIIRLDLDEIDGELKRSLIVWKM-----------
2a5gA           -------------------------------------------
1e0jB           KNPDKGKAHEEGRPVSITDLRGSGALRQLDTIIAL--------
1e9rA           LPEHVTMPDGD--------------------------------
2d2eA           RILNYIQPDKVHVMMDGRVVATGGPELALELEAKGYEWLK---
2awnC           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYP-----------
1e9dA           HQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI--------
2d4hA           CFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNS
2akaA           QMSIFKIIAGILHLGNIKFEKGAGEGAVLKDK-----------
1cr0A           LRALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYM----
2a30D           TNFDYLQEVPILTLDVNE-------------------------
1e3mA           FELTQLPEKEGVANVHLDALEHGDTIAFHSVQDGAAS------
1e9sJ           NEASKALTSARFVLSDKLPEHVTMPDGDFSIR-----------
2axpA           -------------------------------------------
2awoA           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPAD---------
2d3wD           QRILDYIPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL----
3d7wA           LELETSQSTQVQHSTDGVFNNPIALAIAPGVIVTL--------
2d2fA           RILNYIQPDKVHVMMDGRVVATGGPELALELEAKGYEWLK---
2d3wC           ILD-YIKPDYVHVLYQGRIVKSGDFTLVKQLEEQGYGWL----
3bo6B           EPFYRLMAE----------------------------------
3dt2A           WQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKYLA---
1dhjA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVS-----
3d3kA           PQQVFQEVGINYHSPFGCK------------------------
1bg0A           LKTVYKRLVTAVDNIESK-------------------------
2a2zB           TNFDYLQEVPILTLDVNEDFKD---------------------
3czpA           KR-----FARVKVL-----------------------------
3bb1F           RCNKNDSDEK--VLPNGIAWIPHLVQTITEVAL----------
1cr2A           SGALRQLSDTIIALERNNLVLVRILKCRFTGDTGIAGYM----
3cddD           FS-WRQRFSKFTIKDSAGLPTVG--------------------
3da4A           -------------------------------------------
3ch4B           EQRLEEQLENLIEFIRSR-------------------------
1e0jA           KNPDKGKAHEEGRPVSITDLRGSGLRQLSDTIIAL--------
2bbsB           KMEHLKKADKILILHEGSSYFYGTFSELQNLRDSFDQFSA---
2cjwB           DSKEKN-ERRLAYQKRKE-------------------------
1e9rE           NEASKALTSARFVLSDKLPEHVTMPDGDFSIR-----------
3a1wA           -------------------------------------------
2a30A           TNFDYLQEVPILTLDVNE-------------------------
2cckB           LENVVEDTYQTI-------------------------------
2d4uA           -------------------------------------------
3cmvE           VKNKIAAPFKQAEFQILYGEGINFYGELVDLG-----------
3cddF           IPQTGNINTLVPVIDEIGLDEELIASILFSEDD----------
2a2zA           YLEKLHYKHESWLLH--RTLKTNFDYLQEVPILTLDV------
3dt4A           WQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKY-----
2axzC           LQIYQFLTDKNIDSYLNAVNIINIFKIIGKED-----------
3bh0A           SRQVEQRQDKRPMLSDLRESGQL--------------------
1e4yA           EGKDDVTGEELTTRKDDQEETVRKRLVEYHQMPLIGYYSKEAE
2b8tC           QEFYSAVCRHHHKV-PNRPYLNSNSEEFIKFFK----------
2dr3B           SVGERGFGGPVEHGVDGIIRLDLDEIDGELKRSLIVW------
2bbtB           KMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLM---
3dt7A           WQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKYLA---
2awnA           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYP-----------
1e3mB           FELTQLPEKEGVANVHLDALEHGDTIAFHSVQDGAA-------
3d3qA           ETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQA------
1cr1A           SGALRQLSDTIIALERNQLVLVRILKCRFTGDGIAGY------
3dt4C           WQHGVFVGAAMAAEHKGKVIMHDPFAMRPFFGYNFGKYL----
2bx2L           LEAADEIARQLRLRDLGGLIVIDFIDMTPVRH-----------
3bb1B           CNSDEKVLPNGIAWIPHLVQTITEVALNKSESIFVD-------
2bjbA           LTNAVAFLSAAVVSG-GTVRITGWPRVSVQPADHILAIL----
2bdtA           -------------------------------------------
3cr7C           -------------------------------------------
3cddC           FS-WRQRFSKFTIKADSAGLPTVGGIKADVTDSEIGRYR----
2dflA           MHTLYHVPGIRIQLKKSRG--NRRIARVVDAP-----------
1ai4B           KWYSASGYETTQDGPTGSLNISVGAKILYEAV-----------
2bwjA           AEGTPEDVQLCTAID----------------------------
3cr7D           -------------------------------------------
3dtbB           WQHGV-FVGAAMRSEAKVIMHDPFAMRPFFG------------
3adkA           AEGSVDVFSQVC-------------------------------
1d6jB           -------------------------------------------
1e9rD           NEASKALTSARFVLSDKLPEHVTMPDGDFSIR-----------
2eg5G           LEMAI--------------------------------------
2d0kA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
2ausC           LHGDVPEDKIRAVMKEFEGEIIQRTRKVYYIEILEIDG-----
2a5jA           -------------------------------------------
2c7cH           ATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQD-----------
3bb1E           GRCNKN-DSDEKVLPNGIAWIPHLVQTITEVAL----------
1dg3A           CFVFDRPVHELDPEFVQQVADFCSYIFSNSKTKTL--------
421pA           -------------------------------------------
2b8wB           ETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQ-----
3bgwA           SRQVEQRQDKRPMLSDLRGQLEQDADIIEFLYR----------
2b8tB           QEFYSAVCRHH-HKVPNRPYLNSNSEEF---------------
2bhjA           VFPQRSDGKGYQMPDGTIRGDAATLEFTQLCIDLGW-------
1e59A           NSL-RALVKYLDNMSEEEILELNIPTGVPLVYE----------
3cmwC           FYASVRLDIRRIGAVKEG-------------------------
1e6cA           -------------------------------------------
1e2gA           HQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI--------
2dr3D           SVGERGFGGPGVHGVDGIIRLDLDEIDGELKRSLIVWKMRGTS
2a1fF           GNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSL-----
2bv7A           MYTRMNAELNYKV------------------------------
2awoD           SRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNE-
2a1fD           GNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFR---
3bb1C           RCNKNDSDEK--VLPNGIAWIPHLVQTITEVAL----------
1cfrA           VKTTFRPDRRLQLAHEGSLMKALYTRTWTINPTGIRYY-----
3d31A           QTEARIMADRIAVVMDGKLIQVGKPEEIFEK------------
1afrA           VEKLFEIDPDGTVLAFADMMRKKISMP----------------
1eilA           DEALM--QQRKVMGLLCLQDPFGLPLEIYYGP-----------
3bjdB           VDEAA-ALARYLYGELGEEDEKGSHPRLLAKL-----------
3d3qB           ETLYLRINKRVDILGHGLFNEVQHLVEQGFEASQSQAI-----
5dfrA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
3dffA           I---GEHPDHEATRDAALFATHEKNVPVRLWEDLPYAV-----
3bgwD           SRQVEQRQDKRPMLSDLRESGQL--------------------
2boeX           ISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARI--------
1e9sB           -------------------------------------------
2bkhA           HGDFIRMCTAMKKIGLDDEEKLDLFRVVAGV------------
1e9sH           PDGDFSIRSWL--------------------------------
2ck3C           SRLLERAAKMNDAFGGGSLTALPVIETQAGD------------
1dkiA           GKVG----GHAFVID-GADGRNFY-------------------
2bkiA           DDHGDFIRMCTAMKKIG--------------------------
2dr3C           SGV-EHGVDGIIRLDLDEIDGELKRSLIVWKMRGTSHSMRRHP
3cm0A           PDEVYARIRAAL-------------------------------
3be4A           VKFYEDLGILKRVNAKLP-------------------------
2dr3F           SPGVEHGVDGIIRLDLDEIDGELKRSLIVWKM-----------
3dymA           TYRIDGSGQMAITVDVEV-------------------------
1e9sL           PDGDFSIRSWLEDPNGGNLFITWREDMGPALRPLISAWVD---
1d6jA           -------------------------------------------
1draA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
1dhiA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
1bmfC           SRLLERAAKMNDAFGGGSLTALPVIETQAGDV-----------
1e2fA           HQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAI--------
1drbA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
2c9oC           LYTPQEMKQIIKIRAQTEG------------------------
3ecpA           VLLLEATTFRTVGLLHQEWWMRPDDPADADEKESGKWL-----
1e9rG           PDGDFSIRSWLEDPN----------------------------
2c4rL           RQLRLRDLGGLIVIDFIDMTPVRHQRAVENRLREAV-------
1av6A           AVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRT--
3cr7A           -------------------------------------------
2bbtA           M-EHLKKADKILILHEGSSYFYGTFSELQNLRP----------
3bb1A           GRCNKNDSDEK-VLPNGIAWIPHLVQTITEVAL----------
3dfpC           DRVNPCIGGVILFHETL--------------------------
1e9sM           -------------------------------------------
1bglA           TYRIDGSGQMAITVDVEV-------------------------
2dpyA           -------------------------------------------
2c0bL           LLIVIDFIDMTPVRHQRAVENRLREAVRQD-------------
1cjaA           L-RIFH-------------------------------------
2c9gA           -------------------------------------------
2a1fE           GNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSL-----
4atjA           KNQCRFIMDRLYNFS-NTGLPDPTLNTTYLQT-----------
3cioD           -------------------------------------------
1e1qB           --NVISITDGQIFLE--TELFY---------------------
3di4A           CH-----PLLVEIFAPAEGLGDWPSPSVN--------------
3cnlA           -------------------------------------------
1adoA           DRVNPCIGGVILFHETL--------------------------
3dfnC           DRVNPCIGGVILFHETLYQKADD--------------------
2dpyB           -------------------------------------------
2ahwD           IAQAVHNNGGIVMMQVQKMVKKATLHPKSVRI-----------
1ak2A           LEAYHTQTTPLVEYYSKRIDASQTPDVVFASI-----------
3dm9B           DADARGGAALSISYVIDAPILFVGVGQGYDDLWFLERIFG---
1e2hB           --VYGLLANTVRYLQCGGSWREDWGQLSGPQSNAG--------
3b55A           WDRALELDRYVLTGKGNP---SQHLTPVFKTK-----------
3bk7A           LAVLDYLSDVIHVVYGEPGVYGIFSKPK---------------
3clvA           -------------------------------------------
2drcA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
1cs4C           -------------------------------------------
3a00A           -------------------------------------------
3dfqA           DRVNPCIGGVILFHETLYQKADD--------------------
2cvfA           RFRPEGLMAYFRITERG--------------------------
3dauA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF-----
3c15C           -------------------------------------------
1e9sI           NEASKALTSARFVLSDKL-------------------------
1e9sE           -------------------------------------------
1dp0A           TYRIDGSGQMAITVDVEV-------------------------
1e9rF           -------------------------------------------
3dfnD           DRVNPCIGGVILFHETL--------------------------
3brwA           NKLPYTEGDAQQLQRKRHIGNDIV-AVVFQDEPFVPDMIA---
1cjtC           -------------------------------------------
3dfoD           DRVNPCIGGVILFHETLYQKADD--------------------
2cbzA           SMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLR---
3d1mA           DEDGHHSEES--LHYEGRAVDITTSDRDRSKYGMLARLAVEAG
3dfpD           DRVNPCIGGVILFHETLYQKADD--------------------
3cr7B           Y-----LPAK---------------------------------
2a1fC           GNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSL-----
3cbnA           VEYEG--------------------------------------
3cmvB           VKVVKNKIAAPFKQAEFQILYGEGINFYGELVD----------
2d7vA           -------------------------------------------
2bhvD           GMGINQVIAPIVVIREGSRVFISPNTDIFFPIEVIAEFL----
2bkeA           VPG---IRIQLKKSRGNRRIARVVDAPHLPEGEVVFALTE---
3dlbB           IGRRLGLGTPEAVRAQAYRLSIPKLMGRRAV------------
3bb1G           GR-CNKNDSDEKVLPNGIAWIPHLVQTITEVAL----------
2d7vB           -------------------------------------------
1accA           EGLKEVINDRYDMLNISSLRQDGK-------------------
3cmuA           -------------------------------------------
1akeA           SKEAEAGNTKYAKVDGTKPVAEVRAD-----------------
2aunB           SVLLSAFHRHGLPAIHGP-------------------------
3dfnA           DRVNPCIGGVILFHETLYQKADD--------------------
3dfqD           DRVNPCIGGVILFHETLYQKADD--------------------
3dftD           DRVNPCIGGVILFHETLYQKADD--------------------
2d4uB           -------------------------------------------
1culC           -------------------------------------------
1e2kA           RRVYGLLANTVRYLQCGGSWREDWGQSGTGPRPHIGDTLFTL-
3czjA           TYRIDGSGQMAITVDVEV-------------------------
2ahvA           -------------------------------------------
2aumA           S------VLLSAFHRHGLPAIHGPVATGLGLQERLAS------
3dftC           DRVNPCIGGVILFHETLYQKADD--------------------
3bczC           DESQGEIYRSIEHLDKGSIIEQLDPVSFSNYLKKYHNT-----
1aldA           DRVNPCIGGVILFHETLYQKADD--------------------
2b0lC           IVNALRKLESAGVIESRSLGMKGTYIKVLNNKFLIELE-----
2ancB           FDTALTDLKTIIRAERLRMSRQQRHDALISKL-----------
3dyoA           TYRIDGSGQMAITVDVEV-------------------------
2anbA           FDTALTDLKTIIRAERLRMSRQKQRHDALISKLL---------
2bofX           QARIYFDAGHSAWHMASWLQQADISNSAHGIATNTSNYRWTA-
2an9A           FDTALTDLKTIIRAERLRMSRQKQRHDALISKLL---------
1dvrA           LKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPP---------
3dfoC           DRVNPCIGGVILFHETL--------------------------
3ec1A           LSV-KERKTDIVFSGLGWVTCNDPGAQLVVAPKGVDVFI----
3d1mB           GWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAG
3dfqC           DRVNPCIGGVILFHETLYQKAD---------------------
1c9kC           IGVKI--------------------------------------
3dm5B           DGSAKGGGALSAVAATGAPIKFIGTGEKIDDIRFVSRLLGLGD
3crmA           YRQVWDYLDGKLSYAEMTERGIIATRQ----------------
2ccjA           IEGYQEIIHRFKSVNADQPLENVVEDTY----QTIIKYLE---
3c7kA           -------------------------------------------
2aunA           SVLLSAFHRHGLPAIHGPVATGLGLQE----------------
3dvlD           IEEYGPIARYGVFVSDNVVILRNVLEGERRRRTLE--------
2ancD           FDTALTDLKTIIRAERLRMSRQKQRHDA-----LISKLLA---
1dekB           RMYWVKLFALDYLDKFNSGYDYYIVPDTRQDH-----------
3cueF           -------------------------------------------
1eamA           KSDAVNYAKKMYYLNKIV-------------------------
2dftA           -------------------------------------------
6aldA           DRVNPCIGGVILFHETLYQKADD--------------------
2czvB           I------------------------------------------
3bjqB           AFRLKRNTKRIDFGYEGDPYSIVPSALEAKVP-----------
1e4vA           SKEAEAGNTKYAKVDGTKPVAEVRAD-----------------
2ancF           -------------------------------------------
1e9sA           -------------------------------------------
2bboA           KMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSF-
3bv4A           DRVNPCIGGVILFHETL--------------------------
4dfrA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYE-------------
1dyhA           YEQFLPKAQKLYLTHIDAEVEGDTHFPDYE-------------
1ckvA           -------------------------------------------
2c5mD           TDAIQEWVMRQALEPQVCVIELGTVGDIESMPEAFRQFQF---
3bb1D           ESIFVD-KNLI--------------------------------
2bhvA           GMGINQVVNQIVVIREGSRVFISPNTDPREN-EVIAEFL----
3e8aC           -------------------------------------------
1ek0A           -------------------------------------------
1e2iA           LQCGGSWREDWGQLSGTGPRPH---------------------
3bb1H           SLKKDSDIPVVLIENSGRCNKNDSDEKVLPNGIAWIPHL----
2b8tD           E-FYSAVCRHHHKVPNRPYLNSNSEEFIK-FFKN---------
1dw9A           -------------------------------------------
2aexA           ANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVH-----
1e9rB           -------------------------------------------
2dftC           -------------------------------------------
3cnnA           -------------------------------------------
1e2mB           VYGLLANTVRYL-------------------------------
2axnA           DDFMKRISCYEASYQPLDPDKCDRDLSLIKVI-----------
3ed8A           -------------------------------------------
1e2jA           RRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF----
1chdA           PGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIA-------
3dfdA           -------------------------------------------
3c14C           -------------------------------------------
1azsC           -------------------------------------------
3bwdD           -------------------------------------------
1dekA           VPDTRQDHEMDAARAMGATVIHVVRPGQKSND-----------
3ci2A           IVTMEYRIDRVRLFVDKLDNIAQVPR-----------------
3do6A           -------------------------------------------
2e85A           MPLNYLIDDIGEVIFLGIQPDIVGFYYPMTQP-----------
2aumB           SVLLSAFHRHGLPAIHGPVATGLGLEQQ---------------
3dkvA           -------------------------------------------
3a00B           -------------------------------------------
1e2iB           DRHIDRLAKR---------------------------------
1cjuC           -------------------------------------------
2a5vA           -------------------------------------------
3cqcA           YQECLQLADMVSSER-HKLYLVFSKEELR--------------
1e2lB           DRHIDRLAKRL--------------------------------
3bm2B           SPVV----REAFGCREQDKLYLGTPQLVPDPTPF---------
1e2lA           MRVYGLLANTVRYLQCGGSWREDWGQLSGPRP-----------
3e70C           DADARGGAALSISYVIDAPILFVGVGQGYDDLWFLERIFG---
1dwmA           AMTKDFRCDRVWVIVNDHGVVTSVPH-----------------
3b9qA           DGSARGGCVVSVVEELGIPVKFIGVGEAVEDLQPPEAFVN---
3b85B           VDAY---------------------------------------
1e9sK           -------------------------------------------
2e85B           MPLNQLKEDIGEVIFLGIQPDIVG-------------------
2cdnA           MDEVFARALRAL-------------------------------
1d2zD           -------------------------------------------
1bccF           -------------------------------------------
1e2nB           VYGLLA--NTVRYLQCGGSWREDWGQLSGPQSN----------
3cd9A           -------------------------------------------
1d8jA           -------------------------------------------
1cjvC           -------------------------------------------
3c85A           -------------------------------------------
3cddE           -------------------------------------------
2a5vB           -------------------------------------------
3cddA           IKAAADVTDSEIGRYRPLIIVNEEV------------------
1e2mA           DRHIDRLAKR---------------------------------
1e2jB           -------------------------------------------
2bwjB           -------------------------------------------
3dmdA           DADARGGAALSISYVIDAPILFVGVGQGYDDLRFLERIFG---
3dvlC           IEEYGPIAR----------------------------------
1e2nA           RRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDT------
2c1lA           ATYSSLINMNYIDINYTD-------------------------
2a78A           -------------------------------------------
1e2kB           RVYGLLA------------------------------------
2dx7A           SVVLKQDDLKVPLIDPMDVIAEVAVKVALE-------------
1e2hA           RRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF----
3cphA           -------------------------------------------
3cbqA           -------------------------------------------
3cr8B           ALADRRPGERLALRDG---------------------------
1e1dA           NYYPAFKKYPHFVGNYGG-------------------------
2bwjD           -------------------------------------------