[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39592.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d3oB.bssp"
#ERROR : Can't open dsspfile "3d3oA.bssp"
#ERROR : Can't open dsspfile "3bjnA.bssp"
#ERROR : Can't open dsspfile "2cweA.bssp"
#ERROR : Can't open dsspfile "3dp7B.bssp"
#ERROR : Can't open dsspfile "2b0lA.bssp"
#ERROR : Can't open dsspfile "2acjC.bssp"
#ERROR : Can't open dsspfile "1czaN.bssp"

## Summary of PDB Search
:263
    6e-20  13%  3d3oB  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR, ICIR FAMILY
    1e-18  14%  3d3oA  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR, ICIR FAMILY
    1e-17  22%  3bjnA  [x.x.x] TRANSCRIPTIONAL REGULATOR, PUTATIVE
    2e-10  13%  2cweA  [x.x.x] HYPOTHETICAL TRANSCRIPTION REGULATOR PROTEIN,
    4e-06  20%  3dp7B  [x.x.x] SAM-DEPENDENT METHYLTRANSFERASE
    6e-04  13%  2b0lA  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    7e-04  23%  2acjC  [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
    7e-04  13%  1czaN  [c.55.1 - c.55.1 - c.55.1 - c.55.1] HEXOKINASE TYPE I
:263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxPLARYIDVLEVIAAFSGAITLADVSSILDLPKTTAHRLLKGLVRAGLAVEGDAGRSYYVGE
3d3oB           ----------------------------------------------------------------------
3d3oA           ----------------------------------------------------------------------
3bjnA           ----------------------------------------------------------------------
2cweA           ---------VMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVE
3dp7B           ----------LMLKFGIFQLLSGKREGYTLQEISGRTGLTRYAAQVLLEASLTIG---------------
2b0lA           -------------------------GLLVASKIADRVGITRSVIVNALRKLESAGVESRSLGMKGTYIKV
2acjC           ------------MEQRILKFLEELGKATTAHDLSGKLGTPKKEINRVLYSLAKKGK-LQKEAGTPPLW--
1czaN           -------------------------QVKKIDKYLYAMRLSDETLIDIFRKEMKNGLSRDFNPTATVKMLP


                         .         .         *         .         .         .         .:140
query           RLTRLLHAGADDGWYASLAGPHLRALTEASTETCYLARLIGSRVVVALSYSPDVRWRGYVQPGIEMPVNA
3d3oB           ---------------SSRDILEVLQDIHETGETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTS
3d3oA           ----------------FSSRDILEVLQDIHEETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTS
3bjnA           ----------------DAVEAVLSRLQKQTGEAAYVPVG-YRALCVSQRESQALRCS--FVQGQSQPLLR
2cweA           KYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYI
3dp7B           ----------------------------------------------------------------------
2b0lA           LNNKFLIE--------------------------------------------------------------
2acjC           KIAVS-----------------------------------------------------------------
1czaN           TFVRSIPDGSEKGDFIAL----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AATGKAIMAFQSKVLIAEALSHELPKPTINSHTSRKWIEQEFAKVRTNGYATCIGEIDEGLAAIAVPVRL
3d3oB           SNGWLSTNDKAI-----DNTVRRANTITQKDGIRFEVDDARIRQVREQGYASAEHIPFVGGGTICVLLPT
3d3oA           SNGWLSTNDKAI-----DNTVRRANTITQKDGIRFEVDDARIRQVREQGYASAEHIPFVGGGTICVLLPT
3bjnA           GASSKVLAYPAAR--------CEKILRYFGEDPTLDKWQSEFEKIRRHGYAVSTSEIDPGVSGISAPVKG
2cweA           EEKEDALKDFSNEDIIHAIEWL--------STAELARDEEYLELLKRLGSI-------------------
3dp7B           ----------------------------------------------------------------------
2b0lA           ----------------------------------------------------------------------
2acjC           ----------------------------------------------------------------------
1czaN           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PNGAVLHSVGMTGPLERIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d3oB           IQGQPVTGLGGALD---------------------------------------
3d3oA           IQGQPVTGLGGALDRIKQ-----------------------------------
3bjnA           SKLIGAISVAPAHRVES------------------------------------
2cweA           -----------------------------------------------------
3dp7B           -----------------------------------------------------
2b0lA           -----------------------------------------------------
2acjC           -----------------------------------------------------
1czaN           -----------------------------------------------------