[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE38782.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dubA.bssp"
#ERROR : Can't open dsspfile "2ej5A.bssp"
#ERROR : Can't open dsspfile "1ef8B.bssp"
#ERROR : Can't open dsspfile "2ej5B.bssp"
#ERROR : Can't open dsspfile "1ef9A.bssp"
#ERROR : Can't open dsspfile "1dciA.bssp"
#ERROR : Can't open dsspfile "2dubE.bssp"
#ERROR : Can't open dsspfile "1dubB.bssp"
#ERROR : Can't open dsspfile "2dubA.bssp"
#ERROR : Can't open dsspfile "2dubD.bssp"
#ERROR : Can't open dsspfile "1ef8C.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "2a7kC.bssp"
#ERROR : Can't open dsspfile "3bptA.bssp"
#ERROR : Can't open dsspfile "2a7kH.bssp"
#ERROR : Can't open dsspfile "2a7kB.bssp"
#ERROR : Can't open dsspfile "2a7kF.bssp"
#ERROR : Can't open dsspfile "2a81A.bssp"
#ERROR : Can't open dsspfile "2a7kG.bssp"
#ERROR : Can't open dsspfile "2a7kE.bssp"
#ERROR : Can't open dsspfile "2a7kD.bssp"
#ERROR : Can't open dsspfile "2a7kA.bssp"
#ERROR : Can't open dsspfile "2a7kI.bssp"
#ERROR : Can't open dsspfile "3bf0C.bssp"
#ERROR : Can't open dsspfile "3ejvA.bssp"
#ERROR : Can't open dsspfile "3bezD.bssp"
#ERROR : Can't open dsspfile "3bf0A.bssp"
#ERROR : Can't open dsspfile "3bf0D.bssp"
#ERROR : Can't open dsspfile "3bppA.bssp"
#ERROR : Can't open dsspfile "3bezC.bssp"
#ERROR : Can't open dsspfile "3bf0B.bssp"
#ERROR : Can't open dsspfile "2a7sA.bssp"
#ERROR : Can't open dsspfile "2bzrF.bssp"
#ERROR : Can't open dsspfile "2bzrC.bssp"
#ERROR : Can't open dsspfile "2bzrA.bssp"
#ERROR : Can't open dsspfile "2bzrB.bssp"
#ERROR : Can't open dsspfile "2deoB.bssp"
#ERROR : Can't open dsspfile "2deoA.bssp"
#ERROR : Can't open dsspfile "2cbyD.bssp"
#ERROR : Can't open dsspfile "2cbyA.bssp"
#ERROR : Can't open dsspfile "3bezA.bssp"
#ERROR : Can't open dsspfile "2bzrD.bssp"
#ERROR : Can't open dsspfile "2cbyG.bssp"
#ERROR : Can't open dsspfile "2c8tA.bssp"
#ERROR : Can't open dsspfile "2cbyB.bssp"

## Summary of PDB Search
:258
    9e-51  39%  1dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    8e-50  29%  2ej5A  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    9e-49  24%  1ef8B  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    8e-48  30%  2ej5B  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    8e-48  23%  1ef9A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    7e-47  25%  1dciA  [c.14.1] DIENOYL-COA ISOMERASE
    2e-46  39%  2dubE  [c.14.1] 2-ENOYL-COA HYDRATASE
    2e-45  39%  1dubB  [c.14.1] 2-ENOYL-COA HYDRATASE
    5e-45  39%  2dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    1e-44  39%  2dubD  [c.14.1] 2-ENOYL-COA HYDRATASE
    2e-44  24%  1ef8C  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    3e-44  24%  1ef8A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    7e-41  22%  2a7kC  [x.x.x] CARB
    3e-40  23%  3bptA  [x.x.x] 3-HYDROXYISOBUTYRYL-COA HYDROLASE
    3e-39  21%  2a7kH  [x.x.x] CARB
    9e-39  21%  2a7kB  [x.x.x] CARB
    3e-38  21%  2a7kF  [x.x.x] CARB
    3e-38  22%  2a81A  [x.x.x] CARB
    7e-38  21%  2a7kG  [x.x.x] CARB
    9e-38  22%  2a7kE  [x.x.x] CARB
    2e-37  21%  2a7kD  [x.x.x] CARB
    2e-36  21%  2a7kA  [x.x.x] CARB
    2e-36  21%  2a7kI  [x.x.x] CARB
    2e-31  11%  3bf0C  [x.x.x] PROTEASE 4
    2e-29  15%  3ejvA  [x.x.x] UNCHARACTERIZED PROTEIN WITH CYSTATIN-LIKE FOLD
    7e-29   8%  3bezD  [x.x.x] PROTEASE 4
    3e-27  13%  3bf0A  [x.x.x] PROTEASE 4
    4e-27  12%  3bf0D  [x.x.x] PROTEASE 4
    6e-26  17%  3bppA  [x.x.x] 1510-N MEMBRANE PROTEASE
    8e-25   8%  3bezC  [x.x.x] PROTEASE 4
    3e-24  16%  3bf0B  [x.x.x] PROTEASE 4
    2e-23  13%  2a7sA  [x.x.x] PROBABLE PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    3e-23  11%  2bzrF  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    5e-22  10%  2bzrC  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-21  11%  2bzrA  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    3e-21  10%  2bzrB  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    5e-21   9%  2deoB  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
    6e-21  15%  2deoA  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
    2e-20  15%  2cbyD  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    4e-19  15%  2cbyA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    5e-19   9%  3bezA  [x.x.x] PROTEASE 4
    5e-18  10%  2bzrD  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-16  16%  2cbyG  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    8e-12  21%  2c8tA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    4e-07  18%  2cbyB  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
:258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPENVIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
1dubA           ----TEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2ej5A           -----IRYEVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLDHG
1ef8B           MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSA------
2ej5B           MYET-IRYEVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLSDH
1ef9A           MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHE
1dciA           --ESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDM
2dubE           ----TEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
1dubB           --IITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2dubA           ----TEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2dubD           ----TEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
1ef8C           MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDLSY
1ef8A           MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHE
2a7kC           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
3bptA           -----VLLGKKGCTGVITLNRPKFLNALTLNIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVI
2a7kH           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a7kB           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a7kF           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a81A           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a7kG           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDEVK
2a7kE           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a7kD           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a7kA           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
2a7kI           ----MVFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNE
3bf0C           ----------------------------------------------------------------------
3ejvA           ----------------------------------------------------------------------
3bezD           ----------SRGALLLDISGVIVDKPDSQENSLFDIVNTIRQAKDDRNITGIVD---------------
3bf0A           DYALKTPADTGDSIGVVFANGADGEETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGG---------
3bf0D           ALKTPADTGDSIGVVFANGAIMDGEETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGG---------
3bppA           ----------------------------------------------------------------------
3bezC           ------------GALLLDISGVIV-DKPQENSLFDIVNTIRQAKDDRNITGIVDLKNF------------
3bf0B           ----------------------------------------------------------------------
2a7sA           ----------------------------------------------------------------------
2bzrF           -----FGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLP---------
2bzrC           -----FGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPG--------
2bzrA           ----------------------------------------------------------------------
2bzrB           ---------DGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGT-------
2deoB           -----------------IVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIE----------------
2deoA           ----------------------------------------------------------------------
2cbyD           ----------------------------------------------------------------------
2cbyA           ----------------------------------------------------------------------
3bezA           ----------------------------------------------------------------------
2bzrD           -----FGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLP---------
2cbyG           ----------------------------------------------------------------------
2c8tA           ----------------------------------------------------------------------
2cbyB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPG
1dubA           QNRTFQDCYSGKF-LSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2ej5A           DVLR-------SRYAPMMKALHHLEKPVVAAVNGAAAGAGMSLALACDFRLLSEKASFAPAFIHVGLVPD
1ef8B           -GHDIDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
2ej5B           GDVLRSRYA------PMMKALHHLEKPVVAAVNGAAAGAGMSLALACDFRLLSEKASFAPAFIHVGLVPD
1ef9A           LSGGRDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
1dciA           ASDILQPPGDDVAYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAAD
2dubE           QNRTFQDCY------SHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
1dubB           QNRTFQDCYSGKF-LSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2dubA           QNRTFQDCY------SHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2dubD           QNRTFQDCYSGKHWDH----ITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
1ef8C           DDPLR----------QITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
1ef8A           ----LDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
2a7kC           VKQLSRSEDIEEWIDRVYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
3bptA           SEAEKAKQKIAPVFFREEYLNNAVGKPYVALIHGIT-GGGVGLSVHGQFRVATEKCLF-APETAIGLFPD
2a7kH           VKQLSRSEDIEEWVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kB           VKQLSRSEDIEEWIDRVIDLYQAVLKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kF           VKQLSRSEDIEEWVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a81A           VKLSRSEDIEIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kG           QLSRSEDIEEIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kE           VKQLSRSEDIEEWIDRVIDLYQAVLKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kD           VKQLSEDIEEIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kA           VKQLRSEDIEEWIVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kI           VKQLRSEDIEIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
3bf0C           -------DQPSMQYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFA----TN
3ejvA           ------------------------------------------------------AAALFAPEATIEIVDA
3bezD           --LKNFAGGDPSQYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNGLYY
3bf0A           ------SVTASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANYIVANPSTLTGSI----GIFGV
3bf0D           ------SVTASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANYIVANPSTLTGSIGIF----GV
3bppA           -------------IVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQN
3bezC           -----AGGDQPSQYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNGLYY
3bf0B           ------SVTASEVIRAELAAARAAGKPVVVSMGGMAASGGYWISTPANYIVANPSTLTGSI----GIFGV
2a7sA           -------------GAKLLYAYGEATVPKITVITRKAYGGAYCVDMGCDVNLAWPTAQIAVASGAVGFVYR
2bzrF           -GTDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAY---CVMGSKDMGCDVNLAWPTAQIAVMGA
2bzrC           --TDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAY---CVMGSKDMGCDVNLAWPTAQIAVMGA
2bzrA           ------------RGAKLLYAYGEATVPKITVITRKAYGGA---YCVMGSKDMGCDVNLAWPTAQIAVMGA
2bzrB           ---DQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAY---CVMGSKDMGCDVNLAWPTAQIAVMGA
2deoB           ---LDTPGGRADANIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAAPGTSIGACRTNYFIAYI
2deoA           ----------DANIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLI-AAPGTSIGACRTNYFIAYI
2cbyD           ---------------AIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPIAIQAEQ
2cbyA           ---------------AIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPIAIQAEQ
3bezA           ------------QYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNGLYY
2bzrD           -GTDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCV---MGSKDMGCDVNLAWPTAQIAVMGA
2cbyG           ---------------AIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPIAIQAEQ
2c8tA           -----------------YDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKALPHARILMPLIAIQAEQF
2cbyB           ------SISAGMAI---YDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRY-ALPHARILMHQPIAIQ


                         +         .         .         .         .         *         .:210
query           AGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE
1dubA           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2ej5A           AGHLYYLPRLVGRAKALELAVLGEKVTAEEAAALGLATKVIPLSDWEEEVKQFAERLSAMPTKAIGLIKR
1ef8B           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
2ej5B           AGHLYYLPRLVGRAKALELAVLGEKVTAEEAAALGLATKVIPLSDWEEEVKQFAERLSAMPTKAIGLIKR
1ef9A           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
1dciA           VGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFPDKDMLNAAFALAADISSKSPVAVQGSKI
2dubE           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
1dubB           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2dubA           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2dubD           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
1ef8C           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
1ef8A           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
2a7kC           -VGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
3bptA           VGGGYFLPRLQGK-LGYFLALTGFRLKGRDVYRAGIATHFVDSEKLALEEDLLALKSPSKENIASVLENY
2a7kH           -VGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kB           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kF           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a81A           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kG           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kE           -VGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kD           -VGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kA           VGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kI           VG-AAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
3bf0C           GLYYKSLLDKLKVST--HVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYLNTVAANRQIPAEQ
3ejvA           VGGASRSISRLEGRDAIRVAVRQAPHGYRAWSQNVVNAPIIVIEGDHAVLDA----QFVFSILAAEVPDG
3bezD           KSKVSTHVFRVGTYKSAVEPFIRDDSPAAREADSRWIGELWQNYLN-TVAANRQIPAEQVFPGAQGLLEG
3bf0A           ITTVENSLDSIG--VHTDGVSTSPLADVSITRALPPEAQLMMQLSIENGYKRFITLVADARHSTPEQIDK
3bf0D           ITTVENSLDSIG--VHTDGVSTSPLADVSITRALPPEAQLMMQLSIENGYKRFITLVADARHSTPEQIDK
3bppA           GSIIEAPPAITNYFIAEEFITKDLSLTPEEALKYGVIEVVARDNELLKKSNGMKTKIPVNGRYVTLNFTN
3bezC           KSKVSTHVFRVGTYKSAVEPFIRDDSPAAREADSRWIGELWQNY-LNTVAANRQIPAEQVFPGAQGLLEG
3bf0B           ITTVENSLDSIG--VHTDGVSTSPLADVSITRALPPEAQLMMQLSIENGYKRFITLVADARHSTPEQIDK
2a7sA           QQLAEAAANGEDIDKRLQQEYEDTLVNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPPKKHG
2bzrF           SGAVGFVYRLRLQQEYEDT-----LVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGNVPL--
2bzrC           SGAVGFVYRRL----RLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGNVPL--
2bzrA           SGAVGFVYRQQIDRLRLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGNVPL--
2bzrB           SGAVGFVYLR------LQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGNVPL--
2deoB           KSLAQESGRNAT--IAEEFITKDLSLTPEEALKYGVIEVVARDNELLKKSNGKTKIPVNGRYVTLNFTNV
2deoA           KSLAQESGRNA--TIAEEFITKDLSLTPEEALKYGVIEVVARDNELLKKSNGKTKIPVNGRYVTLNFTNV
2cbyD           FAVIKKEMFRLPIERIEADSDRDRWFTAAEALEYGFVDHIITRAHV------------------------
2cbyA           FAVIKKEMFRLNIERIEADSDRDRWFTAAEALEYGFVDHIITR---------------------------
3bezA           KSKVSTHVFRVGTYKSAVEPFIRDDSPAAREADSRWIGELWQNEQVFPGAQGLLEGLTKTGGDTAKYALE
2bzrD           SGAVGFVYRQ--QRLRLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGNVPL--
2cbyG           FAVIKKEMFRLNAERIEADSDRDRWFTAAEALEYGFVDHII-----------------------------
2c8tA           AVIKKENAEFTGQPIERIEADSDRDFTAAEALEYGFVDHIIT----------------------------
2cbyB           AEQFAVIKKEMGQPIERIEADSDRDFTAAEALEYGFVDHIIT----------------------------


                         .         .         .         +         .         .         .:280
query           SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVHR
1dubA           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2ej5A           LLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLF---
1ef8B           ELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNF---
2ej5B           LLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLF---
1ef9A           ELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNF---
1dciA           NLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKS---
2dubE           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
1dubB           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2dubA           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2dubD           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
1ef8C           ELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNF---
1ef8A           ELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNF---
2a7kC           AVNKPFIHLLEQTRDASKAVHKAAFQARDA------------------
3bptA           HTESKID--RDKSFILEEHDKINSCFSANTVEEIIENLQQDGSSFALE
2a7kH           AVNKPFIHLLEQTRDASKAVHKA-------------------------
2a7kB           AVNKPFIHLLEQTRDASKA-----------------------------
2a7kF           AVNKPFIHLLEQTRDASK------------------------------
2a81A           AVNKPFIHLLEQTRDASKAVHKAAFQ----------------------
2a7kG           AVNKPFIHLLEQTRDASKA-----------------------------
2a7kE           AVNKPFIHLLEQTRDASKAVHKAAFQA---------------------
2a7kD           AVNKPFIHLLEQTRDASKA-----------------------------
2a7kA           AVNKPFIHLLEQTRDASKA-----------------------------
2a7kI           AVNKPFIHLLEQTRDASKA-----------------------------
3bf0C           VFPGAQGLLEGLTKTGGDTAKYALENKLVDALASSAEIEKALTKEFG-
3ejvA           GWPTGTFGAQGRIVPIEAGQYRLTLRTVADGWVISARIEHRLPAF---
3bezD           LTKTG-------------------------------------------
3bf0A           IAQGAKANGLVDSLGDFD------------------------------
3bf0D           IAQGHVWTGQD---AKANGLVDSLGDFDDA------------------
3bppA           VEVRYLAPSFKDKLISY-------------------------------
3bezC           LTKTGGDTAKYALENKL-------------------------------
3bf0B           IAQGAKANGLVDSLGDFD------------------------------
2a7sA           NV----------------------------------------------
2bzrF           ------------------------------------------------
2bzrC           ------------------------------------------------
2bzrA           ------------------------------------------------
2bzrB           ------------------------------------------------
2deoB           EVRYL-APSFKDKLI---------------------------------
2deoA           EVRYL-APSFKDKLISY-------------------------------
2cbyD           ------------------------------------------------
2cbyA           ------------------------------------------------
3bezA           NKLVDALASS--------------------------------------
2bzrD           ------------------------------------------------
2cbyG           ------------------------------------------------
2c8tA           ------------------------------------------------
2cbyB           ------------------------------------------------