[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39379.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dhhA.bssp"
#ERROR : Can't open dsspfile "3d9bA.bssp"
#ERROR : Can't open dsspfile "3cuzA.bssp"
#ERROR : Can't open dsspfile "3cv2B.bssp"
#ERROR : Can't open dsspfile "2c5mA.bssp"
#ERROR : Can't open dsspfile "3cv2A.bssp"
#ERROR : Can't open dsspfile "2axcA.bssp"
#ERROR : Can't open dsspfile "1d8cA.bssp"
#ERROR : Can't open dsspfile "2d9rA.bssp"
#ERROR : Can't open dsspfile "2ci1A.bssp"
#ERROR : Can't open dsspfile "2axcA.bssp"

## Summary of PDB Search
:1070
    e-174  21%  2dhhA  [x.x.x] ACRB[MASQUE : MEMB(X) 253 / COIL(x) 0]
    e-173  20%  3d9bA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B[MASQUE : MEMB(X) 253 /
    5e-41  10%  3cuzA  [x.x.x] MALATE SYNTHASE A
    1e-35  10%  3cv2B  [x.x.x] MALATE SYNTHASE A
    5e-33  11%  2c5mA  [x.x.x] CTP SYNTHASE
    2e-23  11%  3cv2A  [x.x.x] MALATE SYNTHASE A
    5e-17  13%  2axcA  [x.x.x] COLICIN E7
    1e-13  12%  1d8cA  [c.1.13] MALATE SYNTHASE G
    3e-11  10%  2d9rA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN
    1e-04  22%  2ci1A  [x.x.x] NG, NG-DIMETHYLARGININE DIMETHYLAMINOHYDROLASE 1
    2e-07  10%  2axcA  [x.x.x] COLICIN E7(query 170->275)
:1070

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxLLAFSVRQRWLVMIGVLMMAAFGAWNFTRLPIDAVPDITNVQVQINTNAPGYSPLEVEQRITFPIE
2dhhA           ----MPNFFIDRXXXXXXXXXXXXXXXXXXXXXXXVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
3d9bA           ----MPNFFIDRXXXXXXXXXXXXXXXXXXXXXXXVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
3cuzA           ----YQALLAKGSGPYFYLPKTQSWQEAWSEVFSYAEDRFNLPRGTIKATLLIETLPAVFQMDEILHALR
3cv2B           ----------------------------FSYAEDRFNLPRGTIKATLLIETLPAVFQMDEILHALRDHIV
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDILPVGIETAMGPVSTGLGEIY
2dhhA           QNMNGIDNLMYMSSNSDTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
3d9bA           QNMNGIDNLMYMSSNSDTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
3cuzA           DHIVGLN-----CGRWDYIFSYIKTLKNYPDRVLPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMA
3cv2B           GLNCGRWDY---------IFSYIKTLKNYPDRVLPDRQAVTMDKPFLNAYSRLLIKTCHKRGAFAMGGMA
2c5mA           ------------------------------------TILKSCGLHVTSIKIDPYINIKDNNLTTG--KIY
3cv2A           -----------------------------------------------------GMAAFIPSKDEEHNNQV
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAGVNEVNTIGGFEKQFHVLPDPARLMAYRLSF
2dhhA           MVVGVI------NTDGTMTQEDISDYVAANMKDAISRTSGVGDVQ-LFGSQYAMRIWMNPNELNKFQLTP
3d9bA           MVVGVINTDGT------MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
3cuzA           AFIPSKDEEHNNQKADKSLEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLL
3cv2B           AFIPSKDEEHNKVKADKSLEANNGHDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLL
2c5mA           QYVINKERKGDYLGKTVVVPHITDAIQEWVMRQALIPEPQVCVIE-LGGTVGDIESMPFIEAFRQFQFKV
3cv2A           LNKVKA-----------DKSLEANNGHDGTWIAHPGLADTAMANDILGSRKNQLEVMREQDAPITADQLL
2axcA           ----------------------------------------------------------------------
1d8cA           -----------------PSPTAATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWS
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           -----------------------------VVNAKPTRTPGVFHASFPGV--PSLTVSTVKGLPVSTTLPR


                         .         .         .         +         .         .         .:280
query           RDVMTSLASNNANVGAGYIEKNGEQYLVRTPGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTG
2dhhA           VDVITAIKAQNAQVAAGQLGGTPPNASIIAQTRLTSTEEFGKILLVNQDGSRVLLRDVAKIELGGENYDI
3d9bA           VDVITAIKAQNAQVAAGQLGGTPPNASIIAQTRLTSTEEFGKILLKVQDGSRVLLRDVAKIELGGENYDI
3cuzA           APCDGERTEEGMRANIRVAVQ-YIEAWISGNGCVPIYGLME----------DAATAEISRTSIWQWIHHQ
3cv2B           APCDGERTEEGMRANIRVA------------VQYIEAWISGNGVPIYGLMEDAATAEISRTSIWQWIHHQ
2c5mA           KRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVCRCSNPLDTSVKEKISMFCHVE-PEQ
3cv2A           APCTEEGMRANIRVAVQYIE-----AWISGNGVPIY-----------GLMEDAATAEISRTSIWQWIHHQ
2axcA           ----------------------------------------------------------------------
1d8cA           AQEIQQELDNNVQGILGYVVRWVEQGIGCSKVPDIHNV----------ALEDRATLRISSQHIANWLRHG
2d9rA           ------------------------------------PIEFDAIIRQVPDAAYVEIPFDVKTVYGKGRVRV
2ci1A           -DFARAERQHQLYVGV-LGSKLGLQVVQLPADEVEDVAVVEETALITRPGAPSRRKEADMMKEAVEMKDE
2axcA           GITEDKG---RTAVPAGFT-FGGGSHEAVPKESGQKPVYVSVTDVLTPAQVRQDEEKRLQQEWND-----


                         .         *         .         .         .         .         +:350
query           AATVSGKEVVLGTAMLLIGENGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEG
2dhhA           IAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKXXXXXXXXXXXXX
3d9bA           IAEFNGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKXXXXXXXXXXXXX
3cuzA           KTLSNGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAAR----LMEQITTSDELIDFLTLPGYRL
3cv2B           KTLSNGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAAR----LMEQITTSDELIDFLTLPGYRL
2c5mA           VICVHDVSSIYRVPLLLEEQGVVDYFLRR-----------------------------------------
3cv2A           KTLSNGKPVTKALFRQMLGEEMKVIASELGEERFSQGRFDDAA----RLMEQITTSDELIDFLTLPGYRL
2axcA           ----------------------------------------------------------------------
1d8cA           ILTKEQVQASLENAKVVDQQNAGDPAYRPAGNFANSCAKQPNGYTE-PLLHAWRLREK------------
2d9rA           NATFDGYPYTGYIVR-GLPCHILGLRQDIRRA-------IGKQPGDSVYVTLL-----------------
2ci1A           NATLDGGDVLFTGREFFVGLSKRTNQRGA----EILADTFKDAVSTVPVVDALHL-KSFCSMAGPNLI--
2axcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXXXXXGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGXXXXXXXXXXXXXXXENCLRL
2dhhA           XXXXXXXXXXFLQNFRATLXXXXXXXXXXXXXXXXXXXXXXXINTLTMXXXXXXXXXXXXXXXXXXXXXX
3d9bA           XXXXXXXXXXFLQNFRATLXXXXXXXXXXXXXXXXXXXXXXXINTLTMXXXXXXXXXXXXXXXXXXXXXX
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPMAXXXXXXXXX
2dhhA           XVMAEE-------GLPPKEATRKSMGQIQGXXXXXXXXXXXXXXXXXXXXXXXGAIYRQFSITXXXXXXX
3d9bA           XVMAEE-------GLPPKEATRKSMGQIQGXXXXXXXXXXXXXXXXXXXXXXXGAIYRQFSITIXXXXXX
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXFVPAAVALMVTGKVSEKENWFMRLAHRTYXXXXXXXXXXXXXXXXXXXXXXXXSGYAATRMGG
2dhhA           XXXXXXXXXXXXXXXXLKF---GWFNRMFEKSTHHYTDSVGGILRSTGRXXXXXXXXXXXXXXXXXXXXX
3d9bA           XXXXXXXXXXXXXXXXXKKGFFGWFNRMFEKSTHHYTDSVGGILRSTGRXXXXXXXXXXXXXXXXXXXXX
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EFIPSLDEGDVAIQAMRIPGTSLTQSLEMQMALEKRLLAIPEVKEAFARTGTAEVATDPMPPSISDGYVM
2dhhA           XXLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKNNVESVFAVNGFGFAGRG---QNTGIAFVS
3d9bA           XXLPDEDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKNNVESVFAVNGFGFAGRG---QNTGIAFVS
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKPRDQWPDPKKPKLEVMKEIETASEEVAGNLYELSQPIQLRFNELISGVRSDVGVKIFGXXXXXXXXXX
2dhhA           LKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARN
3d9bA           LKDWADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEKLTQARN
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           XXXXXXXXTIKGAADVKTEQVAGLPVLTVKLDRQALARFGINVADVQSLVEIAVGGKSAGLVFEGDRRFD
2dhhA           QLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
3d9bA           QLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           --------KPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAG----FTFGGGSHE
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           LVVRLPDHLRTDVEAIKRLPIPLPPADGQAKATPAVFGNSPLAQMRYAPLAELAEISVSPGPNQISREDG
2dhhA           VYVMSEAKYRMLPDDIGDWYVRAA--DGQ-----------------MVPFSAFSSSRWEYGSPRLERYNG
3d9bA           VYVMSEAKYRMLPDDIGDWYVRAA--DGQ-----------------MVPFSAFSSSRWEYGSPRLERYNG
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           AVIRFPKESGQKPVYVSVTDVL-----------------TPAQVKQRQDEEKRLQQEWNDAH--------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           KRRIVVSANVRGRDLGSFVGEAQQLVAGKVKLPAGYWIGWGGQFEQLVSATERLTIVVPXXXXXXXXXXX
2dhhA           LPSMEILGQAPGKSTGEAMELMEQLAS---KLPTGVGYDWTGMSYQERLSGNXXXXXXXXXXXXXXXXXX
3d9bA           LPSMEILGQAPGKSTGEAMELMEQLAS---KLPTGVGYDWTGMSYQERLSGNXXXXXXXXXXXXXXXXXX
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           XXXXXXXDALLVFSGVPLALTGGIFALLLRGIPLSISAGIGFIALSGVAVLNGLVIITFIERLRGDGRKI
2dhhA           XXXXXWSXXXXXXXXXXXXXXXXXXXXXXXGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLDKEGKGL
3d9bA           XXXXXWSXXXXXXXXXXXXXXXXXXXXXXXGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKGKGL
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           VDAVREGALTRLRPVLMTALVASLGFVPMALATGAGAEVQRPLATxxxxxxxxxxxxxxxxxxxxxxxxx
2dhhA           IEATLDAVRMRLXXXXXXXXXXXXXXXXXXXXXXXGSGAQNAVGT-------------------------
3d9bA           IEATLDAVRMRLXXXXXXXXXXXXXXXXXXXXXXXGSGAQNAVGT-------------------------
3cuzA           ----------------------------------------------------------------------
3cv2B           ----------------------------------------------------------------------
2c5mA           ----------------------------------------------------------------------
3cv2A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------
2d9rA           ----------------------------------------------------------------------
2ci1A           ----------------------------------------------------------------------
2axcA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxx
2dhhA           --------------------
3d9bA           --------------------
3cuzA           --------------------
3cv2B           --------------------
2c5mA           --------------------
3cv2A           --------------------
2axcA           --------------------
1d8cA           --------------------
2d9rA           --------------------
2ci1A           --------------------
2axcA           --------------------