[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39246.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ee1A.bssp"
#ERROR : Can't open dsspfile "2azoB.bssp"
#ERROR : Can't open dsspfile "1a1rB.bssp"
#ERROR : Can't open dsspfile "3ejxB.bssp"
#ERROR : Can't open dsspfile "3cs0A.bssp"
#ERROR : Can't open dsspfile "3ejxA.bssp"
#ERROR : Can't open dsspfile "2a4gA.bssp"
#ERROR : Can't open dsspfile "1befA.bssp"
#ERROR : Can't open dsspfile "2ehrA.bssp"
#ERROR : Can't open dsspfile "2cssA.bssp"
#ERROR : Can't open dsspfile "1a1rA.bssp"
#ERROR : Can't open dsspfile "2db5A.bssp"
#ERROR : Can't open dsspfile "3dj1B.bssp"
#ERROR : Can't open dsspfile "3dj1A.bssp"
#ERROR : Can't open dsspfile "3diwA.bssp"
#ERROR : Can't open dsspfile "2edzA.bssp"
#ERROR : Can't open dsspfile "3diwB.bssp"
#ERROR : Can't open dsspfile "3dj3A.bssp"
#ERROR : Can't open dsspfile "3dj3B.bssp"
#ERROR : Can't open dsspfile "2d8iA.bssp"
#ERROR : Can't open dsspfile "3dj3D.bssp"
#ERROR : Can't open dsspfile "3cc0B.bssp"
#ERROR : Can't open dsspfile "1csoE.bssp"
#ERROR : Can't open dsspfile "2edvA.bssp"
#ERROR : Can't open dsspfile "2egnA.bssp"
#ERROR : Can't open dsspfile "3cbxB.bssp"
#ERROR : Can't open dsspfile "2dlsA.bssp"
#ERROR : Can't open dsspfile "3cbyA.bssp"
#ERROR : Can't open dsspfile "3e17B.bssp"
#ERROR : Can't open dsspfile "2egkD.bssp"
#ERROR : Can't open dsspfile "2csjA.bssp"
#ERROR : Can't open dsspfile "3b8jA.bssp"
#ERROR : Can't open dsspfile "2dazA.bssp"
#ERROR : Can't open dsspfile "3cc0A.bssp"
#ERROR : Can't open dsspfile "1be9A.bssp"
#ERROR : Can't open dsspfile "2egkA.bssp"
#ERROR : Can't open dsspfile "1bfeA.bssp"
#ERROR : Can't open dsspfile "2cs5A.bssp"
#ERROR : Can't open dsspfile "2d90A.bssp"
#ERROR : Can't open dsspfile "2egkC.bssp"
#ERROR : Can't open dsspfile "2e7kA.bssp"
#ERROR : Can't open dsspfile "2eegA.bssp"
#ERROR : Can't open dsspfile "2bygA.bssp"
#ERROR : Can't open dsspfile "2eeiA.bssp"
#ERROR : Can't open dsspfile "2as9A.bssp"
#ERROR : Can't open dsspfile "3cyyB.bssp"
#ERROR : Can't open dsspfile "2dm8A.bssp"
#ERROR : Can't open dsspfile "3b76A.bssp"
#ERROR : Can't open dsspfile "2dluA.bssp"
#ERROR : Can't open dsspfile "1b8qA.bssp"
#ERROR : Can't open dsspfile "2ejyA.bssp"
#ERROR : Can't open dsspfile "2awwA.bssp"
#ERROR : Can't open dsspfile "3b76B.bssp"
#ERROR : Can't open dsspfile "2eehA.bssp"
#ERROR : Can't open dsspfile "2dmzA.bssp"
#ERROR : Can't open dsspfile "2egkB.bssp"
#ERROR : Can't open dsspfile "2djtA.bssp"
#ERROR : Can't open dsspfile "3cbyB.bssp"
#ERROR : Can't open dsspfile "2awuA.bssp"
#ERROR : Can't open dsspfile "2awxA.bssp"
#ERROR : Can't open dsspfile "3cc0C.bssp"
#ERROR : Can't open dsspfile "2awuB.bssp"
#ERROR : Can't open dsspfile "2eaqA.bssp"
#ERROR : Can't open dsspfile "2eejA.bssp"
#ERROR : Can't open dsspfile "3cbxA.bssp"
#ERROR : Can't open dsspfile "1agjA.bssp"
#ERROR : Can't open dsspfile "3e17A.bssp"
#ERROR : Can't open dsspfile "2egoA.bssp"
#ERROR : Can't open dsspfile "3e90B.bssp"
#ERROR : Can't open dsspfile "2egoB.bssp"
#ERROR : Can't open dsspfile "3cyyA.bssp"
#ERROR : Can't open dsspfile "3cbzA.bssp"
#ERROR : Can't open dsspfile "2bhgB.bssp"
#ERROR : Can't open dsspfile "2awwB.bssp"
#ERROR : Can't open dsspfile "2a4gC.bssp"
#ERROR : Can't open dsspfile "1d5gA.bssp"
#ERROR : Can't open dsspfile "2edpA.bssp"
#ERROR : Can't open dsspfile "2d92A.bssp"
#ERROR : Can't open dsspfile "2awxB.bssp"
#ERROR : Can't open dsspfile "2as9B.bssp"
#ERROR : Can't open dsspfile "3bpuA.bssp"
#ERROR : Can't open dsspfile "3e90D.bssp"
#ERROR : Can't open dsspfile "2dkrA.bssp"
#ERROR : Can't open dsspfile "2dc2A.bssp"
#ERROR : Can't open dsspfile "2ehrA.bssp"
#ERROR : Can't open dsspfile "2cssA.bssp"
#ERROR : Can't open dsspfile "2db5A.bssp"
#ERROR : Can't open dsspfile "3dj1B.bssp"
#ERROR : Can't open dsspfile "3dj1A.bssp"
#ERROR : Can't open dsspfile "3diwA.bssp"
#ERROR : Can't open dsspfile "2edzA.bssp"
#ERROR : Can't open dsspfile "3diwB.bssp"
#ERROR : Can't open dsspfile "3dj3A.bssp"
#ERROR : Can't open dsspfile "3dj3B.bssp"
#ERROR : Can't open dsspfile "2d8iA.bssp"
#ERROR : Can't open dsspfile "3dj3D.bssp"
#ERROR : Can't open dsspfile "3cc0B.bssp"
#ERROR : Can't open dsspfile "2egnA.bssp"
#ERROR : Can't open dsspfile "3cbxB.bssp"
#ERROR : Can't open dsspfile "2dlsA.bssp"
#ERROR : Can't open dsspfile "3cbyA.bssp"
#ERROR : Can't open dsspfile "3e17B.bssp"
#ERROR : Can't open dsspfile "2egkD.bssp"
#ERROR : Can't open dsspfile "2csjA.bssp"
#ERROR : Can't open dsspfile "2dazA.bssp"
#ERROR : Can't open dsspfile "3cc0A.bssp"
#ERROR : Can't open dsspfile "1be9A.bssp"
#ERROR : Can't open dsspfile "2egkA.bssp"
#ERROR : Can't open dsspfile "1bfeA.bssp"
#ERROR : Can't open dsspfile "2d90A.bssp"
#ERROR : Can't open dsspfile "2egkC.bssp"
#ERROR : Can't open dsspfile "2eegA.bssp"
#ERROR : Can't open dsspfile "2eeiA.bssp"
#ERROR : Can't open dsspfile "2awwA.bssp"
#ERROR : Can't open dsspfile "2eehA.bssp"
#ERROR : Can't open dsspfile "2dmzA.bssp"
#ERROR : Can't open dsspfile "2djtA.bssp"
#ERROR : Can't open dsspfile "3cbyB.bssp"
#ERROR : Can't open dsspfile "2eaqA.bssp"
#ERROR : Can't open dsspfile "2eejA.bssp"

## Summary of PDB Search
:526
    2e-34  12%  3ee1A  [x.x.x] EFFECTOR PROTEIN VIRA
    2e-29   9%  2azoB  [c.52.1] MUTH
    5e-25  20%  1a1rB  [b.47.1] NS3 PROTEIN
    6e-25  13%  3ejxB  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    5e-24  37%  3cs0A  [x.x.x] PROTEASE DO
    9e-24  13%  3ejxA  [x.x.x] DIAMINOPIMELATE EPIMERASE, CHLOROPLASTIC
    2e-22  18%  2a4gA  [x.x.x] NS3 PROTEASE/HELICASE
    7e-22  20%  1befA  [b.47.1] DENGUE VIRUS NS3 SERINE PROTEASE
    4e-19  17%  2ehrA  [x.x.x] INAD-LIKE PROTEIN
    6e-19  17%  2cssA  [x.x.x] REGULATING SYNAPTIC MEMBRANE EXOCYTOSIS PROTEIN
    3e-17  18%  1a1rA  [b.47.1] NS3 PROTEIN
    5e-17  17%  2db5A  [x.x.x] INAD-LIKE PROTEIN
    2e-16  20%  3dj1B  [x.x.x] TAX1-BINDING PROTEIN 3
    2e-15  23%  3dj1A  [x.x.x] TAX1-BINDING PROTEIN 3
    4e-15  25%  3diwA  [x.x.x] TAX1-BINDING PROTEIN 3
    2e-14  21%  2edzA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1
    2e-14  22%  3diwB  [x.x.x] TAX1-BINDING PROTEIN 3
    2e-14  25%  3dj3A  [x.x.x] TAX1-BINDING PROTEIN 3
    2e-13  24%  3dj3B  [x.x.x] TAX1-BINDING PROTEIN 3
    3e-13  11%  2d8iA  [x.x.x] T-CELL LYMPHOMA INVASION AND METASTASIS 1
    3e-13  24%  3dj3D  [x.x.x] TAX1-BINDING PROTEIN 3
    6e-13  10%  3cc0B  [x.x.x] DISHEVELLED-2
    1e-12  19%  1csoE  [b.47.1] PROTEINASE B
    2e-12  16%  2edvA  [x.x.x] FERM AND PDZ DOMAIN-CONTAINING PROTEIN 1
    2e-12  25%  2egnA  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    3e-12  20%  3cbxB  [x.x.x] DISHEVELLED-2
    4e-12  32%  2dlsA  [x.x.x] RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 11
    7e-12  20%  3cbyA  [x.x.x] DISHEVELLED-2
    7e-12  25%  3e17B  [x.x.x] TIGHT JUNCTION PROTEIN ZO-2
    9e-12  24%  2egkD  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    1e-11  18%  2csjA  [x.x.x] TJP2 PROTEIN
    1e-11  39%  3b8jA  [x.x.x] PROTEASE DEGS
    5e-11  12%  2dazA  [x.x.x] INAD-LIKE PROTEIN
    6e-11  22%  3cc0A  [x.x.x] DISHEVELLED-2
    1e-10  23%  1be9A  [b.36.1] PSD-95
    1e-10  24%  2egkA  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    2e-10  23%  1bfeA  [b.36.1] PSD-95
    3e-10  12%  2cs5A  [x.x.x] TYROSINE-PROTEIN PHOSPHATASE, NON-RECEPTOR TYPE
    4e-10  24%  2d90A  [x.x.x] PDZ DOMAIN CONTAINING PROTEIN 1
    4e-10  25%  2egkC  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    4e-10  20%  2e7kA  [x.x.x] MAGUK P55 SUBFAMILY MEMBER 2
    4e-10  18%  2eegA  [x.x.x] PDZ AND LIM DOMAIN PROTEIN 4
    5e-10  17%  2bygA  [x.x.x] CHANNEL ASSOCIATED PROTEIN OF SYNAPSE-110
    6e-10  24%  2eeiA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1
    7e-10  17%  2as9A  [x.x.x] SERINE PROTEASE
    2e-09  21%  3cyyB  [x.x.x] TIGHT JUNCTION PROTEIN ZO-1
    2e-09  21%  2dm8A  [x.x.x] INAD-LIKE PROTEIN
    3e-09  13%  3b76A  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE LNX
    3e-09  21%  2dluA  [x.x.x] INAD-LIKE PROTEIN
    4e-09  17%  1b8qA  [b.36.1] PROTEIN (NEURONAL NITRIC OXIDE SYNTHASE)
    4e-09  19%  2ejyA  [x.x.x] 55 KDA ERYTHROCYTE MEMBRANE PROTEIN
    4e-09  19%  2awwA  [x.x.x] SYNAPSE ASSOCIATED PROTEIN 97
    5e-09  10%  3b76B  [x.x.x] E3 UBIQUITIN-PROTEIN LIGASE LNX
    5e-09  23%  2eehA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 7
    7e-09  21%  2dmzA  [x.x.x] INAD-LIKE PROTEIN
    7e-09  27%  2egkB  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    1e-08  20%  2djtA  [x.x.x] UNNAMED PROTEIN PRODUCT
    1e-08  19%  3cbyB  [x.x.x] DISHEVELLED-2
    2e-08  20%  2awuA  [x.x.x] SYNAPSE-ASSOCIATED PROTEIN 97
    3e-08  18%  2awxA  [x.x.x] SYNAPSE ASSOCIATED PROTEIN 97
    4e-08  19%  3cc0C  [x.x.x] DISHEVELLED-2
    9e-08  18%  2awuB  [x.x.x] SYNAPSE-ASSOCIATED PROTEIN 97
    1e-07  20%  2eaqA  [x.x.x] LIM DOMAIN ONLY PROTEIN 7
    1e-07  34%  2eejA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1
    1e-07  20%  3cbxA  [x.x.x] DISHEVELLED-2
    1e-07  21%  1agjA  [b.47.1] EPIDERMOLYTIC TOXIN A
    1e-07  23%  3e17A  [x.x.x] TIGHT JUNCTION PROTEIN ZO-2
    2e-07  27%  2egoA  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    4e-07  16%  3e90B  [x.x.x] NS3 PROTEASE
    5e-07  27%  2egoB  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-
    6e-07  23%  3cyyA  [x.x.x] TIGHT JUNCTION PROTEIN ZO-1
    1e-06  20%  3cbzA  [x.x.x] DISHEVELLED-2
    1e-06  14%  2bhgB  [x.x.x] FOOT-AND-MOUTH DISEASE VIRUS 3C PROTEASE
    1e-06  21%  2awwB  [x.x.x] SYNAPSE ASSOCIATED PROTEIN 97
    3e-06  18%  2a4gC  [x.x.x] NS3 PROTEASE/HELICASE
    5e-06  27%  1d5gA  [b.36.1] HUMAN PHOSPHATASE HPTP1E
    5e-06  24%  2edpA  [x.x.x] SHROOM FAMILY MEMBER 4
    7e-06  15%  2d92A  [x.x.x] INAD-LIKE PROTEIN
    1e-05  18%  2awxB  [x.x.x] SYNAPSE ASSOCIATED PROTEIN 97
    2e-05  19%  2as9B  [x.x.x] SERINE PROTEASE
    3e-05  22%  3bpuA  [x.x.x] MEMBRANE-ASSOCIATED GUANYLATE KINASE, WW AND PDZ
    5e-05  10%  3e90D  [x.x.x] NS3 PROTEASE
    2e-04  25%  2dkrA  [x.x.x] LIN-7 HOMOLOG B
    3e-04  27%  2dc2A  [x.x.x] GOLGI ASSOCIATED PDZ AND COILED-COIL MOTIF
    6e-04  26%  2ehrA  [x.x.x] INAD-LIKE PROTEIN(query 437->516)
    3e-04  27%  2cssA  [x.x.x] REGULATING SYNAPTIC MEMBRANE EXOCYTOSIS PROTEIN(query 434->516)
    3e-05  25%  2db5A  [x.x.x] INAD-LIKE PROTEIN(query 436->526)
    1e-07  20%  3dj1B  [x.x.x] TAX1-BINDING PROTEIN 3(query 434->520)
    1e-06  20%  3dj1A  [x.x.x] TAX1-BINDING PROTEIN 3(query 432->522)
    2e-06  20%  3diwA  [x.x.x] TAX1-BINDING PROTEIN 3(query 434->513)
    3e-06  19%  2edzA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1(query 434->525)
    9e-06  20%  3diwB  [x.x.x] TAX1-BINDING PROTEIN 3(query 434->516)
    6e-06  20%  3dj3A  [x.x.x] TAX1-BINDING PROTEIN 3(query 434->508)
    9e-06  20%  3dj3B  [x.x.x] TAX1-BINDING PROTEIN 3(query 434->508)
    4e-05  19%  2d8iA  [x.x.x] T-CELL LYMPHOMA INVASION AND METASTASIS 1(query 436->523)
    9e-06  20%  3dj3D  [x.x.x] TAX1-BINDING PROTEIN 3(query 434->508)
    3e-04  16%  3cc0B  [x.x.x] DISHEVELLED-2(query 437->520)
    2e-05  22%  2egnA  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-(query 450->508)
    7e-05  24%  3cbxB  [x.x.x] DISHEVELLED-2(query 450->516)
    4e-05  32%  2dlsA  [x.x.x] RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 11(query 450->515)
    9e-04  21%  3cbyA  [x.x.x] DISHEVELLED-2(query 450->525)
    1e-04  18%  3e17B  [x.x.x] TIGHT JUNCTION PROTEIN ZO-2(query 436->508)
    1e-04  23%  2egkD  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-(query 450->513)
    3e-05  19%  2csjA  [x.x.x] TJP2 PROTEIN(query 436->526)
    8e-04  19%  2dazA  [x.x.x] INAD-LIKE PROTEIN(query 436->526)
    2e-04  19%  3cc0A  [x.x.x] DISHEVELLED-2(query 436->524)
    1e-04  20%  1be9A  [b.36.1] PSD-95(query 446->526)
    8e-05  21%  2egkA  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-(query 436->508)
    7e-05  20%  1bfeA  [b.36.1] PSD-95(query 446->526)
    2e-05  21%  2d90A  [x.x.x] PDZ DOMAIN CONTAINING PROTEIN 1(query 436->526)
    6e-05  19%  2egkC  [x.x.x] GENERAL RECEPTOR FOR PHOSPHOINOSITIDES 1-(query 432->508)
    3e-05  13%  2eegA  [x.x.x] PDZ AND LIM DOMAIN PROTEIN 4(query 436->508)
    2e-04  23%  2eeiA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1(query 446->524)
    6e-04  17%  2awwA  [x.x.x] SYNAPSE ASSOCIATED PROTEIN 97(query 436->511)
    5e-05  28%  2eehA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 7(query 436->508)
    7e-04  19%  2dmzA  [x.x.x] INAD-LIKE PROTEIN(query 432->508)
    1e-04  15%  2djtA  [x.x.x] UNNAMED PROTEIN PRODUCT(query 450->516)
    4e-05  20%  3cbyB  [x.x.x] DISHEVELLED-2(query 445->520)
    2e-05  20%  2eaqA  [x.x.x] LIM DOMAIN ONLY PROTEIN 7(query 436->513)
    6e-05  24%  2eejA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1(query 436->508)
:526

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ee1A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1rB           ----------------------------------------------------------------------
3ejxB           ----------------------------------------------------------------------
3cs0A           ----------------------------------------------------------------------
3ejxA           ----------------------------------------------------------------------
2a4gA           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
1a1rA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
1csoE           ----------------------------------------------------------------------
2edvA           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
3b8jA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2cs5A           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2e7kA           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2bygA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2as9A           ----------------------------------------------------------------------
3cyyB           ----------------------------------------------------------------------
2dm8A           ----------------------------------------------------------------------
3b76A           ----------------------------------------------------------------------
2dluA           ----------------------------------------------------------------------
1b8qA           ----------------------------------------------------------------------
2ejyA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
3b76B           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2egkB           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2awuA           ----------------------------------------------------------------------
2awxA           ----------------------------------------------------------------------
3cc0C           ----------------------------------------------------------------------
2awuB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
3cbxA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
3e17A           ----------------------------------------------------------------------
2egoA           ----------------------------------------------------------------------
3e90B           ----------------------------------------------------------------------
2egoB           ----------------------------------------------------------------------
3cyyA           ----------------------------------------------------------------------
3cbzA           ----------------------------------------------------------------------
2bhgB           ----------------------------------------------------------------------
2awwB           ----------------------------------------------------------------------
2a4gC           ----------------------------------------------------------------------
1d5gA           ----------------------------------------------------------------------
2edpA           ----------------------------------------------------------------------
2d92A           ----------------------------------------------------------------------
2awxB           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
3bpuA           ----------------------------------------------------------------------
3e90D           ----------------------------------------------------------------------
2dkrA           ----------------------------------------------------------------------
2dc2A           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3ee1A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1rB           ----------------------------------------------------------------------
3ejxB           ----------------------------------------------------------------------
3cs0A           ----------------------------------------------------------------------
3ejxA           ----------------------------------------------------------------------
2a4gA           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
1a1rA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
1csoE           ----------------------------------------------------------------------
2edvA           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
3b8jA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2cs5A           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2e7kA           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2bygA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2as9A           ----------------------------------------------------------------------
3cyyB           ----------------------------------------------------------------------
2dm8A           ----------------------------------------------------------------------
3b76A           ----------------------------------------------------------------------
2dluA           ----------------------------------------------------------------------
1b8qA           ----------------------------------------------------------------------
2ejyA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
3b76B           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2egkB           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2awuA           ----------------------------------------------------------------------
2awxA           ----------------------------------------------------------------------
3cc0C           ----------------------------------------------------------------------
2awuB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
3cbxA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
3e17A           ----------------------------------------------------------------------
2egoA           ----------------------------------------------------------------------
3e90B           ----------------------------------------------------------------------
2egoB           ----------------------------------------------------------------------
3cyyA           ----------------------------------------------------------------------
3cbzA           ----------------------------------------------------------------------
2bhgB           ----------------------------------------------------------------------
2awwB           ----------------------------------------------------------------------
2a4gC           ----------------------------------------------------------------------
1d5gA           ----------------------------------------------------------------------
2edpA           ----------------------------------------------------------------------
2d92A           ----------------------------------------------------------------------
2awxB           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
3bpuA           ----------------------------------------------------------------------
3e90D           ----------------------------------------------------------------------
2dkrA           ----------------------------------------------------------------------
2dc2A           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTDFPFAKLSEGK
3ee1A           -----QQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQISENIENRLNFP----EN
2azoB           -----ELAALVGLVTPENLKRDKGWIG----VLLEIWLGASAGSKPEQDFAALGVELKTIPVDSLGRPLE
1a1rB           -----LATCINGVCWTVYHGAGTRTIAS----PKGPVIQMYTNVD--QDLVGWPAPQGSR------SLTP
3ejxB           ----------------------------------------------------------------------
3cs0A           ----------KGYVVTNNHVVDNATVIKVQLSDGRKFDAKV-GKDPRSDIALIQIQNPKNLTAIKADSDA
3ejxA           ----------------------------------------------------------------------
2a4gA           -----LATCINGVCWTVYHGAGTR----TIASPKGPVIQMYTNVD--QDLVGWPAPQGSRSL------TP
1befA           ----------EGTFHTMWHVTRGAVLM----HKGKRIEP--SWADVKKDLVSCGGGWKL--------EGE
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
1a1rA           -----LATCINGVCWTVYHGAGTRT---------------------------IASPKG------PVIQMY
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
1csoE           -----VRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIP-KDGTVGGQ
2edvA           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
3b8jA           -----VIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARV
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2cs5A           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2e7kA           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2bygA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2as9A           ------FVIGKNTIITNKHVSKDYKVGDRITAHPNGKIKSISDYPGDEDISVMNIEEQAVEGPKGFNFNE
3cyyB           ----------------------------------------------------------------------
2dm8A           ----------------------------------------------------------------------
3b76A           ----------------------------------------------------------------------
2dluA           ----------------------------------------------------------------------
1b8qA           ----------------------------------------------------------------------
2ejyA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
3b76B           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2egkB           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2awuA           ----------------------------------------------------------------------
2awxA           ----------------------------------------------------------------------
3cc0C           ----------------------------------------------------------------------
2awuB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
3cbxA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
3e17A           ----------------------------------------------------------------------
2egoA           ----------------------------------------------------------------------
3e90B           ------GVMVEGVFHTLWHTTKGA------ALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKW-------
2egoB           ----------------------------------------------------------------------
3cyyA           ----------------------------------------------------------------------
3cbzA           ----------------------------------------------------------------------
2bhgB           -----TGVFGTAY-LVPRHLFAEKYDK---ILDGRATDSDYRVFEFELSDAALVLHRGNKVRDITKHFRD
2awwB           ----------------------------------------------------------------------
2a4gC           ------------------------------------------------INGVCWTVYHGAGTRTIASPKG
1d5gA           ----------------------------------------------------------------------
2edpA           ----------------------------------------------------------------------
2d92A           ----------------------------------------------------------------------
2awxB           ----------------------------------------------------------------------
2as9B           ------FVIGKNTIITNKHVSKDYKVGDRKGNGGIYKIKSISDYPGDEDISVMNIENFNENVQAFNFAKD
3bpuA           ----------------------------------------------------------------------
3e90D           -------VMVEGVFHTLWHTTK----GAALMSGEGRLDPYWGSVKEDRLCYGGPWKLQHKWNGQDEVQMI
2dkrA           ----------------------------------------------------------------------
2dc2A           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAI
3ee1A           NCGHIIKINAVVPGRA-YEVSSSILPSHITCNGV--GINKIETSYLVHAGTLPS--------SEGLRNAI
2azoB           TTFVCVAPLTGNSGVTWETSHVRHKLKRVLWIPIPLAQRRVGSPLLWSPNEEEDRQLREDWEELMDMIVL
1a1rB           CTCGSSDLYLVTR-------HADVIPVRRRGDSRGSL--LSPRPISYLKGSSGGPLLCPTGHAVGLFRAA
3ejxB           --------------------------------------HFVKYHG---LGNDFILVDNRDSSEPKITQEQ
3cs0A           LRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNANYENFIQTDAAINRGNSGGALVNLNGELIGINTAI
3ejxA           --------------------------------------HFVKYHG---LGNDFILVDNRDSSEPKITQEQ
2a4gA           CTCGSSDLYLVTRHA-------DVIPVRRRGDSRGSL--LSPRPISYLKGSSGGPLLCPAGHAVGLFRAA
1befA           WKEGEEVVLALEPGKNPRAVKPGLFKTNAGT--------IGAVSLDFSPGTSGSPIIDKKGKVVGIYGNG
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
1a1rA           TNVDQDLVGWPAPQGSRTPCTCGSSDLYLVTRHADVIPVLSPRPISYLKGSSGGPLLCPTGHAVGLFRAA
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
1csoE           DITSAANATVGMAVTRRGSTTSGSVTALNATVNYGGVYGMIRTNVCAEPGDSGGPLYSGTRAI-GL-TSG
2edvA           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
3b8jA           PHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNN----FLATDASINHGNSGGALVNSLGELMGINTLS
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2cs5A           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2e7kA           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2bygA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2as9A           NQAFNFIKVIGYPLPAQNSFKQFESTGTIKRI----KDNILNFDAYIEPGNSGSPVLNSNNEVIGVVYGG
3cyyB           ----------------------------------------------------------------------
2dm8A           ----------------------------------------------------------------------
3b76A           ----------------------------------------------------------------------
2dluA           ----------------------------------------------------------------------
1b8qA           ----------------------------------------------------------------------
2ejyA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
3b76B           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2egkB           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2awuA           ----------------------------------------------------------------------
2awxA           ----------------------------------------------------------------------
3cc0C           ----------------------------------------------------------------------
2awuB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
3cbxA           ----------------------------------------------------------------------
1agjA           LKDGDKLELIGYPFDHKVNQMHRS------EIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSK
3e17A           ----------------------------------------------------------------------
2egoA           ----------------------------------------------------------------------
3e90B           -NGQDEVQMIVVEPGKNVKNVRTKPGV-----FKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNI
2egoB           ----------------------------------------------------------------------
3cyyA           ----------------------------------------------------------------------
3cbzA           ----------------------------------------------------------------------
2bhgB           TARGTPVVGVVNNADVGRLIFSGEALTYKDI-----VPGLFAYKAATRAGYAGGAVLAKDTFIVGTH---
2awwB           ----------------------------------------------------------------------
2a4gC           PNVDQDLVGWPAPQGSLTPCTCGSSDLYLVTRHADVIPVRRRGDISYLKGSSGGPLLCPAGHAVGLFRAA
1d5gA           ----------------------------------------------------------------------
2edpA           ----------------------------------------------------------------------
2d92A           ----------------------------------------------------------------------
2awxB           ----------------------------------------------------------------------
2as9B           AKVDDKIKVIGYPLPASFKQFESTGTIKRIKDN------ILNFDAYIEPGNSGSPVLNSNNEVIGVVYGY
3bpuA           ----------------------------------------------------------------------
3e90D           VVEPGKNVKNVRTKPGVFKTPEGE------IGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYI
2dkrA           ----------------------------------------------------------------------
2dc2A           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGP
3ee1A           P---PESRQVSFAIIS------------------------------------------------------
2azoB           GQVERITARHYLQIRPKAAN-AKALTEAIGARGERILTLPRKNFTSALLARHFLIQ--------------
1a1rB           VCTRGVAKAVDF-IPVENLETTMR----------------------------------------------
3ejxB           AAFGVGADGVIFAMPGVNGTDYAMRIFNSDGSEPEMCGNGVRCFARFIAE---LENLQGKHSFTIHTGAG
3cs0A           LAPDGGNIGIGFAIPSNVKNLTSQVEYGQVKRGELGIGTELNSELAKA----KVDAQRGAFVSQVLPNSS
3ejxA           AAFGVGADGVIFAMPGVNGTDYAMRIFNSDGSEPEMCGNGVRCFARFIAELEN---LQGKHSFTIHTGAG
2a4gA           VCTRGVAKAVDF-IPVENLETTMR----------------------------------------------
1befA           VV-TRSGAYVSAIAQTEKSIEDNPEIED------------------------------------------
2ehrA           --------GSSGSSGPNFSHWGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSP
2cssA           ---SSGSSGVTWQPSKEGDRLIGRVILNKRT--TMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSL
1a1rA           VCTRGVAKAVDF-IPVENLETTMR----------------------------------------------
2db5A           -GSSGLGNEDFNSVIQQMAQGRQIEYIDIERPSTGGLGFSVVALRS------QNLGKVDIFVKDVQPGSV
3dj1B           ------------------------EIHKLRQGENLILGFSIGGGIDQDPSQNPFS-DKGIYVTRVSEGGP
3dj1A           ---------------TAVVQRVEIHKLRQGE--NLILGFSIGGQDPSQNPFSEDKTDKGIYVTRVSEGGP
3diwA           --------------PVTAVVQRVE-IHKLRQGENLILGFSIGGQDPSQNPFSEDKTDKGIYVTRVSEGGP
2edzA           -----------SSGSSGMASTFNPRECKLSKQEGQNYGFFLR----------IEKDTDGHLIRVIEEGSP
3diwB           ------------------------EIHKLRQGENLILGFSIGGGIDSQNPFSEDKTDKGIYVTRVSEGGP
3dj3A           ------------------------EIHKLRQGENLILGFSIGGQDPSQNPFSEDKTDKGIYVTRVSEGGP
3dj3B           ------------------------EIHKLRQGENLILGFSIGGQDPSQNPFSEDKTDKGIYVTRVSEGGP
2d8iA           ---------------------ICPKVTQSIHIEKSDTAADTYGFSLSSVEEDG---IRRLYVNSVKETGL
3dj3D           -----------------------VEIHKLRQGENLILGFSIGGGIPSQNPFSEDKTDKGIYVTRVSEGGP
3cc0B           ----------------------------HMNIITVTLNMEKYFLGISIVGQSNERGDGGIYIGSIMKGGA
1csoE           GSGNCSSGGTTFFQPVTEALVAYGV---------------------------------------------
2edvA           -----------------------------GSSGSSGVRHTVKIDKDTLLQDYGFSESLPLTVVAVTA-GG
2egnA           --------------------------------------RKVLTLEKGDNQTFGIQTYGVTFVARVHESSP
3cbxB           -----------------------------------HMNIITVTLNMEKYNFLGISQSGGIYIGSIMKGGA
2dlsA           --------------------------------SSGSSGVQRCVIIQKDQHGFGVSGDRIVLVQSVRPGGA
3cbyA           -----------------------------------HMNIITVTLNMEKYNFLGIVGQGGIYIGSIMKGGA
3e17B           ------------------------------------IGVLLMKSRAN--EEYGLRLGSQIFVKEMTRTGL
2egkD           ---------------------------------------KVLTLEKGDNQTFGIQTYGVTFVARVHESSP
2csjA           ----GSSGSSGMEEVIWEQYTVTLQKDS-----KRGFGIAVSGGRDNPHFENG---ETSIVISDVLPGGP
3b8jA           GIGFAI--------PFQLATKIMDKLIRDG----------------------------------------
2dazA           DAFTDQKIRQRYADLPGELHIIELEK------DKNGLGLSLAGNKDR--------SRMSIFVVGINPEGP
3cc0A           ------------------------------------MNIITVTLNMEKYNFLGIRGDGGIYIGSIMKGGA
1be9A           ---------------------------------------------------IGGEDGEGIFISFILAGGP
2egkA           ---------------------------------------KVLTLEKGDNQTFGFEYGLVTFVARVHESSP
1bfeA           ---------------------------------------------------IGGEDGEGIFISFILAGGP
2cs5A           -----------------------------------HDNLVLIRMKPDENGRFGFNQKMPVIVSRVAPGTP
2d90A           ----------------------------------------------------AGPEQKGQIIKDIEPGSP
2egkC           -----------------------RKVLTLEKGDNQTFGFEIQT---------YGLHVEVTFVARVHESSP
2e7kA           -----------------------------------GSSGRMVGIRKTAGEHLGVTFRVELVIARILHGGM
2eegA           -------------------------------RGPSPWGFRLV---------GGRDFSAPLTISRVHAGSK
2bygA           --------------------------------GPKGLGFSIAG----GVGNQHIPGDNSIYVTKIIDGGA
2eeiA           ----------------------------------------------------TVQGKKGVYMTDITPQGV
2as9A           IGKIGS--EYNGAVYFTPIKDFIQKHIEQ-----------------------------------------
3cyyB           --------------------------------------TKVTLVKSAKNEEYGLRLASHIFVKEISQDSL
2dm8A           --------------------------------GRSGLGLSIVGGKDT--------PLNAIVIHEVYEEGA
3b76A           -----------LYFQSMHEKVVNIQ-----KDPGESLGMTVAGGASHREW------DLPIYVISVEPGGV
2dluA           --------------------------------------VELINDGSGLGFGIVGGKTSGVVVRTIVPGGL
1b8qA           -----------SHMIEPNVISVRLFKRK-----VGGLGFLVK----------ERVSKPPVIISDLIRGGA
2ejyA           --------------------------------------VRLIQFEKVTEEPMGICEKQSCTVARILHGGM
2awwA           --------------------------------GPKGLGFSIAG----GVGNQHIPGDNSIYVTSIVEGGA
3b76B           ----------------LYFQSMHEKVVNIQKDPGESLGMTVAGGASH------REWDLPIYVISVEPGGV
2eehA           --------------------------------PAGRLGFSVRG---------GSEHGLGIFVSKVEEGSS
2dmzA           -------------------------------KDGQSLGIRIV----GYVGTSHTGEASGIYVKSVIPGSA
2egkB           -----------------------RKVLTLEKGDNQTFGFEIQ--------TYGLHHVEVTFVARVHESSP
2djtA           -----------------------------------------------------VAGDTPLAVRGLLKDGP
3cbyB           -------------------------------------------LNMEKYNFLGISSDGGIYIGSIMKGGA
2awuA           -------------------------------------GFSIAG----GVGNQHIPGDNSIYVTKIIEGGA
2awxA           --------------------------------GPKGLGFSIAG----GVGNQHIPGDNSIYVTKIIEGGA
3cc0C           ----------------------------------------------SIVGQSNERGDGGIYIGSIMKGGA
2awuB           -----------------------------IKLIKGPKGLGFSIA--GGVGNQHIPGDNSIYVTKIIEGGA
2eaqA           -------------------------------------------INQTPGKSLDFWDIPGIFVASVEAGSP
2eejA           ----------------------------------------------------AIRGLPGSFIKEVQKGGP
3cbxA           ----------------------------------------------SIVGQSNERGDGGIYIGSIMKGGA
1agjA           VSHLDREHQINYGVGIGNY--VKRIINEKN----------------------------------------
3e17A           ------------------------------------IGVLLMKSRAN--EEYGLRLGSQIFVKEMTRTGL
2egoA           -----------------------------EKGDNQTFGFEIQT---------YGLVEMVTFVARVHESSP
3e90B           MPNGSYISAIVQGKRMDEP---------------------------------------------------
2egoB           -------------------------------GDNQTFGFEIQTYG-------LHHVEMVTFVARVHESSP
3cyyA           --------------------------------------TKVTLVKSAKNEEYGLRLASHIFVKEISQDSL
3cbzA           ------------------------------------MNIITVTLNMEKYNFLGISGDGGIYIGSIMKGGA
2bhgB           ---SAGGNGVGYCSCVSRSL--------------------------------------------------
2awwB           -------------------------------------GFSIA----GGVGNQHIPGDNSIYVTSIVEGGA
2a4gC           VCTRGVAKAV-DFIPVENLETTM-----------------------------------------------
1d5gA           -------------------------------------------------------RHGGIYVKAVIPQGA
2edpA           --------------------------------GGAPWGFTLKG---------GLEHCEPLTVSKIEDGGK
2d92A           -------------------------------------------FSILDYQDPLDPTRSVIVIRSLVADGV
2awxB           --------------------------------GPKGLGFSIAG----GVGNQHIPGDNSIYVTKIIEGGA
2as9B           N-------GAVYFTP--QIKDFIQKHIE-------QHH--------------------------------
3bpuA           ----------------------------------------------------------GQRVKQIVDRSR
3e90D           ---SAIVQGKRMDEP-------------------------------------------------------
2dkrA           ----------------------------------------------------------PIYISRVIPGGV
2dc2A           ----------------------------------------------------------PILISEIHPGQP
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKAGIESGDVITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVXXX
3ee1A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1rB           ----------------------------------------------------------------------
3ejxB           LIVPEIQDDGQVKVDMGTPILKAQDVPTKLSGNKGEAVVEAELVVDGVSWNVTCVSMGNP---HCITFGK
3cs0A           AAKAGIKAGDVITSLNGKPISSFAALRA-QVGTPVGSKLTLGLLRDGKQVNVNLELQQSSNQVDSS----
3ejxA           LIVPEIQDDGQVKVDMGTPILKAQDVPTKLSGNKGEAVVEAELVVDGVSWNVTCVSMGNP---HCITFGK
2a4gA           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
2ehrA           AGKTNALTGDKILEVSGVDLQNASHSEAVEAIKNAGNPVVFIVQSLSSTPRV------------------
2cssA           ADVVGLRAGDEVLEWNGKPLPGATEVYNIILESKSEPQVEIIVSRPS-----------------------
1a1rA           ----------------------------------------------------------------------
2db5A           ADRDQRKENDQILAINHTPLDQNISHQQAIALLQTTGSLRLIVAREPVHTKSSTSGP-------------
3dj1B           AEIAGLQIGDKIMQVNGWDMTMVTDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSM--------------
3dj1A           AEIAGLQIGDKIMQVNGWDMTMVTDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSM--------------
3diwA           AEIAGLQIGDKIMQVNGWDMTMVHDQARKRLTKRSEEVVRLLVTRQS-----------------------
2edzA           AEKAGLLDGDRVLRINGVFVDKEEHAQVVELVRKSGNSVTLLVLDGDSYEKAVKN---------------
3diwB           AEIAGLQIGDKIMQVNGWDMTMVTDQARKRLTKRSEEVVRLLVTRQSLQK--------------------
3dj3A           AEIAGLQIGDKIMQVNGWDMTMVTDQARKRLTKRSEEVVRLLV---------------------------
3dj3B           AEIAGLQIGDKIMQVNGWDMTMVTDQARKRLTKRSEEVVRLLVTRQ------------------------
2d8iA           ASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVESGP---------------
3dj3D           AEIAGLQIGDKIMQVNGWDMTMVHDQARKRLTKRSEEVVRLLV---------------------------
3cc0B           VAADGRIEPGDMLLQVNMNFENMSDAVRVLDIVHKPGPIVLTVAKSGEIVLWSDI---------------
1csoE           ----------------------------------------------------------------------
2edvA           SAHGKLFPGDQILQMNNEPAEDLSWERAVDILREAEDSLSITVVRCTSSGPS------------------
2egnA           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLY-------------------------
3cbxB           VAADGIEPGDMLLQVNDMNFENMDDAVRVLDIVHKPGPIVLTVAKSGGGWKWYGWF--------------
2dlsA           AMKAGVKEGDRIIKVNGTMVTNSS-HLEVVKLIKSGAYVALTLL--------------------------
3cbyA           VAADGIEPGDMLLQVNDMNFENMSDAVRVLDIVHKPGPIVLTVAKSGGGWKDYGWI--------------
3e17B           ATKDGNHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVL--------------------------
2egkD           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTEESQL------------------
2csjA           AD-GLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQVAPLSGP-------------
3b8jA           ----------------------------------------------------------------------
2dazA           AAADGMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMASGP-------------
3cc0A           VAADGIEPGDMLLQVNDMNFENMDDAVRVLDIVHKPGPIVLTVAKSGGGGEIVLWS--------------
1be9A           ADLSGLRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVN----------
2egkA           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTEESQL------------------
1bfeA           ADLSGLRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVN----------
2cs5A           ADLCRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVYDVVEESG----------
2d90A           AEAAGLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKEAESIYSLSGP-------------
2egkC           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYES-----------------------
2e7kA           VAQQGLLHGDIIKEVNGQPVGSDPRALQELLR-NASGSVILKILSGP-----------------------
2eegA           AALAALCPGDLIQAINGESTELMTHLEAQNRIKGCHDHLTLSVSSGP-----------------------
2bygA           AQKDGLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSEVVYLKVGKPT-----------------------
2eeiA           AMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKS-------------
2as9A           ----------------------------------------------------------------------
3cyyB           AARDNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQR-------------------------
2dm8A           AARDGLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEESGP-------------
3b76A           ISRDRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEGSIV------------------
2dluA           ADRDGLQTGDHILKIGGTNVQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTSGP-------------
1b8qA           AEQSGLIQGDIILAVNDRPLVDLYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTG----------
2ejyA           IHRQGLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQ-----------------------
2awwA           AHKDGLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVA--------------------------
3b76B           ISRDRIKTGDILLNVDGVELTEVSRSEAVALLKRTSSSIVLKALEVKEGSIV------------------
2eehA           AERAGLCVGDKITEVNGLSLEST-TMGSAVKVLTSSSRLHMMVRRMG-----------------------
2dmzA           AYHNHIQVNDKIVAVDGVNIQGFANHDVVEVLRNAGQVVHLTLVRR------------------------
2egkB           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYES-----------------------
2djtA           AQRCGLEVGDLVLHINGESTQGLTHAQAVERIRAGGPQLHLVIRRPL-----------------------
3cbyB           VAADGRIEGDMLLQVNDMNFENMSDAVRVLDIVHKPGPIVLTVAKSGWKDYGWIDG--------------
2awuA           AHKDGLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVAKPT-----------------------
2awxA           AHKDGKLQGDKLLAVNSVSLEEVTHEEAVTALKNTSDFVYLKVAKPTS----------------------
3cc0C           VAADGREPGDMLLQVNDMNFENMSDDAVRVLRDIVHKPIVLTVAKSGEIVLWSDI---------------
2awuB           AHKDGLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVA--------------------------
2eaqA           AEFSQLQVDDEIIAINNTKFSYNDEWEEAMAKAQETGHLVMDVRRYG-----------------------
2eejA           ADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKK-----------------------
3cbxA           VAADGIEPGDMLLQVNDMNFENMSDAVRVLDIVHKPGPIVLTVAKSGGGWKWYGWF--------------
1agjA           ----------------------------------------------------------------------
3e17A           ATKDNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLR-------------------------
2egoA           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLY-------------------------
3e90B           ----------------------------------------------------------------------
2egoB           AQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLY-------------------------
3cyyA           AARDGIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVV---------------------------
3cbzA           VAADGIEPGDMLLQVNDMNFENMSAVRVLRDIVHKPGPIVLTVAKSGGSGNE------------------
2bhgB           ----------------------------------------------------------------------
2awwB           AHKDGLQIGDKLLAVNSVGLEEVTHEEAVTALKNTSDFVYLKVA--------------------------
2a4gC           ----------------------------------------------------------------------
1d5gA           AESDGIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQ-----------------------
2edpA           AALSKMRTGDELVNINGTPLYGSRQEALILIK-GSFRILKLIVRRRN-----------------------
2d92A           AERSGLLPGDRLVSVNEYCLDNTSEAVEILKA-VPPGLVHLGICSGP-----------------------
2awxB           AHKDKLQIGDKLLAVNSVSLEEVTHEEAVTALKNTSDFVYLKVA--------------------------
2as9B           ----------------------------------------------------------------------
3bpuA           GLKEGDL----IVEVNKKNVQALTQVVDMLVESPKGSEVTLLVQRQT-----------------------
3e90D           ----------------------------------------------------------------------
2dkrA           ADRHGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRSGPS----------------------
2dc2A           ADRCGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVA-----------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDV
3ee1A           ----------------------------------------------------------------------
2azoB           ----------------------------------------------------------------------
1a1rB           ----------------------------------------------------------------------
3ejxB           KGGPNLKVDDLNLPEIG----PKFEHHEMFPARTNTEFVEVLSRS-------------------------
3cs0A           ----------SIFNGIEG-----AESNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
3ejxA           KGGPNLKVDDLNLPEIG----PKFEHHEMFPARTNTEFVEVLSRS-------------------------
2a4gA           ----------------------------------------------------------------------
1befA           ----------------------------------------------------------------------
2ehrA           ----------------------------------------------------------------------
2cssA           ----------------------------------------------------------------------
1a1rA           ----------------------------------------------------------------------
2db5A           ----------------------------------------------------------------------
3dj1B           ----------------------------------------------------------------------
3dj1A           ----------------------------------------------------------------------
3diwA           ----------------------------------------------------------------------
2edzA           ----------------------------------------------------------------------
3diwB           ----------------------------------------------------------------------
3dj3A           ----------------------------------------------------------------------
3dj3B           ----------------------------------------------------------------------
2d8iA           ----------------------------------------------------------------------
3dj3D           ----------------------------------------------------------------------
3cc0B           ----------------------------------------------------------------------
1csoE           ----------------------------------------------------------------------
2edvA           ----------------------------------------------------------------------
2egnA           ----------------------------------------------------------------------
3cbxB           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3cbyA           ----------------------------------------------------------------------
3e17B           ----------------------------------------------------------------------
2egkD           ----------------------------------------------------------------------
2csjA           ----------------------------------------------------------------------
3b8jA           ----------------------------------------------------------------------
2dazA           ----------------------------------------------------------------------
3cc0A           ----------------------------------------------------------------------
1be9A           ----------------------------------------------------------------------
2egkA           ----------------------------------------------------------------------
1bfeA           ----------------------------------------------------------------------
2cs5A           ----------------------------------------------------------------------
2d90A           ----------------------------------------------------------------------
2egkC           ----------------------------------------------------------------------
2e7kA           ----------------------------------------------------------------------
2eegA           ----------------------------------------------------------------------
2bygA           ----------------------------------------------------------------------
2eeiA           ----------------------------------------------------------------------
2as9A           ----------------------------------------------------------------------
3cyyB           ----------------------------------------------------------------------
2dm8A           ----------------------------------------------------------------------
3b76A           ----------------------------------------------------------------------
2dluA           ----------------------------------------------------------------------
1b8qA           ----------------------------------------------------------------------
2ejyA           ----------------------------------------------------------------------
2awwA           ----------------------------------------------------------------------
3b76B           ----------------------------------------------------------------------
2eehA           ----------------------------------------------------------------------
2dmzA           ----------------------------------------------------------------------
2egkB           ----------------------------------------------------------------------
2djtA           ----------------------------------------------------------------------
3cbyB           ----------------------------------------------------------------------
2awuA           ----------------------------------------------------------------------
2awxA           ----------------------------------------------------------------------
3cc0C           ----------------------------------------------------------------------
2awuB           ----------------------------------------------------------------------
2eaqA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
3cbxA           ----------------------------------------------------------------------
1agjA           ----------------------------------------------------------------------
3e17A           ----------------------------------------------------------------------
2egoA           ----------------------------------------------------------------------
3e90B           ----------------------------------------------------------------------
2egoB           ----------------------------------------------------------------------
3cyyA           ----------------------------------------------------------------------
3cbzA           ----------------------------------------------------------------------
2bhgB           ----------------------------------------------------------------------
2awwB           ----------------------------------------------------------------------
2a4gC           ----------------------------------------------------------------------
1d5gA           ----------------------------------------------------------------------
2edpA           ----------------------------------------------------------------------
2d92A           ----------------------------------------------------------------------
2awxB           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
3bpuA           ----------------------------------------------------------------------
3e90D           ----------------------------------------------------------------------
2dkrA           ----------------------------------------------------------------------
2dc2A           ----------------------------------------------------------------------
2ehrA           ----------------GGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNLKTGDKILEVSGVDLQNASHS
2cssA           -------------MPKDSGALLGLKVVGGGRLGAFITKVKKGSLADVVGHRAGDEVLEWNGKPLATNEEV
2db5A           ---------------LGFSVVALRSQ-NLGKVDIFVKDVQPGSVADRDQLKENDQILAINHTPLDQNISH
3dj1B           -------------LILGFSIGGGIDQDPSSDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMV-TH
3dj1A           -----------ENLILGFSIGGGIDQDPSQDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTM-VTH
3diwA           -------------LILGFSIGGGIDQDPSQDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMV-TH
2edzA           -------------QNYGFFL-----RIEKDTDGHLIRVIEEGSPAEKAGLLDGDRVLRINGVFVDKEEHA
3diwB           -------------LILGFSIGGGIDQDPSQDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTM-VTH
3dj3A           -------------LILGFSIGGGIDQDPSQDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMVTHDQA
3dj3B           -------------LILGFSIGGGIDQDPSQDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMVTHDQA
2d8iA           ---------------YGFSLSSVEED---GIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSS
3dj3D           -------------LILGFSIGGGIDQDPSQDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMVTHDQA
3cc0B           ----------------FLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNMNFMSNDDA
2egnA           -----------------------------TYGVTFVARVHESSPAQLAGLTPGDTIASVNGLNVEGIRHR
3cbxB           -----------------------------QSGGIYIGSIMKGGAVAADGIEPGDMLLQVNDMNFMSNDDA
2dlsA           -----------------------------GDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNS-SH
3cbyA           -----------------------------GQGGIYIGSIMKGGAVAADGIEPGDMLLQVNDMNFMSNDDA
3e17B           ---------------IGVLLMKSRANEEYGGSQIFVKEMTRTGLATKDGLHEGDIILKINGTVTENMSLT
2egkD           -----------------------------TYGVTFVARVHESSPAQLAGLTPGDTIASVNGLNVEGIRHR
2csjA           ---------------FGIAVSGGRDNPHFGETSIVISDVLPGGPA-DGLLQENDRVVMVNGTPMEDVLHS
2dazA           ---------------LGLSL---AGNKDRSRMSIFVVGINPEGPAAADGMRIGDELLEINNQILYGRSH-
3cc0A           ---------------LGISIV--GQSNERGDGGIYIGSIMKGGAVADGRIEPGDMLLQVNDMNFMSNDDA
1be9A           -------------------------IGGEDGEGIFISFILAGGPADLSGERKGDQILSVNGVDLRNASHE
2egkA           ---------------FGFEIQT-------YGLVTFVARVHESSPAQLAGLTPGDTIASVNGLNVEGIRHR
1bfeA           -------------------------IGGEDGEGIFISFILAGGPADLSGERKGDQILSVNGVDLRNASHE
2d90A           ---------------YGFYL-----RAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKSVEALDHD
2egkC           -----------DNQTFGFEIQTYGL----HVEVTFVARVHESSPAQLAGLTPGDTIASVNGLNVEGIRHR
2eegA           ---------------WGFRLVGGRDFSA----PLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHL
2eeiA           -------------------------KTVQGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDASHE
2awwA           ---------------LGFSIAGVGNQHIPGDNSIYVTSIVEGGAAHDGKLQIGDKLLAVNSVGLEEVTHE
2eehA           ---------------LGFSVRGGSEHGL----GIFVSKVEEGSSAERAGLCVGDKITEVNGLSLEST-TM
2dmzA           -----------DGQSLGIRIVGVGTSHTGEASGIYVKSVIPGSAAYNGHIQVNDKIVAVDGVNIQGFANH
2djtA           -----------------------------GDTPLAVRGLLKDGPAQRCGREVGDLVLHINGESTQGLTHA
3cbyB           ------------------------SIVGQSDGGIYIGSIMKGGAVADGRIEPGDMLLQVNDMNFMSNDDA
2eaqA           ---------------LDFGFTI-----KWDIPGIFVASVEAGSPAEFSQLQVDDEIIAINNTKFNDSKEW
2eejA           ---------------YGFHL-----NAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYE


                         *         .         .         .         .         +         .:560
query           REAINTAKADNKNSVLIRVRSGGSSRFVAVPISAKG
3ee1A           ------------------------------------
2azoB           ------------------------------------
1a1rB           ------------------------------------
3ejxB           ------------------------------------
3cs0A           RKVLDSK----PSVLALNIQRGDSTIYL--------
3ejxA           ------------------------------------
2a4gA           ------------------------------------
1befA           ------------------------------------
2ehrA           ------------------------------------
2cssA           ------------------------------------
1a1rA           ------------------------------------
2db5A           ------------------------------------
3dj1B           ------------------------------------
3dj1A           ------------------------------------
3diwA           ------------------------------------
2edzA           ------------------------------------
3diwB           ------------------------------------
3dj3A           ------------------------------------
3dj3B           ------------------------------------
2d8iA           ------------------------------------
3dj3D           ------------------------------------
3cc0B           ------------------------------------
1csoE           ------------------------------------
2edvA           ------------------------------------
2egnA           ------------------------------------
3cbxB           ------------------------------------
2dlsA           ------------------------------------
3cbyA           ------------------------------------
3e17B           ------------------------------------
2egkD           ------------------------------------
2csjA           ------------------------------------
3b8jA           ------------------------------------
2dazA           ------------------------------------
3cc0A           ------------------------------------
1be9A           ------------------------------------
2egkA           ------------------------------------
1bfeA           ------------------------------------
2cs5A           ------------------------------------
2d90A           ------------------------------------
2egkC           ------------------------------------
2e7kA           ------------------------------------
2eegA           ------------------------------------
2bygA           ------------------------------------
2eeiA           ------------------------------------
2as9A           ------------------------------------
3cyyB           ------------------------------------
2dm8A           ------------------------------------
3b76A           ------------------------------------
2dluA           ------------------------------------
1b8qA           ------------------------------------
2ejyA           ------------------------------------
2awwA           ------------------------------------
3b76B           ------------------------------------
2eehA           ------------------------------------
2dmzA           ------------------------------------
2egkB           ------------------------------------
2djtA           ------------------------------------
3cbyB           ------------------------------------
2awuA           ------------------------------------
2awxA           ------------------------------------
3cc0C           ------------------------------------
2awuB           ------------------------------------
2eaqA           ------------------------------------
2eejA           ------------------------------------
3cbxA           ------------------------------------
1agjA           ------------------------------------
3e17A           ------------------------------------
2egoA           ------------------------------------
3e90B           ------------------------------------
2egoB           ------------------------------------
3cyyA           ------------------------------------
3cbzA           ------------------------------------
2bhgB           ------------------------------------
2awwB           ------------------------------------
2a4gC           ------------------------------------
1d5gA           ------------------------------------
2edpA           ------------------------------------
2d92A           ------------------------------------
2awxB           ------------------------------------
2as9B           ------------------------------------
3bpuA           ------------------------------------
3e90D           ------------------------------------
2dkrA           ------------------------------------
2dc2A           ------------------------------------
2ehrA           EAVEAIKNA--GNPVVFIVQSLSSTP----------
2cssA           YNIILESK--SEPQVEIIVSRPSGPS----------
2db5A           QQAIALLQQ-TTGSLRLIVAREPVHTKSSTSGPSSG
3dj1B           DQARKRLTKRSEEVVRLLVTRQSLQKAVQQ------
3dj1A           DQARKRLTKRSEEVVRLLVTRQSLQKAVQQSM----
3diwA           DQARKRLTKRSEEVVRLLVTRQS-------------
2edzA           QVVELVRKSGNSVTLLV-LDGDSYEKAVKNQVDLK-
3diwB           DQARKRLTKRSEEVVRLLVTRQSLQK----------
3dj3A           RKRLTKRSEEVVRLLVTR------------------
3dj3B           RKRLTKRSEEVVRLLVTR------------------
2d8iA           MLKDFLSQP--SLGLLVRTYPELEEGVESGPSS---
3dj3D           RKRLTKRSEEVVRLLVTR------------------
3cc0B           VRVLRDIVHKPG-PIVLTVAKSGEIVLWSD------
2egnA           EIVDIIKASGNVLRLETL------------------
3cbxB           VRVLRDIVHKPGPIVLTVAKSGGGWK----------
2dlsA           LEVVKLIKSGAYVALTLLGSSSGPS-----------
3cbyA           VRVLRDIVHKPG-PIVLTVAKSGGGWKDYGWIDGK-
3e17B           DARKLIEKSRGKLQLVVL------------------
2egkD           EIVDIIKAS--GNVLRLETLYGT-------------
2csjA           FAVQQLRKS--GKIAAIVVKRPRKVQVAPLSGPSSG
2dazA           QNASAIIKTAPS-KVKLVFIRNEDAVNQMASGPSSG
3cc0A           VRVLRDIVHKPG-PIVLTVAKSGGGGEIVLWSDI--
1be9A           QAAIALKNAGQT--VTIIAQYKPEEYSRFEANSRVN
2egkA           EIVDIIKASGNVLRLETL------------------
1bfeA           QAAIALKNA--GQTVTIIAQYKPEEYSRFEANSRVN
2d90A           GVVEMIRKGGDQ--TTLLVLDKEAESIYSLSGPSSG
2egkC           EIVDIIKASGNVLRLETL------------------
2eegA           EAQNRIKGCHDHLTLSVS------------------
2eeiA           EVVEKVKKS--GSRVMFLLVDKETDKRHVEQKSG--
2awwA           EAVTALKNTSDFVYLKVAKPT---------------
2eehA           GSAVKVLTSSSRLHMMVR------------------
2dmzA           DVVEVLRNAGQVVHLTLV------------------
2djtA           QAVERIRAGGPQ--LHLVIRRPLSGP----------
3cbyB           VRVLRDIVHKPG-PIVLTVAKSGWKDYGWI------
2eaqA           EEAMAKAQ--ETGHLVMDVRRYG-------------
2eejA           KVVDRIQSSGKNVTLLVC------------------