[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39446.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d3fA.bssp"
#ERROR : Can't open dsspfile "3b3dB.bssp"
#ERROR : Can't open dsspfile "3b3dA.bssp"
#ERROR : Can't open dsspfile "1afsA.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "3c3uA.bssp"
#ERROR : Can't open dsspfile "1az1A.bssp"
#ERROR : Can't open dsspfile "2acsA.bssp"
#ERROR : Can't open dsspfile "2dv0A.bssp"
#ERROR : Can't open dsspfile "2acuA.bssp"
#ERROR : Can't open dsspfile "3caqB.bssp"
#ERROR : Can't open dsspfile "1ah3A.bssp"
#ERROR : Can't open dsspfile "3cv6A.bssp"
#ERROR : Can't open dsspfile "1adsA.bssp"
#ERROR : Can't open dsspfile "3eb4A.bssp"
#ERROR : Can't open dsspfile "2alrA.bssp"
#ERROR : Can't open dsspfile "2bgsA.bssp"
#ERROR : Can't open dsspfile "3burA.bssp"
#ERROR : Can't open dsspfile "3eauA.bssp"
#ERROR : Can't open dsspfile "3eb3A.bssp"
#ERROR : Can't open dsspfile "1c9wA.bssp"
#ERROR : Can't open dsspfile "1ah0A.bssp"
#ERROR : Can't open dsspfile "2bgqA.bssp"
#ERROR : Can't open dsspfile "2agtA.bssp"
#ERROR : Can't open dsspfile "2bp1A.bssp"
#ERROR : Can't open dsspfile "2c91A.bssp"
#ERROR : Can't open dsspfile "2bp1B.bssp"
#ERROR : Can't open dsspfile "3cv7A.bssp"
#ERROR : Can't open dsspfile "2c91B.bssp"
#ERROR : Can't open dsspfile "1dqaB.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "3cd5C.bssp"
#ERROR : Can't open dsspfile "3cctC.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "1dq9C.bssp"
#ERROR : Can't open dsspfile "2aicA.bssp"
#ERROR : Can't open dsspfile "1dqaD.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "1dq8C.bssp"
#ERROR : Can't open dsspfile "3cd5D.bssp"
#ERROR : Can't open dsspfile "2d4cB.bssp"
#ERROR : Can't open dsspfile "1dq8B.bssp"
#ERROR : Can't open dsspfile "1dq8A.bssp"
#ERROR : Can't open dsspfile "3cdbC.bssp"
#ERROR : Can't open dsspfile "2d4cA.bssp"
#ERROR : Can't open dsspfile "3cdaA.bssp"
#ERROR : Can't open dsspfile "1dq9B.bssp"
#ERROR : Can't open dsspfile "2d4cC.bssp"
#ERROR : Can't open dsspfile "1dq8D.bssp"
#ERROR : Can't open dsspfile "3cd0D.bssp"
#ERROR : Can't open dsspfile "3bglD.bssp"
#ERROR : Can't open dsspfile "1dqaC.bssp"
#ERROR : Can't open dsspfile "1dy1A.bssp"
#ERROR : Can't open dsspfile "3cdaD.bssp"
#ERROR : Can't open dsspfile "3ee8B.bssp"
#ERROR : Can't open dsspfile "3ee8A.bssp"
#ERROR : Can't open dsspfile "1dy0A.bssp"
#ERROR : Can't open dsspfile "1dq9D.bssp"
#ERROR : Can't open dsspfile "3bmaF.bssp"
#ERROR : Can't open dsspfile "3cd5A.bssp"

## Summary of PDB Search
:281
    9e-52  30%  3d3fA  [x.x.x] YVGN PROTEIN
    2e-51  25%  3b3dB  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    4e-50  26%  3b3dA  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    4e-45  22%  1afsA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    4e-45  27%  1a80A  [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    5e-45  26%  3c3uA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    8e-45  26%  1az1A  [x.x.x] ALDOSE REDUCTASE
    2e-44  25%  2acsA  [x.x.x] ALDOSE REDUCTASE
    5e-44  25%  2dv0A  [x.x.x] ALDOSE REDUCTASE
    7e-44  25%  2acuA  [x.x.x] ALDOSE REDUCTASE
    8e-44  27%  3caqB  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    9e-44  25%  1ah3A  [c.1.7 (1ekoA)] ALDOSE REDUCTASE
    1e-43  23%  3cv6A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
    6e-43  25%  1adsA  [c.1.7 (1ef3A)] ALDOSE REDUCTASE
    7e-43  25%  3eb4A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    8e-43  28%  2alrA  [x.x.x] ALDEHYDE REDUCTASE
    1e-42  24%  2bgsA  [x.x.x] ALDOSE REDUCTASE
    5e-42  25%  3burA  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    6e-42  25%  3eauA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-41  25%  3eb3A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-41  26%  1c9wA  [c.1.7] CHO REDUCTASE
    5e-41  25%  1ah0A  [x.x.x] ALDOSE REDUCTASE
    9e-41  23%  2bgqA  [x.x.x] ALDOSE REDUCTASE
    6e-39  25%  2agtA  [x.x.x] ALDOSE REDUCTASE
    2e-38  25%  2bp1A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    2e-38  23%  2c91A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-37  25%  2bp1B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    3e-37  28%  3cv7A  [x.x.x] ALCOHOL DEHYDROGENASE
    1e-36  24%  2c91B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    7e-36  11%  1dqaB  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    9e-36  23%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    1e-34  11%  3cd5C  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    2e-33  10%  3cctC  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    3e-33  27%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    6e-33  10%  1dq9C  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-32  10%  2aicA  [x.x.x] GUANINE NUCLEOTIDE EXCHANGE FACTOR BOPE
    3e-32  11%  1dqaD  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    8e-32  24%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    8e-32  11%  1dq8C  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    2e-31  11%  3cd5D  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    5e-31  18%  2d4cB  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    5e-31  12%  1dq8B  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    3e-30  11%  1dq8A  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    4e-28  12%  3cdbC  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    5e-28  16%  2d4cA  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    5e-28  11%  3cdaA  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    7e-28  13%  1dq9B  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    8e-28  16%  2d4cC  [x.x.x] SH3-CONTAINING GRB2-LIKE PROTEIN 2
    1e-27  11%  1dq8D  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    1e-26  13%  3cd0D  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    4e-26  12%  3bglD  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    1e-24  12%  1dqaC  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    1e-22  10%  1dy1A  [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
    2e-21  14%  3cdaD  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
    1e-20  12%  3ee8B  [x.x.x] NON-STRUCTURAL PROTEIN 1
    5e-20  12%  3ee8A  [x.x.x] NON-STRUCTURAL PROTEIN 1
    3e-19   9%  1dy0A  [d.169.1] COLLAGEN ALPHA1(XVIII) CHAIN
    3e-19  12%  1dq9D  [d.179.1 - d.58.20] PROTEIN (HMG-COA REDUCTASE)
    1e-17   8%  3bmaF  [x.x.x] D-ALANYL-LIPOTEICHOIC ACID SYNTHETASE
    1e-10  13%  3cd5A  [x.x.x] 3-HYDROXY-3-METHYLGLUTARYL-COENZYME A REDUCTASE
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSWDTRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
3d3fA           TSLKDTVKLHNGVEMPWFGLGVFKV--ENGNEATESVKAAIKNGYRSIDTAAIYKEGVGIGIKESGVARE
3b3dB           ---QAKATLHNGVEMPWFGLGVFQV--EEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVIREGIEESRE
3b3dA           ---QAKATLHNGVEMPWFGLGVFQV--EEGSELVNAVKTAIVHGYRSIDTAAIYGN-EAGVGEGIEGSRE
1afsA           ---SLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYE-VEEEVGQAIRSKIE
1a80A           ----SIVLNDG-NSIPQLGYGVFKVPPAD---TQRAVEEALEVGYRHIDTAAIYGEGVGAAIAASGIARD
3c3uA           ----CVKLNDG-HFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYN-NEEQVGLAIRSKIA
1az1A           ----SRLLLNNGAKMPILGLGTWKSPPGQ---VTEAVKVAIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2acsA           ----SRLLLNNGAKMPILGLGTWKSPPGQ---VTEAVKVAIDVGYRHIDCAHVYQNVGVAIQEKLREQRE
2dv0A           ----SRILLNNGAKMPILGLGTWKSPPGQ---VTEAVKVAIDVGYRHIDCAHVYQNVGVAIQEKLREQRE
2acuA           ----SRLLLNNGAKMPILGLGTWKSPPGQ---VTEAVKVAIDVGYRHIDCAHVHQNVGVAIQEKLREQRE
3caqB           ---SHRIPLSDGNSIPIIGLGTYSEPKSPKGACATSVKVAIDTGYRHIDGAYIYQN-EHEVGEAIREKIA
1ah3A           ----SHLVLYTGAKMPILGLGTWKSPPGK---VTEAVKVAIDLGYRHIDCAHVYQEVGLGLQEKLQVKRE
3cv6A           -----CVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVYNTEDHVGEAIRSKIAD
1adsA           ----SRLLLNNGAKMPILGLGTWKSPPGQ---VTEAVKVAIDVGYRHIDCAHVYQNVGVAIQEKLREKRE
3eb4A           MLQFYRNLGKSGLRVSCLGLGTWVTFGGTDEMAEHLMTLAYDNGINLFDTAEVYAKAEVVLGNIIKKRRS
2alrA           ----SCVLLHTGQKMPLIGLGTWKSEPGQ---VKAAVKYALSVGYRHIDCAAIYG-NEPEIGEALKEDVG
2bgsA           ----DHFVLKSGHAMPAVGLGTWRAGSDT---AHSVRTAITEAGYRHVDTAAEYG-VEKEVGKGLKAAME
3burA           ---SHRIPLSDGNSIPIIGLGTYSEKSTPKGACATSVKVAIDTGYRHIDGAYIYQ-NEHEVGEAIREKIA
3eauA           MLQFYRNLGKSGLRVSCLGLGTWVTFGGTDEMAEHLMTLAYDNGINLFDTAEVYAKAEVVLGNIIKKKRS
3eb3A           MLQFYRNLGKSGLRVSCLGLGTWVTGQITDEMAEHLMTLAYDNGINLFDTAEVYAKAEVVLGNIIKKKRS
1c9wA           ---TFVELSTK-AKMPIVGLGTWQSPPGQ---VKEAVKVAIDAGYRHIDCAYAYHEVGEAIQEKIKVRRE
1ah0A           ----HLVLYTG-AKMPILGLGTWKSPPGK---VTEAVKVAIDLGYRHIDCAHVYQEVGLGLQEKLQGKRE
2bgqA           ----DHFVLKSGHAMPAVGLGTWDT-------AHSVRTAITEAGYRHVDTAAEYGVEK-EVGKGLKAAME
2agtA           ----SRILLNNGAKMPILGLGTWKSPPGQ---VTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLRE
2bp1A           ----------------ASVLGTMEMRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSELGLGLGGGDC
2c91A           ------------PLRPATVLGTMEMRRMDASASAASVRAFLERGHSELDTAFMYCDGQSELGLGLGSGDC
2bp1B           ----------------ASVLGTMEMRRMDAPASAAAVRAFLERGHTELDTAFMYSDSETILGGLGLGLGC
3cv7A           ----SCVLLHTGQKMPLIGLGTWKSEPGQ---VKAAIKYALTVGYRHIDCAAIYGN-ELEIGEALQETVG
2c91B           -----------------TVLGTMEMRRMDASASAASVRAFLERGHSELDTAFMYCDSENILGGGLGSGDC
1dqaB           ----AIGLG-GGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
2clpA           -----------------TVLGAMEMRRMDAPTSAAVTRAFLERGHTEIDTAFVYSQSETILGGLLGGSDC
3cd5C           -----AIGLGGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
3cctC           CRAIGLGGGASSRVLADGMTRGPVVPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
2ao0A           -----CVLLHTGQKMPLIGLGTWKSE-PGQ--VKAAIKYALTVGYRHIDCA-AIYGNELEIGEALQETVG
1dq9C           ----GLGGGASSRVLADGMTRGPVVPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
2aicA           --------------------------------------------------------------DAKQAIRH
1dqaD           CRAIGLGGGASSRVLADGMTRGPVVPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
2clpI           -----------------TVLGAMEMRRMDAPTSAAVTRAFLERGHTEIDTAFVYSQSETILGGLLGGSDC
1dq8C           CRAIGLGGGASSRVLADGMTRGPVVPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
3cd5D           -----AIGLGGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
2d4cB           VDVTSRAVMEIMTKTIEYLQRAKLSMIPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMSEVKD
1dq8B           -----AIGLGGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
1dq8A           -----AIGLGGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
3cdbC           ----AIGLG-GGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
2d4cA           ---VTSRAVMEIMTKTIEYLQPNPAAKLYPQAEALLAEAMLKFGRELGDDCNFGPGEVGEAMRELSEVKD
3cdaA           -----AIGLGGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
1dq9B           ---------GGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
2d4cC           ----VMEIMTKTIEYLQPNPASRAKLPGYPQAEALLAEAMLKFGRELGDDCNFGLGEVGEAMRELSEVKD
1dq8D           -----AIGLGGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
3cd0D           CRAIGLGGGASSRVLADTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSI--AGR
3bglD           -----AIGLGGGASSRVLADGMTGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRARLQKSIAGR
1dqaC           -----RAIGLGGGASSRVRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
1dy1A           ----------------------------------------------------------------------
3cdaD           ---------GGGASSRVLADGMTRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGR
3ee8B           ----------------------------------------------------------------------
3ee8A           ----------------------------------------------------------------------
1dy0A           ----------------------------------------------------------------------
1dq9D           CRAIGLGGGASSRVLADGMTRGPVVRLPRACDS--AEVKAWLETSEGFAVITSRFARLQKLHTSI--AGR
3bmaF           ----------------------------------------------------------------------
3cd5A           -----------------TRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTFARLQKLHTSIAG--R


                         .         .         *         .         .         .         .:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
3d3fA           ELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSN
3b3dB           DLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSN
3b3dA           DLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSN
1afsA           DGTVKREDISTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFFETVDICDTWEAMEKCKDAGLAKSIGVSN
1a80A           DLFITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWPAADNYVHAWEKMIELRAAGLTRSIGVSN
3c3uA           DGSVKREDICNSHRPELVRPALERSLKNLQLDYVDLYLIHFFDTVDLCATWEAVEKCKDAGLAKSIGVSN
1az1A           ELFIVSKLWCTYHEKGLVKGACQKTLFKPGKEFFPLDESGNPSDTNILDTWAAMEELVDEGLVKAIGISN
2acsA           ELFIVSKLWCTYHEKGLVKGACQKTLFKPGKEFFPLDESGNPSDTNILDTWAAMEELVDEGLVKAIGISN
2dv0A           ELFIVSKLWCTYHEKGLVKGACQKTLFKPGKEFFPLDESGNVSDTNILDTWAAMEELVDEGLVKAIGISN
2acuA           ELFIVSKLWCTYHEKGLVKGACQKTLFKPGKEFFPLDESGNPSDTNILDTWAAMEELVDEGLVKAIGISN
3caqB           EIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMKSNLCATWEAMEACKDAGLVKSLGVSN
1ah3A           DLFIVSKLWCTDHEKNLVKGACQTTLRPGKDPFPLDGDGNVVPESDFVETWEAMEELVDEGLVKAIGVSN
3cv6A           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYFDRVDLCATWEAMEKCKDAGLTKSIGVSN
1adsA           ELFIVSKLWCTYHEKGLVKGACQKTLFKPGKEFFPLDESGNPSDTNILDTWAAMEELVDEGLVKAIGISN
3eb4A           SLVITTKIFWGGLSRKHIIEGLKASLERLQLEYVDVVFANRDPNTPMEETVRAMTHVINQGMAMYWGTSR
2alrA           PGKAVPREWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYSTHYKETWKALEALVAKGLVQALGLSN
2bgsA           ALFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWVLEFDMEGVWKEMENLVKDGLVKDIGVCN
3burA           EGKVRREDIATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVYHKSNLCATWEAMEACKDAGLVKSLGVSN
3eauA           SLVITTKIFWGGLSRKHIIEGLKASLERLQLEYVDVVFANRDPNTPMEETVRAMTHVINQGMAMYWGTSR
3eb3A           SLVITTKITERGLSRKHIIEGLKASLERLQLEYVDVVFANRPPNTPMEETVRAMTHVINQGMAMYWGTSR
1c9wA           DLFIVSKLWPTCFERKLLKEAFQKGLQPGKELFPKDDQGNVLSKITFLDAWEVMEELVDEGLVKALGVSN
1ah0A           DLFIVSKLWCTDHEKNLVKGACQTTLRPGKDPFPLDGDGNVVDESDFVETWEAMEELVDEGLVKAIGVSN
2bgqA           AGIDRKDLFVTNLAPERVRPALENTLKDLQLDYIDLYHIHWVLEFDMEGVWKEMENLVKDGLVKDIGVCN
2agtA           QVVKREELFCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFAAMEELVDEGLVKAIGISN
2bp1A           RVKIATKANPWDGKPDSVRSQLETSLKRLQCPQVDLFYLHAPDGTPVEETLHACQRLHQEGKFVELGLSN
2c91A           TVKIATKANPWEGKPDSIRSQLETSLKRLQCPRVDLFYLHAPHSTPVEETLCACHQLHQEGKFVELGLSN
2bp1B           RVKIATKADGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHTPVEETLHACQRLHQEGKFVELGLSN
3cv7A           PGKAVPREENTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYATHYKDTWKALEALVAKGLVRALGLSN
2c91B           TVKIATKANPWEGKPDSIRSQLETSLKRLQCPRVDLFYLHAPDSTPVEETLCACHQLHQEGKFVELGLSN
1dqaB           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
2clpA           RVKIDTKAFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMDHSTPVEETLRACHQLHQEGKFVELGLSN
3cd5C           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
3cctC           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
2ao0A           PGKAVPREENTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYATHYKDTWKALEALVAKGLVRALGLSN
1dq9C           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
2aicA           FVDEAVKQVAIRQDAEFGRQVYEATLCAIFSEAKDRFCMDPIEALGDAARATGLPGADKQGVFTPSGAGT
1dqaD           NLYIRFQSRSGDAMGMNMIKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVEAVIP
2clpI           RVKIDTKLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHPDHSTPVEETLRACHQLHQEGKFVELGLSN
1dq8C           NLYIRFQSRSGDAMGMNMIKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
3cd5D           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
2d4cB           SLDIEVKQNFHDKDLREIQSALQHHLKKLEGRRLDFDYKKKRQKIPDEELRQALEKFDESKEIAESSMFN
1dq8B           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
1dq8A           NLYIRFQSRSGDAMGMNMIKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVEAVIP
3cdbC           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
2d4cA           SLDIEVKQNFIDKDLREIQSALQHHLKKLEGRRLDFDYKKKRGKIPDEELRQALEKFDESKEIAESSMFN
3cdaA           NLYIRFQSSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVEAVIP
1dq9B           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
2d4cC           SLDIEVKQNFIDKDLREIQSALQHHLKKLEGRRLDFDYKKKRGKIPDEELRQALEKFDESKEIAESSMFN
1dq8D           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCAVIP
3cd0D           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVEAVIP
3bglD           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCAVIP
1dqaC           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
1dy1A           ------------------------------------PLAHTHQDFQPVLHLVALNTPLS-GGMRGIRGAD
3cdaD           NLYIRFQSRSGDAGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVI
3ee8B           ------------------------------------YITDMTIEE---LSRDWFMLMPKQKVEGPLCIRI
3ee8A           ------------------------------------YITDMTIEE---LSRDWFMLMPKQKVEGPLCIRI
1dy0A           ---------------------------------------HTHQDFQPVLHLVALNTPLS-GGMRGIRGAD
1dq9D           NLYIRFQSRSGDAMMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVEAVIP
3bmaF           ----------------------------------NLGAEKSAVATTIDSFKERKVRALSDPNVRFFGSSE
3cd5A           NLYIRFQSRSGDAMGMNMISGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVEAVIP


                         +         .         .         .         .         *         .:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
3d3fA           FQVHHLEELLKDA---EIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEAWSPLMQ-----GQLLDNEVLT
3b3dB           FQIHHLEDLMTAA---EIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQ-----GQLLDHPVLA
3b3dA           FQIHHLEDLMTAA---EIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQ-----GQLLDHPVLA
1afsA           FNCRQLERILNKPGL-KYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKSPVLLDDPVLC
1a80A           HLVPHLERIVAAT---GVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQGKYDLFGAEP---VT
3c3uA           FNRRQLEMILNKPGL-KYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREESPVLLEDPVLC
1az1A           FNH-LQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2acsA           FNHLQVEMILNKPGL-KYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGWAKPEDPSLLEDPRIK
2dv0A           FNHLQVEMILNKPGL-KYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGWAKPEDPSLLEDPRIK
2acuA           FNHLQVEMILNKPGL-KYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGWAKPEDPSLLEDPRIK
3caqB           FNRRQLELILNKPG-LKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGWVNVSSPPLLKDALLN
1ah3A           FNHLQVEKILNKPGL-KYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGWAKPEDPSLLEDPRIK
3cv6A           FNYRQLEMILNKPGL-KYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQRYPSPVLLDEPVLG
1adsA           FNHLQVEMILNKPGL-KYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGWAKPEDPSLLEDPRIK
3eb4A           WSSMEIMEAYSVANLIPPRCEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLACSEEGRRQQAKLKELQ
2alrA           FNSRQIDDILSVA---SVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLG-VLLEEP------VVL
2bgsA           YTVTKLNRLLRSA---KIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGSSEKNLA---HDPVVE
3burA           FNRRQLELILNKPGL-KHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLN
3eauA           WSSMEIMEAYSVANLIPPICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLACSEEGRRQQAKLKELQ
3eb3A           WSSMEIMEAYSVANLIPPICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAGIPPYSRASLKGYELQ
1c9wA           FNHFQIERILNKPGL-KHKPVTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGWAKPEDPSLLEDPKIK
1ah0A           FNHLQVEKILNKPGL-KYKPAVNQIEVHPYLTQEKLIEYCKSKGIVVTAYSPLGWAKPEDPSLLEDPRIK
2bgqA           YTVTKLNRLLRSA---KIPPAVCQMEMHPGWKNDKIFEACKKHGIHITAYSPLGKNLA------HDPVVE
2agtA           FNHLQVEMILNKPGLKYKPA-VNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSAKPEDPSLLEDPRIK
2bp1A           YASWEVAEICTLCGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGEHHFEAIALVEKALQ
2c91A           YASWEVAEICTLCGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKALQ
2bp1B           YASWEVAEICTLCGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGEHHFEAIALVEKALQ
3cv7A           FSSRQIDDVLSVA---SVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSRDPNEPVLLEEPVVQ
2c91B           YASWEVAEICTLCGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPLAGEHHFEAIALVEKALQ
1dqaB           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQNEDLYISCTMPSIEIG
2clpA           YAAWEVCTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGYKYEDKDGKQ
3cd5C           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDEDLYISCTMPSIEIG
3cctC           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQNEDLYISCTMPSIEIG
2ao0A           FSSRQIDDVLSVA---SVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSRDPNEPVLLEEPVVQ
1dq9C           PAKVVREAMIEVNINKNLVGSAMAGSIGGYNAHAIVTAIYIACGQDAAQNVGSSNEDLYISCTMPSIEIG
2aicA           NPLIRLRADTLMGAELAARPEYRELQPYARQAIDLVANALPAERSNTLVEFRQTVQ-TLEATYRRAAQDA
1dqaD           AKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIG-GYNAHAANIVTAIYIACGQNEDLYISCTMPSIEIG
2clpI           YAAWEVCTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGYKYEDKDGKQ
1dq8C           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDEDLYISCTMPSIEIG
3cd5D           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQNEDLYISCTMPSIEIG
2d4cB           LLE---MDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIR-------------------------
1dq8B           PAK-VVREVLKTTTEAMIEVNINKNLVGSAMAGIGGYNAHAANIVTAIYIACGQDAAQNVGSSMPSIEIG
1dq8A           AKVVREVLKTT-TEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDEDLYISCTMPSIEIG
3cdbC           PAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQVGSSNCITLMEASGIG
2d4cA           LLEMDIEQVSQLSAL---VQAQLEYHKQAVQILQQVTVRLEERIR-------------------------
3cdaA           AKVVREVLKTTTEA-MIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIAGPTNEDLYISCTMPSIEIG
1dq9B           PAK-VVREVLKTTTEAMIEVNINKNLVGSAMAGIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLIG
2d4cC           LLE---MDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIR-------------------------
1dq8D           AKVVRE-VLKTTTEAMIEVNINKNLVGYNAHAANIVTAIYSSNCITLMEASGPTNEDLYISCTMPSIEIG
3cd0D           AKV--VREVLKTTTEMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSMEASGIG
3bglD           AKVVRE-VLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLIG
1dqaC           PA--KVVREVLKTTTEAMIEVNINKNLVGSAMAGGGYNAHAANIVTAIYIACGQD---------------
1dy1A           FQCFQQARAVGLSGT-FRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGWH
3cdaD           PAKV-VREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITIG
3ee8B           DQAIMDKNIM-------LKANFSVIF--DRLETLILLRAFTEEGAIVGEISPLPS--FPGHTIEDKNAIG
3ee8A           DQAIMDKNIML-------KANFSVIFDRLE--TLILLRAFTEEGAIVGEISPLPS--FPGHTIEDKNAIG
1dy0A           FQCFQQARAVGLSGT-FRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPVWH
1dq9D           AKVVRVLKTTTEAMIEVNINKNLVGSAMAGSI--GGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLIG
3bmaF           WLRFDGAHPAVLAYLLGQGGAASLNQYFGMQQMLPQLENKQVVYVISPQWNGDQLTSFLKSGDQASQLVQ
3cd5A           AKVVRE----------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKXXXXXXXXXXXXXXSLRLSDEEIAAIDQAFPLGPEPASLPx
3d3fA           QIAEKHNKSVAQVILRWDLQHG-VVTIPKSIKEHRIIENADIFDFELSQEDMDKIDALERVGPNP-----
3b3dB           DIAQTYNKSVAQIILRWDLQHGI-ITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNRVGPDPDNFD-
3b3dA           DIAQTYNKSVAQIILRWDLQHGI-ITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNRVGPDPDNFD-
1afsA           AIAKKYKQTPALVALRYQLQRG-VVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNR----------
1a80A           AAAAAHGKTPAQAVLRWHLQKGF-VVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDPGDGSGR----
3c3uA           ALAKKHKRTPALIALRYQLQRGVV-VLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNR----------
1az1A           AIAAKHNKTTAQVLIRFPMQRNLV-VIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNR----------
2acsA           AIAAKHNKTTAQVLIRFPMQRNLV-VIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNR----------
2dv0A           AIAAKHNKTTAQVLIRFPMQRNLV-VIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNR----------
2acuA           AIAAKHNKTTAQVLIRFPMQRNLV-VIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNR----------
3caqB           SLGKRYNKTAAQIVLRFNIQRG-VVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEAL------------
1ah3A           AIAAKYNKTTAQVLIRFPMQRN-LIVIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNR----------
3cv6A           SMAKKYNRTPALIALRYQLQRG-IVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNR----------
1adsA           AIAAKHNKTTAQVLIRFPMQRN-LVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNR----------
3eb4A           AIAERLGCTLPQLAIAWCLRNEGVSSLLGASNAEQLMENIGAIQVKLSSSIVHEIDSIL-----------
2alrA           ALAEKYGRSPAQILLRWQVQRKVI-CIPKSITPSRILQNIKVFDFTFSPEEMKQLNALN-----------
2bgsA           KVANKLNKTPGQVLIKWALQRGT-SVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK-----------
3burA           SLGKRYNKTAAQIVLRFNIQRGVV-VIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNK----------
3eauA           AIAERLGCTLPQLAIAWCLRNEGVSSLLGASNAEQLMENIGAIQVKLSSSIVHEIDSIL-----------
3eb3A           AIAERLGCTLPQLAIAWLRNEGVSSVLLGASNAEQLMENIGAIQPKLSSSIVHEIDSIL-----------
1c9wA           EIAAKHKKTSAQVLIRFHIQRNVV-VIPKSVTPARIHENFQVFDFQLSDQEMATILGFN-----------
1ah0A           AIAAKYNKTTAQVLIRFPMQRNLI-VIPKSVTPERIAENFQVFDFELSPEDMNTLLSYNR----------
2bgqA           KVANKLNKTPGQVLIKWALQRG-TSVIPKSSKDERIKENIQVFGWEIPEEDFKVLCSIK-----------
2agtA           AIAAKHNKTTAQVLIRFPMQRNL-VVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVC-----
2bp1A           AAYGASAPSVTSAALRWMYHHSQLAVILGMSSLEQLEQNLAATEEPLEPAVVDAFNQAWHLVAHEC----
2c91A           TTYGTNAPRMTSAALRWMYHHSQLAVILGMSSLEQLEQNLAATEGPLEPAVVEAFDQAWNMVAHE-----
2bp1B           AAYGASAPSVTSAALRWMYHHSQLAVILGMSSLEQLEQNLAATEEPLEPAVVDAFNQAWHLVAHEC----
3cv7A           ALAEKYNRSPAQILLRWQVQRKV-ICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFI-----
2c91B           TTYGTNAPRMTSAALRWMYHHSQLQVILGMSSLEQLEQNLAATEEPLEPAVVEAFDQAWNMVAHEC----
1dqaB           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALAAGH-----------
2clpA           PVGRFFGNTWAEMYRNRYWKE-------------------------------------------------
3cd5C           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
3cctC           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
2ao0A           ALAEKYNRSPAQILLRWQ-VQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALN-----------
1dq9C           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALAAGH-----------
2aicA           SRDEKGATNAADGA--------------------------------------------------------
1dqaD           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
2clpI           PVGRFFGNTWAEMYRNR-----------------------------------------------------
1dq8C           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
3cd5D           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
2d4cB           ----------------------------------------------------------------------
1dq8B           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
1dq8A           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
3cdbC           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
2d4cA           ----------------------------------------------------------------------
3cdaA           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
1dq9B           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
2d4cC           ----------------------------------------------------------------------
1dq8D           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
3cd0D           TVGGGTNLLPQQACLQMLGVQ-------------------------------------------------
3bglD           TVGGGTNLLPQQACLQMLGVQGA-CKDNPGENARQLARIVCGTVMAGELSLMAALA--------------
1dqaC           ----------------------------------------------------------------------
1dy1A           GSDPSGRRLMESYCETWRTETTQASSLLSGRLLEQKAASCHNSYIVLCIENSF-----------------
3cdaD           TVGGGTNLLPQQACLQMLGVQ-------------------------------------------------
3ee8B           VLIGGLEWNDNTVRVS------------------------------------------------------
3ee8A           VLIGGLEWNDNTVRVSK-----------------------------------------------------
1dy0A           GSDPSGRRLMESYCETWRTETTQASSLLSGRLLEQKAASCHNSYIVLCIENSF-----------------
1dq9D           TVGGGTNLLPQQACLQMLGVQ-------------------------------------------------
3bmaF           KLASKEELSTADNEMIELLARFNERQAS--------FFGQFSGYVNYDKHVAKYLKI-------------
3cd5A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           x
3d3fA           -
3b3dB           -
3b3dA           -
1afsA           -
1a80A           -
3c3uA           -
1az1A           -
2acsA           -
2dv0A           -
2acuA           -
3caqB           -
1ah3A           -
3cv6A           -
1adsA           -
3eb4A           -
2alrA           -
2bgsA           -
3burA           -
3eauA           -
3eb3A           -
1c9wA           -
1ah0A           -
2bgqA           -
2agtA           -
2bp1A           -
2c91A           -
2bp1B           -
3cv7A           -
2c91B           -
1dqaB           -
2clpA           -
3cd5C           -
3cctC           -
2ao0A           -
1dq9C           -
2aicA           -
1dqaD           -
2clpI           -
1dq8C           -
3cd5D           -
2d4cB           -
1dq8B           -
1dq8A           -
3cdbC           -
2d4cA           -
3cdaA           -
1dq9B           -
2d4cC           -
1dq8D           -
3cd0D           -
3bglD           -
1dqaC           -
1dy1A           -
3cdaD           -
3ee8B           -
3ee8A           -
1dy0A           -
1dq9D           -
3bmaF           -
3cd5A           -