[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39205.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3e8kG.bssp"
#ERROR : Can't open dsspfile "3e8kC.bssp"
#ERROR : Can't open dsspfile "3e8kB.bssp"
#ERROR : Can't open dsspfile "3e8kA.bssp"
#ERROR : Can't open dsspfile "3e8kE.bssp"
#ERROR : Can't open dsspfile "3e8kD.bssp"

## Summary of PDB Search
:431
    9e-34  16%  3e8kG  [x.x.x] MAJOR CAPSID PROTEIN
    2e-30  16%  3e8kC  [x.x.x] MAJOR CAPSID PROTEIN
    3e-30  16%  3e8kB  [x.x.x] MAJOR CAPSID PROTEIN
    4e-14  18%  3e8kA  [x.x.x] MAJOR CAPSID PROTEIN
    5e-14  18%  3e8kE  [x.x.x] MAJOR CAPSID PROTEIN
    9e-14  17%  3e8kD  [x.x.x] MAJOR CAPSID PROTEIN
:431

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e8kG           ----------------------------------------------------------------------
3e8kC           ----------------------------------------------------------------------
3e8kB           ----------------------------------------------------------------------
3e8kA           ----------------------------------------------------------------------
3e8kE           ----------------------------------------------------------------------
3e8kD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3e8kG           ----------------------------------------------------------------------
3e8kC           ----------------------------------------------------------------------
3e8kB           ----------------------------------------------------------------------
3e8kA           ----------------------------------------------------------------------
3e8kE           ----------------------------------------------------------------------
3e8kD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxPIRGLASVRQISGSVYKKPFMTAGPATGWVGEAAARPQTSSPTLDAL
3e8kG           ------------------------------LRRLTIRDLLAQGRTSSNALEYVREEVNAPGDSDITFSKQ
3e8kC           -------------------------------RRLTIRDLLAQGRTSSNALEYVREEVNAPGDSDITFSKQ
3e8kB           -----------------------TIRDLLAQGRTSSNAL--------EYVREEVFTNAPGDSD-ITFSKQ
3e8kA           ----------------------------------------------------------------------
3e8kE           ----------------------------------------------------------------------
3e8kD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SFPAMELYAMPXXXXXXXXXXXVNLDDWLTGEIDTVFAEQEGAAFVSGDGINKPKGFLAAPTVANAAWSW
3e8kG           TANVKTIAHWVQASRQVMDDAP-MLQSYINNRLMYGLALKEEGQLLNGDGTGDNLEGLNKVATAYDT---
3e8kC           TANVKTIAHWVQASRQVMDDAP-MLQSYINNRLMYGLALKEEGQLLNGDGTGDNLEGLNKVATAYDT---
3e8kB           TANVKTIAHWVQASRQVMDDA-PMLQSYINNRLMYGLALKEEGQLLNGDGTGDNLEGLNKVATAYDT---
3e8kA           ----------------------------------------------------------------------
3e8kE           ----------------------------------------------------------------------
3e8kD           --------------------------------------------------------------GTGDNLEG


                         .         *         .         .         .         .         +:350
query           GNLGFVATGAAGAFPASNPSDVLIDLMFALKPGYRQNASFVMNRRTQAAIRKFKDNNGVYLWQPPATASG
3e8kG           ----------SLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGP-QAFT
3e8kC           ----------SLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGP-QAFT
3e8kB           ----------SLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGP-QAFT
3e8kA           -----------------TRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGPQ-AFT
3e8kE           -----------------TRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGPQ-AFT
3e8kD           LNKVATAYDTSLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGPQ-AFT


                         .         .         .         .         *         .         .:420
query           RASLIGFPLADAEDMPDIAANSLAIAFGDFRRGYLIVDRQGVRVLRDPYSAKPYVLFYTTKRVGGGVQDF
3e8kG           SNIMWGLPVVPTKAQAA-----GTFTVGGFDMASQVFDRMDATVEVSREDRDNFLTILCEERLALAHYRP
3e8kC           SNIMWGLPVVPTKAQAA-----GTFTVGGFDMASQVFDRMDATVEVSREDRDNFLTILCEERLALAHYRP
3e8kB           SNIMWGLPVVPTKAQAA-----GTFTVGGFDMASQVFDRMDATVEVSREDRDNFLTILCEERLALAHYRP
3e8kA           SNIMWGLPVVPTKAQA-----AGTFTVGGFDMASQVFDRMDATVEVSREDRDNFLTILCEERLALAHYRP
3e8kE           SNIMWGLPVVPTKAQA-----AGTFTVGGFDMASQVFDRMDATVEVSREDRDNFLTILCEERLALAHYRP
3e8kD           SNIMWGLPVVPTKAQA-----AGTFTVGGFDMASQVFDRMDATVEVSREDRDNFLTILCEERLALAHYRP


                         .         .         +         .         .         .         .:490
query           DAIKLLKFxxx
3e8kG           TAIIKGTF---
3e8kC           TAIIKGTF---
3e8kB           TAIIKGTF---
3e8kA           TAIIKGTF---
3e8kE           TAIIKGTF---
3e8kD           TAIIKGTF---