[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39396.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cknB.bssp"
#ERROR : Can't open dsspfile "1ckmA.bssp"
#ERROR : Can't open dsspfile "1a0iA.bssp"
#ERROR : Can't open dsspfile "2cfmA.bssp"
#ERROR : Can't open dsspfile "3bacA.bssp"
#ERROR : Can't open dsspfile "1b04B.bssp"
#ERROR : Can't open dsspfile "1b04A.bssp"
#ERROR : Can't open dsspfile "3baaA.bssp"

## Summary of PDB Search
:313
    3e-28  14%  1cknB  [d.142.2 - b.40.4] MRNA CAPPING ENZYME
    2e-26  14%  1ckmA  [d.142.2 - b.40.4] MRNA CAPPING ENZYME
    3e-25  15%  1a0iA  [x.x.x] DNA LIGASE
    2e-20  21%  2cfmA  [x.x.x] THERMOSTABLE DNA LIGASE
    1e-16  16%  3bacA  [x.x.x] DNA LIGASE
    1e-13  14%  1b04B  [d.142.2] PROTEIN (DNA LIGASE)
    1e-13  14%  1b04A  [d.142.2] PROTEIN (DNA LIGASE)
    5e-06  16%  3baaA  [x.x.x] DNA LIGASE
:313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRVVRIHAEGAVPAPMPGFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHD
1cknB           -----AKMKDLAMDDHKFPRLPGPNPVSIERKDFEKLKQNKYVVSETDGIRFMMFFGFKVCTIIDRAMTV
1ckmA           -----AKMKDLAMDDHKFPRLPGPNPVSIERKDEKLKQNKYVVSEKTDGIRFMMFFGFKVCTIIDRAMTV
1a0iA           ----------------IKTNPFKAVSFVEAIKKALDNAGYLIAEIKYDGVRGNICVNTANSYWLSRVSKT
2cfmA           ---------NEGLAKVQVQLGKPIKPLAQQIRDALLEGGEAEFEIKYDGARVQVHKDGSKIIVYSRRLEN
3bacA           -------------------------KRIEDRLILLPKPLTFCCEPKLDGLAVSILYNGELTQAATRGGED
1b04B           ------VAHRVPMMSLANAFGEGDLRDFDRRVRQEVGEAAYVCELAIDGLAVSVRYEDGYVQGATRGGED
1b04A           ---------------------------------QEVGEAAYVCELAIDGLAVSVRYDGYFVQGATRGGED
3baaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WSKMFAPLVAALSDAAXXXXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXMLFYAFDLLHLDGYDLGPVP
1cknB           YLLPFKNIPRVLFQ--------------------GSIFDGELCVDIVEKKFAFVLFDAVVVSGVTVSQMD
1ckmA           YLLPFKNIPRVLFQ--------------------GSIFDGELCVDIVEKKFAFVLFDAVVVSGVTVSQMD
1a0iA           FDVRWKRLLNDDRCFYKDGFMLDGELMVKGVDFNGLLRTKWTDTKNQEFHRKIKLYAILPLHIVESGEDC
2cfmA           VTRAIPEIVEALKEAIIPEKAIVEGELVAIGENGPFQYVLRRFRRKHNIELELNLFDVLYVDGQSLIDTK
3bacA           ITANIRTIRVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTLVLNAYGIGIAEGVGL-PTT
1b04B           ITENLKTIRSLPLREAFMPKASFLRLNEERKARELFALRQLDPKVAASRQLDLFVYGLADAEALGI--AS
1b04A           ITENLKTIRSLP--LRLKEPVSLEARGEAFMPKASFLRLNEERKARELFANPLFVYGLADAEALG--IAS
3baaA           ----------------------------------------------------TFLYTVADFGPMK--AKT


                         +         .         .         .         .         *         .:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKR
1cknB           LASRFFAMKRSLKEFYKEWIPLEHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYG-RNFNLFKLKPHHT
1ckmA           LASRFFAMKRSLNVPEDPAILREHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYG-RNFNLFKLKPGTH
1a0iA           DVMTLLMQEHVKNMLLQEYFPEVYDMVELQQLYEQKRAEGHEGLIVKDPMCIYKRG-KKSGWWKMKPENE
2cfmA           FIDRRRTLEEI---IKQNEKIKTKKVEEAEAFYK-RALEGHEGLAKRLDAVYEPGN-RGKKWLKIKPTEN
3bacA           HYARLQWLKSIGIPV-NPEIRLCNGADEVLDFYQDIQNKDIDGTVLKINDIALQNGFISKAPRWAIAYKF
1b04B           HSEALDYLQALGFK-VNPERRRCANIDEVIADKRPQLPYEIDGIVIKVDSFAQQRAAKSPRWAKFP----
1b04A           HSEALDYLQALGFK-VNPERRRCANIDEVIADKRPQLPYEIDGIVIKVDSFAQQRAAKSPRW--------
3baaA           QFEALEELSAIGFRT-NPERQLCQSIDEVWAYIEEYHEKEIDGIVIKVNEFALELGFTVKAP--------


                         .         .         .         +         .         .         .:280
query           EHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETXXXXXXXXXXXXXXX
1cknB           IDFIIMSEDGTIGI------FDPNLRKNVPVGKLDGYYN-------------------------------
1ckmA           HDFIIMSEDGTIGILRKNVPVGKLDGYYNKGSIVECGFADGTWKYIQGRS--------------------
1a0iA           ADGIIQGLVWGTKGKVIGFEVLLESGRLVNATNISRALMDEFTETVKEATLSQWGFFDACTINPYDGWA-
2cfmA           LDLVIIGAEWGEGRRAILGAYDPETGEFLEVGKVGSGFTDDDLVEFTKLKPLIIKEEGKRVWLQPKVV--
3bacA           ----------------------------------------------------------------------
1b04B           ----------------------------------------------------------------------
1b04A           ----------------------------------------------------------------------
3baaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXMSADVEYRDITASGHLRHASFKGLxxxx
1cknB           ---------------------------------
1ckmA           ---------------------------------
1a0iA           -------CQISYMEETPDGSLRHPSFVMF----
2cfmA           -------IEVTYQEIQKSFALRFPRFVAL----
3bacA           ---------------------------------
1b04B           ---------------------------------
1b04A           ---------------------------------
3baaA           ---------------------------------