[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2dwpA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3dmdC.bssp"
#ERROR : Can't open dsspfile "2dwoA.bssp"
#ERROR : Can't open dsspfile "3cmvH.bssp"
#ERROR : Can't open dsspfile "3cmvG.bssp"
#ERROR : Can't open dsspfile "1d1cA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ccgA.bssp"
#ERROR : Can't open dsspfile "1bifA.bssp"
#ERROR : Can't open dsspfile "3c95A.bssp"
#ERROR : Can't open dsspfile "2ccjB.bssp"
#ERROR : Can't open dsspfile "2bifA.bssp"
#ERROR : Can't open dsspfile "3cmvC.bssp"
#ERROR : Can't open dsspfile "4dcgA.bssp"
#ERROR : Can't open dsspfile "3dmdB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2c03B.bssp"
#ERROR : Can't open dsspfile "2c61B.bssp"
#ERROR : Can't open dsspfile "3eiuB.bssp"
#ERROR : Can't open dsspfile "3eiuA.bssp"
#ERROR : Can't open dsspfile "2ccgB.bssp"
#ERROR : Can't open dsspfile "2dr3A.bssp"
#ERROR : Can't open dsspfile "1e9cA.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "2a2zD.bssp"
#ERROR : Can't open dsspfile "1aroP.bssp"
#ERROR : Can't open dsspfile "2a30D.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2b8tA.bssp"
#ERROR : Can't open dsspfile "1cr4A.bssp"
#ERROR : Can't open dsspfile "2akaB.bssp"
#ERROR : Can't open dsspfile "2b8wA.bssp"
#ERROR : Can't open dsspfile "2cckA.bssp"
#ERROR : Can't open dsspfile "1e98A.bssp"
#ERROR : Can't open dsspfile "2c04A.bssp"
#ERROR : Can't open dsspfile "3cmvA.bssp"
#ERROR : Can't open dsspfile "3b85A.bssp"
#ERROR : Can't open dsspfile "3czpB.bssp"
#ERROR : Can't open dsspfile "3dm5A.bssp"
#ERROR : Can't open dsspfile "1e9fA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "2akaA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2a30B.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2dr3E.bssp"
#ERROR : Can't open dsspfile "2czvA.bssp"
#ERROR : Can't open dsspfile "2axzC.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1e9dA.bssp"
#ERROR : Can't open dsspfile "2a5gA.bssp"
#ERROR : Can't open dsspfile "3dt2A.bssp"
#ERROR : Can't open dsspfile "3cmxA.bssp"
#ERROR : Can't open dsspfile "1bg0A.bssp"
#ERROR : Can't open dsspfile "3b2qA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2c03A.bssp"
#ERROR : Can't open dsspfile "2ctsA.bssp"
#ERROR : Can't open dsspfile "3bpbA.bssp"
#ERROR : Can't open dsspfile "3b2qB.bssp"
#ERROR : Can't open dsspfile "2b8tB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2c61A.bssp"
#ERROR : Can't open dsspfile "2axpA.bssp"
#ERROR : Can't open dsspfile "2cgtH.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "3a1wA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "3dt7A.bssp"
#ERROR : Can't open dsspfile "2cjwB.bssp"
#ERROR : Can't open dsspfile "2dr3B.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "3c8uA.bssp"
#ERROR : Can't open dsspfile "2bdtA.bssp"
#ERROR : Can't open dsspfile "1e0jB.bssp"
#ERROR : Can't open dsspfile "2a2zB.bssp"
#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "2bc9A.bssp"
#ERROR : Can't open dsspfile "2a5jA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2bkhA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1e4yA.bssp"
#ERROR : Can't open dsspfile "3dt4A.bssp"
#ERROR : Can't open dsspfile "1e9sF.bssp"
#ERROR : Can't open dsspfile "1e9sG.bssp"
#ERROR : Can't open dsspfile "1cr1A.bssp"
#ERROR : Can't open dsspfile "3dtbB.bssp"
#ERROR : Can't open dsspfile "2b8tC.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "2a1fF.bssp"
#ERROR : Can't open dsspfile "1e3mA.bssp"
#ERROR : Can't open dsspfile "1dkiA.bssp"
#ERROR : Can't open dsspfile "2d4hA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "3bo6B.bssp"
#ERROR : Can't open dsspfile "2bwjA.bssp"
#ERROR : Can't open dsspfile "3cr7C.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "421pA.bssp"
#ERROR : Can't open dsspfile "1e0jA.bssp"
#ERROR : Can't open dsspfile "3cmtD.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2b92B.bssp"
#ERROR : Can't open dsspfile "1e9sJ.bssp"
#ERROR : Can't open dsspfile "1e9sD.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1e2fA.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2a30A.bssp"
#ERROR : Can't open dsspfile "3d7wA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "3bgwA.bssp"
#ERROR : Can't open dsspfile "1e9sB.bssp"
#ERROR : Can't open dsspfile "2anbA.bssp"
#ERROR : Can't open dsspfile "2c9oC.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "3cnlA.bssp"
#ERROR : Can't open dsspfile "2c0bL.bssp"
#ERROR : Can't open dsspfile "3dt4C.bssp"
#ERROR : Can't open dsspfile "3d3kA.bssp"
#ERROR : Can't open dsspfile "2a2zA.bssp"
#ERROR : Can't open dsspfile "2d4hB.bssp"
#ERROR : Can't open dsspfile "2bkiA.bssp"
#ERROR : Can't open dsspfile "3cddF.bssp"
#ERROR : Can't open dsspfile "2b8wB.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "2a1fD.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "3cmvE.bssp"
#ERROR : Can't open dsspfile "3cddD.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2d4uA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3bgwD.bssp"
#ERROR : Can't open dsspfile "2bx2L.bssp"
#ERROR : Can't open dsspfile "2cckB.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "3bb1B.bssp"
#ERROR : Can't open dsspfile "1cr2A.bssp"
#ERROR : Can't open dsspfile "3bwdD.bssp"
#ERROR : Can't open dsspfile "2dr3D.bssp"
#ERROR : Can't open dsspfile "3d3qA.bssp"
#ERROR : Can't open dsspfile "1dg3A.bssp"
#ERROR : Can't open dsspfile "2ancD.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1eilA.bssp"
#ERROR : Can't open dsspfile "3ecpA.bssp"
#ERROR : Can't open dsspfile "2an9A.bssp"
#ERROR : Can't open dsspfile "2bjbA.bssp"
#ERROR : Can't open dsspfile "1e3mB.bssp"
#ERROR : Can't open dsspfile "3cr7A.bssp"
#ERROR : Can't open dsspfile "3ec1A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1e2gA.bssp"
#ERROR : Can't open dsspfile "3cr7D.bssp"
#ERROR : Can't open dsspfile "1ak2A.bssp"
#ERROR : Can't open dsspfile "2bhjA.bssp"
#ERROR : Can't open dsspfile "3adkA.bssp"
#ERROR : Can't open dsspfile "3bczC.bssp"
#ERROR : Can't open dsspfile "1akeA.bssp"
#ERROR : Can't open dsspfile "2dr3C.bssp"
#ERROR : Can't open dsspfile "3ch4B.bssp"
#ERROR : Can't open dsspfile "1bglA.bssp"
#ERROR : Can't open dsspfile "1e9rE.bssp"
#ERROR : Can't open dsspfile "3clvA.bssp"
#ERROR : Can't open dsspfile "2c7cH.bssp"
#ERROR : Can't open dsspfile "3cddC.bssp"
#ERROR : Can't open dsspfile "1d6jB.bssp"
#ERROR : Can't open dsspfile "3cmwC.bssp"
#ERROR : Can't open dsspfile "1e9rD.bssp"
#ERROR : Can't open dsspfile "2c4rL.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "1e59A.bssp"
#ERROR : Can't open dsspfile "2cvfA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3bh0A.bssp"
#ERROR : Can't open dsspfile "3di4A.bssp"
#ERROR : Can't open dsspfile "2dr3F.bssp"
#ERROR : Can't open dsspfile "3dffA.bssp"
#ERROR : Can't open dsspfile "3dfpC.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2aunA.bssp"
#ERROR : Can't open dsspfile "4atjA.bssp"
#ERROR : Can't open dsspfile "3d3qB.bssp"
#ERROR : Can't open dsspfile "2aumA.bssp"
#ERROR : Can't open dsspfile "3da4A.bssp"
#ERROR : Can't open dsspfile "2ccjA.bssp"
#ERROR : Can't open dsspfile "2ausC.bssp"
#ERROR : Can't open dsspfile "3bb1A.bssp"
#ERROR : Can't open dsspfile "2ahwD.bssp"
#ERROR : Can't open dsspfile "2aumB.bssp"
#ERROR : Can't open dsspfile "2eg5G.bssp"
#ERROR : Can't open dsspfile "2aunB.bssp"
#ERROR : Can't open dsspfile "2a1fE.bssp"
#ERROR : Can't open dsspfile "1e9sM.bssp"
#ERROR : Can't open dsspfile "3dlbB.bssp"
#ERROR : Can't open dsspfile "3cr7B.bssp"
#ERROR : Can't open dsspfile "1e4vA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "3bb1E.bssp"
#ERROR : Can't open dsspfile "1av6A.bssp"
#ERROR : Can't open dsspfile "2ancB.bssp"
#ERROR : Can't open dsspfile "3dfnC.bssp"
#ERROR : Can't open dsspfile "3dfoD.bssp"
#ERROR : Can't open dsspfile "1e9rF.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3crmA.bssp"
#ERROR : Can't open dsspfile "3a00A.bssp"
#ERROR : Can't open dsspfile "2dftC.bssp"
#ERROR : Can't open dsspfile "2bofX.bssp"
#ERROR : Can't open dsspfile "2ck3C.bssp"
#ERROR : Can't open dsspfile "3dymA.bssp"
#ERROR : Can't open dsspfile "1cjaA.bssp"
#ERROR : Can't open dsspfile "3dfnA.bssp"
#ERROR : Can't open dsspfile "3dfqA.bssp"
#ERROR : Can't open dsspfile "1accA.bssp"
#ERROR : Can't open dsspfile "3e8aC.bssp"
#ERROR : Can't open dsspfile "3dfoC.bssp"
#ERROR : Can't open dsspfile "1e9sL.bssp"
#ERROR : Can't open dsspfile "1cs4C.bssp"
#ERROR : Can't open dsspfile "2b8tD.bssp"
#ERROR : Can't open dsspfile "2ancF.bssp"
#ERROR : Can't open dsspfile "1e9sH.bssp"
#ERROR : Can't open dsspfile "3dfqC.bssp"
#ERROR : Can't open dsspfile "3cnnA.bssp"
#ERROR : Can't open dsspfile "2ahvA.bssp"
#ERROR : Can't open dsspfile "1e2kA.bssp"
#ERROR : Can't open dsspfile "2dflA.bssp"
#ERROR : Can't open dsspfile "3dftD.bssp"
#ERROR : Can't open dsspfile "1eamA.bssp"
#ERROR : Can't open dsspfile "3cbnA.bssp"
#ERROR : Can't open dsspfile "2boeX.bssp"
#ERROR : Can't open dsspfile "3dfpD.bssp"
#ERROR : Can't open dsspfile "1adoA.bssp"
#ERROR : Can't open dsspfile "1culC.bssp"
#ERROR : Can't open dsspfile "3dfqD.bssp"
#ERROR : Can't open dsspfile "1e9sI.bssp"
#ERROR : Can't open dsspfile "1bmfC.bssp"
#ERROR : Can't open dsspfile "3dm9B.bssp"
#ERROR : Can't open dsspfile "3bjdB.bssp"
#ERROR : Can't open dsspfile "2bhvA.bssp"
#ERROR : Can't open dsspfile "2bkeA.bssp"
#ERROR : Can't open dsspfile "3dyoA.bssp"
#ERROR : Can't open dsspfile "2b0lC.bssp"
#ERROR : Can't open dsspfile "3be4A.bssp"
#ERROR : Can't open dsspfile "3cioD.bssp"
#ERROR : Can't open dsspfile "2a1fC.bssp"
#ERROR : Can't open dsspfile "3dfnD.bssp"
#ERROR : Can't open dsspfile "3c15C.bssp"
#ERROR : Can't open dsspfile "3dftC.bssp"
#ERROR : Can't open dsspfile "1cfrA.bssp"
#ERROR : Can't open dsspfile "3czjA.bssp"
#ERROR : Can't open dsspfile "2dftA.bssp"
#ERROR : Can't open dsspfile "1aldA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "3bb1F.bssp"
#ERROR : Can't open dsspfile "1dp0A.bssp"
#ERROR : Can't open dsspfile "3cmuA.bssp"
#ERROR : Can't open dsspfile "2d4uB.bssp"
#ERROR : Can't open dsspfile "2bhvD.bssp"
#ERROR : Can't open dsspfile "3bb1C.bssp"
#ERROR : Can't open dsspfile "1cjtC.bssp"
#ERROR : Can't open dsspfile "6aldA.bssp"
#ERROR : Can't open dsspfile "1c9kC.bssp"
#ERROR : Can't open dsspfile "3b55A.bssp"
#ERROR : Can't open dsspfile "3c7kA.bssp"
#ERROR : Can't open dsspfile "3cm0A.bssp"
#ERROR : Can't open dsspfile "3cueF.bssp"
#ERROR : Can't open dsspfile "3d1mB.bssp"
#ERROR : Can't open dsspfile "2bv7A.bssp"
#ERROR : Can't open dsspfile "1e9sE.bssp"
#ERROR : Can't open dsspfile "2e85A.bssp"
#ERROR : Can't open dsspfile "1dekB.bssp"
#ERROR : Can't open dsspfile "2czvB.bssp"
#ERROR : Can't open dsspfile "1e9rG.bssp"
#ERROR : Can't open dsspfile "1cjuC.bssp"
#ERROR : Can't open dsspfile "3d1mA.bssp"
#ERROR : Can't open dsspfile "1dvrA.bssp"
#ERROR : Can't open dsspfile "1e9rB.bssp"
#ERROR : Can't open dsspfile "3ed8A.bssp"
#ERROR : Can't open dsspfile "1azsC.bssp"
#ERROR : Can't open dsspfile "2c9gA.bssp"
#ERROR : Can't open dsspfile "2d7vA.bssp"
#ERROR : Can't open dsspfile "3cmvB.bssp"
#ERROR : Can't open dsspfile "1e2nA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3a00B.bssp"
#ERROR : Can't open dsspfile "3c14C.bssp"
#ERROR : Can't open dsspfile "1e1qB.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "2dpyB.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "3bv4A.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2e85B.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "3bb1H.bssp"
#ERROR : Can't open dsspfile "3bjqB.bssp"
#ERROR : Can't open dsspfile "3bb1G.bssp"
#ERROR : Can't open dsspfile "2cdnA.bssp"
#ERROR : Can't open dsspfile "3brwA.bssp"
#ERROR : Can't open dsspfile "2d7vB.bssp"
#ERROR : Can't open dsspfile "1ek0A.bssp"
#ERROR : Can't open dsspfile "1e2iA.bssp"
#ERROR : Can't open dsspfile "1cjvC.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "3dvlD.bssp"
#ERROR : Can't open dsspfile "3b9qA.bssp"
#ERROR : Can't open dsspfile "3dm5B.bssp"
#ERROR : Can't open dsspfile "2aexA.bssp"
#ERROR : Can't open dsspfile "3bm2B.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2dpyA.bssp"
#ERROR : Can't open dsspfile "1e9sA.bssp"
#ERROR : Can't open dsspfile "1e2lA.bssp"
#ERROR : Can't open dsspfile "1e2lB.bssp"
#ERROR : Can't open dsspfile "3dkvA.bssp"
#ERROR : Can't open dsspfile "3dfdA.bssp"
#ERROR : Can't open dsspfile "1e2mB.bssp"
#ERROR : Can't open dsspfile "2bwjB.bssp"
#ERROR : Can't open dsspfile "1dw9A.bssp"
#ERROR : Can't open dsspfile "2c5mD.bssp"
#ERROR : Can't open dsspfile "1e2jA.bssp"
#ERROR : Can't open dsspfile "1chdA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3b85B.bssp"
#ERROR : Can't open dsspfile "1e2jB.bssp"
#ERROR : Can't open dsspfile "3ci2A.bssp"
#ERROR : Can't open dsspfile "1e9sK.bssp"
#ERROR : Can't open dsspfile "3cddA.bssp"
#ERROR : Can't open dsspfile "1e2nB.bssp"
#ERROR : Can't open dsspfile "1e2mA.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "2dx7A.bssp"
#ERROR : Can't open dsspfile "2a78A.bssp"
#ERROR : Can't open dsspfile "3cphA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"
#ERROR : Can't open dsspfile "2bwjD.bssp"
#ERROR : Can't open dsspfile "3bs4A.bssp"
#ERROR : Can't open dsspfile "3c85A.bssp"
#ERROR : Can't open dsspfile "1d6aA.bssp"
#ERROR : Can't open dsspfile "2bhvC.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "3cbqA.bssp"
#ERROR : Can't open dsspfile "2c95B.bssp"
#ERROR : Can't open dsspfile "3bb1D.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "3cr8B.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1agpA.bssp"
#ERROR : Can't open dsspfile "2awiA.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2atxA.bssp"
#ERROR : Can't open dsspfile "3cqcA.bssp"
#ERROR : Can't open dsspfile "221pA.bssp"
#ERROR : Can't open dsspfile "2cxxB.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "3bfkB.bssp"

## Summary of PDB Search
:235
    2e-39  25%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-35   9%  2dwpA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    5e-34  22%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    7e-34   7%  3dmdC  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    2e-33   8%  2dwoA  [x.x.x] 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-
    2e-33  14%  3cmvH  [x.x.x] PROTEIN RECA
    2e-33  11%  3cmvG  [x.x.x] PROTEIN RECA
    6e-33  10%  1d1cA  [c.37.1 - b.34.3] MYOSIN
    2e-32  24%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN
    3e-32  11%  2ccgA  [x.x.x] THYMIDYLATE KINASE
    2e-31  11%  1bifA  [c.37.1 - c.60.1 (3bifA)] 6-PHOSPHOFRUCTO-2-KINASE/
    2e-31  11%  3c95A  [x.x.x] EXODEOXYRIBONUCLEASE I
    6e-31   9%  2ccjB  [x.x.x] THYMIDYLATE KINASE
    8e-31  11%  2bifA  [c.37.1 - c.60.1] PROTEIN
    8e-31  13%  3cmvC  [x.x.x] PROTEIN RECA
    9e-31   8%  4dcgA  [x.x.x] VP39
    1e-30   8%  3dmdB  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    3e-30  22%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-30  16%  2c03B  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    1e-29   7%  2c61B  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    4e-29   7%  3eiuB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-29   8%  3eiuA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    9e-29  10%  2ccgB  [x.x.x] THYMIDYLATE KINASE
    1e-28  14%  2dr3A  [x.x.x] UPF0273 PROTEIN PH0284
    2e-28   8%  1e9cA  [c.37.1] THYMIDYLATE KINASE
    2e-28  10%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    7e-28  10%  2a2zD  [x.x.x] DEOXYCYTIDINE KINASE
    1e-27   8%  1aroP  [e.8.1] T7 RNA POLYMERASE
    1e-26   9%  2a30D  [x.x.x] DEOXYCYTIDINE KINASE
    2e-26  13%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-26  11%  2b8tA  [x.x.x] THYMIDINE KINASE
    2e-26  11%  1cr4A  [c.37.1] DNA PRIMASE/HELICASE
    4e-26  14%  2akaB  [x.x.x] DYNAMIN-1
    1e-25  11%  2b8wA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-25  12%  2cckA  [x.x.x] THYMIDYLATE KINASE
    1e-25  10%  1e98A  [c.37.1] THYMIDYLATE KINASE
    1e-25  17%  2c04A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    2e-25  15%  3cmvA  [x.x.x] PROTEIN RECA
    3e-25  13%  3b85A  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    4e-25  10%  3czpB  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    5e-25  10%  3dm5A  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    6e-25  11%  1e9fA  [c.37.1] THYMIDYLATE KINASE
    8e-25  17%  1e69A  [c.37.1] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-24   8%  2akaA  [x.x.x] MYOSIN II HEAVY CHAIN
    1e-24  28%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    2e-24  24%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-24  10%  2a30B  [x.x.x] DEOXYCYTIDINE KINASE
    3e-24  23%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-24  26%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-24  12%  2dr3E  [x.x.x] UPF0273 PROTEIN PH0284
    5e-24   8%  2czvA  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    7e-24   9%  2axzC  [x.x.x] PRGX
    9e-24  24%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-23  11%  1e9dA  [c.37.1] THYMIDYLATE KINASE
    1e-23  10%  2a5gA  [x.x.x] ADP-RIBOSYLATION FACTOR 6
    2e-23  11%  3dt2A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    3e-23  13%  3cmxA  [x.x.x] PROTEIN RECA
    3e-23  11%  1bg0A  [a.83.1 - d.128.1 (1m15A)] ARGININE KINASE
    4e-23   7%  3b2qA  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    6e-23  26%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-23  14%  2c03A  [x.x.x] SIGNAL RECOGNITION PARTICLE PROTEIN
    8e-23   9%  2ctsA  [x.x.x] CITRATE SYNTHASE
    8e-23  13%  3bpbA  [x.x.x] DIMETHYLARGININE DIMETHYLAMINOHYDROLASE
    1e-22   7%  3b2qB  [x.x.x] V-TYPE ATP SYNTHASE BETA CHAIN
    1e-22  10%  2b8tB  [x.x.x] THYMIDINE KINASE
    2e-22  22%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-22   7%  2c61A  [x.x.x] A-TYPE ATP SYNTHASE NON-CATALYTIC SUBUNIT B
    2e-22  12%  2axpA  [x.x.x] HYPOTHETICAL PROTEIN BSU20280
    4e-22  10%  2cgtH  [x.x.x] 60 KDA GROEL
    5e-22  14%  1e9rA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-22   8%  1e2dA  [c.37.1] THYMIDYLATE KINASE
    1e-21  12%  3a1wA  [x.x.x] IRON(II) TRANSPORT PROTEIN B
    1e-21  13%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-21  15%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-21  10%  3dt7A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-21  14%  2cjwB  [x.x.x] GTP-BINDING PROTEIN GEM
    2e-21  11%  2dr3B  [x.x.x] UPF0273 PROTEIN PH0284
    2e-21  27%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-21  15%  3c8uA  [x.x.x] FRUCTOKINASE
    7e-21  12%  2bdtA  [x.x.x] BH3686
    9e-21   7%  1e0jB  [c.37.1] DNA HELICASE
    1e-20  10%  2a2zB  [x.x.x] DEOXYCYTIDINE KINASE
    1e-20  11%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    1e-20  11%  2bc9A  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    2e-20  11%  2a5jA  [x.x.x] RAS-RELATED PROTEIN RAB-2B
    2e-20  22%  2d2fA  [x.x.x] SUFC PROTEIN
    2e-20   8%  2bkhA  [x.x.x] UNCONVENTIONAL MYOSIN
    3e-20  28%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-20  28%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    5e-20  10%  1e6cA  [c.37.1] SHIKIMATE KINASE
    5e-20  11%  1e4yA  [c.37.1 - g.41.2] ADENYLATE KINASE
    5e-20  10%  3dt4A  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-20  12%  1e9sF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-20  11%  1e9sG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-20  12%  1cr1A  [c.37.1] DNA PRIMASE/HELICASE
    8e-20   9%  3dtbB  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    1e-19   9%  2b8tC  [x.x.x] THYMIDINE KINASE
    1e-19  10%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    1e-19  18%  2a1fF  [x.x.x] URIDYLATE KINASE
    2e-19   9%  1e3mA  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-19   9%  1dkiA  [d.3.1] PYROGENIC EXOTOXIN B ZYMOGEN
    2e-19  10%  2d4hA  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    3e-19  13%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-19  12%  3bo6B  [x.x.x] HYDROPHILIC PROTEIN, VIRA PROTEIN
    3e-19  12%  2bwjA  [x.x.x] ADENYLATE KINASE 5
    4e-19  11%  3cr7C  [x.x.x] ADENYLYL-SULFATE KINASE
    5e-19  25%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    6e-19   9%  421pA  [x.x.x] H-RAS P21 PROTEIN
    7e-19   7%  1e0jA  [c.37.1] DNA HELICASE
    7e-19  14%  3cmtD  [x.x.x] PROTEIN RECA
    7e-19  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-19   9%  2b92B  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    7e-19  13%  1e9sJ  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    7e-19  12%  1e9sD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    9e-19  11%  1d6jA  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-18  12%  1e2fA  [c.37.1] THYMIDYLATE KINASE
    1e-18  10%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    2e-18  10%  2a30A  [x.x.x] DEOXYCYTIDINE KINASE
    2e-18  12%  3d7wA  [x.x.x] BETA-GALACTOSIDE-SPECIFIC LECTIN 1
    2e-18  14%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    2e-18  12%  3bgwA  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    2e-18  13%  1e9sB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-18  11%  2anbA  [x.x.x] GUANYLATE KINASE
    3e-18  12%  2c9oC  [x.x.x] RUVB-LIKE 1
    3e-18  13%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-18  13%  3cnlA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    6e-18   8%  2c0bL  [x.x.x] RIBONUCLEASE E
    6e-18  12%  3dt4C  [x.x.x] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    6e-18  10%  3d3kA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    6e-18   9%  2a2zA  [x.x.x] DEOXYCYTIDINE KINASE
    1e-17  10%  2d4hB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-17  11%  2bkiA  [x.x.x] UNCONVENTIONAL MYOSIN
    1e-17   9%  3cddF  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-17   9%  2b8wB  [x.x.x] INTERFERON-INDUCED GUANYLATE-BINDING PROTEIN 1
    1e-17  14%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-17  16%  2a1fD  [x.x.x] URIDYLATE KINASE
    1e-17  11%  1cr0A  [c.37.1] DNA PRIMASE/HELICASE
    2e-17  10%  3cmvE  [x.x.x] PROTEIN RECA
    2e-17  12%  3cddD  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    2e-17  23%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-17  14%  2d4uA  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    3e-17  13%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-17  10%  3bgwD  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-17   7%  2bx2L  [x.x.x] RIBONUCLEASE E
    3e-17  10%  2cckB  [x.x.x] THYMIDYLATE KINASE
    3e-17  26%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-17  13%  3bb1B  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-17  11%  1cr2A  [c.37.1] DNA PRIMASE/HELICASE
    1e-16  14%  3bwdD  [x.x.x] RAC-LIKE GTP-BINDING PROTEIN ARAC6
    1e-16  11%  2dr3D  [x.x.x] UPF0273 PROTEIN PH0284
    1e-16  12%  3d3qA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-16  11%  1dg3A  [c.37.1 - a.114.1] PROTEIN (INTERFERON-INDUCED
    1e-16  11%  2ancD  [x.x.x] GUANYLATE KINASE
    1e-16  14%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-16  10%  1eilA  [d.32.1 - d.32.1] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE
    1e-16  13%  3ecpA  [x.x.x] TN5 TRANSPOSASE
    2e-16  11%  2an9A  [x.x.x] GUANYLATE KINASE
    2e-16  13%  2bjbA  [x.x.x] 3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
    2e-16  11%  1e3mB  [d.75.2 - c.55.6 - a.113.1 - c.37.1] DNA MISMATCH REPAIR
    2e-16  11%  3cr7A  [x.x.x] ADENYLYL-SULFATE KINASE
    2e-16   8%  3ec1A  [x.x.x] YQEH GTPASE
    2e-16   6%  1afrA  [a.25.1] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-16  10%  1e2gA  [c.37.1] THYMIDYLATE KINASE
    3e-16  12%  3cr7D  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-16  10%  1ak2A  [x.x.x] ADENYLATE KINASE ISOENZYME-2
    3e-16  10%  2bhjA  [x.x.x] NITRIC OXIDE SYNTHASE
    3e-16  11%  3adkA  [x.x.x] ADENYLATE KINASE
    4e-16   8%  3bczC  [x.x.x] PROTEIN MEMO1
    4e-16  14%  1akeA  [c.37.1 - g.41.2] ADENYLATE KINASE
    4e-16  10%  2dr3C  [x.x.x] UPF0273 PROTEIN PH0284
    5e-16  11%  3ch4B  [x.x.x] PHOSPHOMEVALONATE KINASE
    5e-16   6%  1bglA  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    7e-16  10%  1e9rE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-16   8%  3clvA  [x.x.x] RAB5 PROTEIN, PUTATIVE
    9e-16  12%  2c7cH  [x.x.x] 60 KDA CHAPERONIN
    1e-15  11%  3cddC  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    1e-15  13%  1d6jB  [c.37.1] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-15  17%  3cmwC  [x.x.x] PROTEIN RECA
    1e-15  10%  1e9rD  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-15   7%  2c4rL  [x.x.x] RIBONUCLEASE E
    2e-15  14%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-15  12%  1e59A  [c.60.1] PHOSPHOGLYCERATE MUTASE
    2e-15  12%  2cvfA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
    2e-15  26%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-15   9%  3bh0A  [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
    3e-15   6%  3di4A  [x.x.x] UNCHARACTERIZED PROTEIN DUF1989
    3e-15  13%  2dr3F  [x.x.x] UPF0273 PROTEIN PH0284
    3e-15   6%  3dffA  [x.x.x] TEICOPLANIN PSEUDOAGLYCONE DEACETYLASES ORF2
    3e-15  10%  3dfpC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-15  25%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-15  12%  2aunA  [x.x.x] HYPOTHETICAL PROTEIN
    5e-15  13%  4atjA  [a.93.1] PROTEIN (PEROXIDASE C1A)
    7e-15  10%  3d3qB  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    8e-15  12%  2aumA  [x.x.x] HYPOTHETICAL PROTEIN
    8e-15  11%  3da4A  [x.x.x] COLICIN-M
    9e-15  10%  2ccjA  [x.x.x] THYMIDYLATE KINASE
    1e-14   8%  2ausC  [x.x.x] PSEUDOURIDINE SYNTHASE
    1e-14  16%  3bb1A  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-14  10%  2ahwD  [x.x.x] PUTATIVE ENZYME YDIF
    1e-14  12%  2aumB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-14   9%  2eg5G  [x.x.x] XANTHOSINE METHYLTRANSFERASE
    2e-14  11%  2aunB  [x.x.x] HYPOTHETICAL PROTEIN
    2e-14  17%  2a1fE  [x.x.x] URIDYLATE KINASE
    2e-14  13%  1e9sM  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-14  12%  3dlbB  [x.x.x] ARGONAUTE
    2e-14  11%  3cr7B  [x.x.x] ADENYLYL-SULFATE KINASE
    3e-14  11%  1e4vA  [c.37.1 - g.41.2] ADENYLATE KINASE
    3e-14  12%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    5e-14  16%  3bb1E  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    5e-14   7%  1av6A  [c.66.1] PROTEIN (VP39 PROTEIN (E.C.2.7.7.19))
    6e-14  11%  2ancB  [x.x.x] GUANYLATE KINASE
    6e-14  10%  3dfnC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-14  10%  3dfoD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-14  14%  1e9rF  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-14  15%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-14  15%  3crmA  [x.x.x] TRNA DELTA(2)-ISOPENTENYLPYROPHOSPHATE
    1e-13  13%  3a00A  [x.x.x] GUANYLATE KINASE
    1e-13  16%  2dftC  [x.x.x] SHIKIMATE KINASE
    1e-13   9%  2bofX  [x.x.x] ENDOGLUCANASE E-2
    1e-13   9%  2ck3C  [x.x.x] ATP SYNTHASE ALPHA CHAIN HEART ISOFORM
    1e-13   7%  3dymA  [x.x.x] BETA-GALACTOSIDASE
    1e-13   7%  1cjaA  [d.144.1] PROTEIN (ACTIN-FRAGMIN KINASE)
    1e-13  10%  3dfnA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13  10%  3dfqA  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-13  10%  1accA  [x.x.x] ANTHRAX PROTECTIVE ANTIGEN
    2e-13  10%  3e8aC  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-13  10%  3dfoC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-13  11%  1e9sL  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    2e-13  15%  1cs4C  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-13  10%  2b8tD  [x.x.x] THYMIDINE KINASE
    2e-13  10%  2ancF  [x.x.x] GUANYLATE KINASE
    3e-13  14%  1e9sH  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-13  10%  3dfqC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    4e-13  13%  3cnnA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-13   8%  2ahvA  [x.x.x] PUTATIVE ENZYME YDIF
    4e-13  12%  1e2kA  [c.37.1] THYMIDINE KINASE
    4e-13  12%  2dflA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    4e-13  10%  3dftD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    5e-13  11%  1eamA  [c.66.1] PROTEIN (VP39)
    5e-13   8%  3cbnA  [x.x.x] CONSERVED PROTEIN MTH639
    6e-13  14%  2boeX  [x.x.x] ENDOGLUCANASE E-2
    6e-13  10%  3dfpD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-13  11%  1adoA  [c.1.10] ALDOLASE
    7e-13  15%  1culC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    7e-13  10%  3dfqD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    7e-13  15%  1e9sI  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    8e-13   8%  1bmfC  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    8e-13  10%  3dm9B  [x.x.x] SIGNAL RECOGNITION PARTICLE RECEPTOR
    9e-13  13%  3bjdB  [x.x.x] PUTATIVE 3-OXOACYL-(ACYL-CARRIER-PROTEIN)
    1e-12  15%  2bhvA  [x.x.x] COMB10
    1e-12  11%  2bkeA  [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
    1e-12   6%  3dyoA  [x.x.x] BETA-GALACTOSIDASE
    1e-12  11%  2b0lC  [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
    1e-12  12%  3be4A  [x.x.x] ADENYLATE KINASE
    1e-12   5%  3cioD  [x.x.x] TYROSINE-PROTEIN KINASE ETK
    1e-12  18%  2a1fC  [x.x.x] URIDYLATE KINASE
    2e-12  11%  3dfnD  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-12  12%  3c15C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    2e-12  10%  3dftC  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    2e-12  13%  1cfrA  [x.x.x] RESTRICTION ENDONUCLEASE
    2e-12   6%  3czjA  [x.x.x] BETA-GALACTOSIDASE
    2e-12  15%  2dftA  [x.x.x] SHIKIMATE KINASE
    2e-12  11%  1aldA  [c.1.10 (2aldA)] ALDOLASE A
    3e-12  25%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-12  15%  3bb1F  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-12   6%  1dp0A  [b.18.1 - b.1.4 - c.1.8 - b.1.4 - b.30.5] BETA-GALACTOSIDASE
    3e-12  14%  3cmuA  [x.x.x] PROTEIN RECA
    5e-12  17%  2d4uB  [x.x.x] METHYL-ACCEPTING CHEMOTAXIS PROTEIN I
    6e-12  16%  2bhvD  [x.x.x] COMB10
    6e-12  15%  3bb1C  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    6e-12  15%  1cjtC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-11  11%  6aldA  [c.1.10] FRUCTOSE-1,6-BIS(PHOSPHATE) ALDOLASE
    2e-11   7%  1c9kC  [c.37.1] ADENOSYLCOBINAMIDE KINASE
    2e-11  14%  3b55A  [x.x.x] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN
    2e-11  12%  3c7kA  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(O) SUBUNIT
    2e-11  14%  3cm0A  [x.x.x] ADENYLATE KINASE
    3e-11  12%  3cueF  [x.x.x] GTP-BINDING PROTEIN YPT1
    3e-11   9%  3d1mB  [x.x.x] SONIC HEDGEHOG PROTEIN
    4e-11  13%  2bv7A  [x.x.x] GLYCOLIPID TRANSFER PROTEIN
    4e-11  12%  1e9sE  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    6e-11  11%  2e85A  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    7e-11   9%  1dekB  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    7e-11  13%  2czvB  [x.x.x] RIBONUCLEASE P PROTEIN COMPONENT 3
    9e-11  11%  1e9rG  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    1e-10  12%  1cjuC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    2e-10  13%  3d1mA  [x.x.x] SONIC HEDGEHOG PROTEIN
    2e-10  11%  1dvrA  [c.37.1 - g.41.2] ADENYLATE KINASE
    2e-10  12%  1e9rB  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-10  12%  3ed8A  [x.x.x] YELLOW FLUORESCENCE PROTEIN
    3e-10  11%  1azsC  [c.37.1 - a.66.1] GS-ALPHA
    4e-10  11%  2c9gA  [x.x.x] PENTON PROTEIN
    4e-10  16%  2d7vA  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    6e-10  15%  3cmvB  [x.x.x] PROTEIN RECA
    6e-10  11%  1e2nA  [c.37.1] THYMIDINE KINASE
    6e-10  12%  1e2iB  [c.37.1] THYMIDINE KINASE
    7e-10  13%  3a00B  [x.x.x] GUANYLATE KINASE
    8e-10  13%  3c14C  [x.x.x] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S) SUBUNIT
    8e-10   9%  1e1qB  [b.49.1 - c.37.1 - a.69.1] BOVINE MITOCHONDRIAL F1-ATPASE
    1e-09  11%  1e2hB  [c.37.1] THYMIDINE KINASE
    1e-09  14%  2dpyB  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    1e-09  10%  1dekA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-09  11%  3bv4A  [x.x.x] FRUCTOSE-BISPHOSPHATE ALDOLASE A
    1e-09  19%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-09  18%  2e85B  [x.x.x] HYDROGENASE 3 MATURATION PROTEASE
    2e-09   9%  1ckvA  [x.x.x] PROTEIN (PROTEIN B)
    2e-09  21%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  14%  3bb1H  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    3e-09  13%  3bjqB  [x.x.x] PHAGE-RELATED PROTEIN
    4e-09  13%  3bb1G  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    4e-09  15%  2cdnA  [x.x.x] ADENYLATE KINASE
    6e-09   8%  3brwA  [x.x.x] RAP1 GTPASE-ACTIVATING PROTEIN 1
    8e-09  17%  2d7vB  [x.x.x] HYPOTHETICAL PROTEIN VCA0330
    1e-08  12%  1ek0A  [c.37.1] PROTEIN (GTP-BINDING PROTEIN YPT51)
    1e-08  13%  1e2iA  [c.37.1] THYMIDINE KINASE
    3e-08  19%  1cjvC  [c.37.1 - a.66.1] GUANINE NUCLEOTIDE-BINDING PROTEIN G(S)
    3e-08  10%  1bccF  [f.27.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    9e-08   9%  3dvlD  [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
    9e-08  12%  3b9qA  [x.x.x] CHLOROPLAST SRP RECEPTOR HOMOLOG, ALPHA SUBUNIT
    1e-07  10%  3dm5B  [x.x.x] SIGNAL RECOGNITION 54 KDA PROTEIN
    1e-07  11%  2aexA  [x.x.x] COPROPORPHYRINOGEN III OXIDASE, MITOCHONDRIAL
    1e-07  10%  3bm2B  [x.x.x] PROTEIN YDJA
    2e-07  12%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-07  17%  2dpyA  [x.x.x] FLAGELLUM-SPECIFIC ATP SYNTHASE
    3e-07  18%  1e9sA  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-07   9%  1e2lA  [c.37.1] THYMIDINE KINASE
    4e-07  11%  1e2lB  [c.37.1] THYMIDINE KINASE
    4e-07  12%  3dkvA  [x.x.x] ADENYLATE KINASE
    4e-07   7%  3dfdA  [x.x.x] PROTEIN YQBN
    5e-07  11%  1e2mB  [c.37.1] THYMIDINE KINASE
    5e-07  14%  2bwjB  [x.x.x] ADENYLATE KINASE 5
    5e-07  12%  1dw9A  [a.35.1 - d.72.1] CYANATE LYASE
    6e-07  11%  2c5mD  [x.x.x] CTP SYNTHASE
    7e-07  12%  1e2jA  [c.37.1] THYMIDINE KINASE
    7e-07  14%  1chdA  [x.x.x] CHEB METHYLESTERASE
    1e-06  14%  1d8jA  [a.4.5] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-06  10%  3b85B  [x.x.x] PHOSPHATE STARVATION-INDUCIBLE PROTEIN
    1e-06  14%  1e2jB  [c.37.1] THYMIDINE KINASE
    3e-06  13%  3ci2A  [x.x.x] CHYMOTRYPSIN INHIBITOR 2
    3e-06  14%  1e9sK  [c.37.1] CONJUGAL TRANSFER PROTEIN TRWB
    3e-06  12%  3cddA  [x.x.x] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN
    4e-06  13%  1e2nB  [c.37.1] THYMIDINE KINASE
    4e-06  12%  1e2mA  [c.37.1] THYMIDINE KINASE
    4e-06   7%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    7e-06   8%  2dx7A  [x.x.x] ASPARTATE RACEMASE
    8e-06   9%  2a78A  [x.x.x] RAS-RELATED PROTEIN RAL-A
    1e-05  11%  3cphA  [x.x.x] RAS-RELATED PROTEIN SEC4
    1e-05  23%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
    1e-05  18%  2bwjD  [x.x.x] ADENYLATE KINASE 5
    1e-05  11%  3bs4A  [x.x.x] UNCHARACTERIZED PROTEIN PH0321
    3e-05  12%  3c85A  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    3e-05   8%  1d6aA  [d.165.1] POKEWEED ANTIVIRAL PROTEIN
    4e-05   9%  2bhvC  [x.x.x] COMB10
    5e-05  18%  1e2hA  [c.37.1] THYMIDINE KINASE
    7e-05  31%  3cbqA  [x.x.x] GTP-BINDING PROTEIN REM 2
    8e-05  20%  2c95B  [x.x.x] ADENYLATE KINASE 1
    1e-04  14%  3bb1D  [x.x.x] TRANSLOCASE OF CHLOROPLAST 34
    1e-04  15%  1dwmA  [d.40.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-04  10%  3cr8B  [x.x.x] SULFATE ADENYLYLTRANFERASE, ADENYLYLSULFATE
    2e-04  18%  1ckeA  [c.37.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    3e-04  10%  1agpA  [x.x.x] C-H-RAS P21 PROTEIN
    3e-04  22%  2awiA  [x.x.x] PRGX
    3e-04   7%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    4e-04  30%  2atxA  [x.x.x] SMALL GTP BINDING PROTEIN TC10
    4e-04  10%  3cqcA  [x.x.x] NUCLEAR PORE COMPLEX PROTEIN NUP107
    5e-04  17%  221pA  [x.x.x] H-RAS P21 PROTEIN
    6e-04  33%  2cxxB  [x.x.x] PROBABLE GTP-BINDING PROTEIN ENGB
    8e-04  11%  1e6vC  [d.58.31] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    9e-04  14%  3bfkB  [x.x.x] SMALL GTPASE RAB11
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST
2d3wB           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDLLALSP
2dwpA           ---------------RVQKIWVPVDHRNSIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREA
3b5jA           -----------DSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADP
3dmdC           -----SEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGA
2dwoA           -SRVQKIWVPVDH-RPSLPRSCGPNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREA
3cmvH           -DRSMDVETISTGSLSLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
3cmvG           EDRSMDVETISTGSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
1d1cA           RRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQAGVLEQQILQA
3b60A           DLEFRNVTFTYPGRPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTL
2ccgA           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
1bifA           --------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDM
3c95A           HPENRNAVIMVDLAGDISPLLELDSDTLRAVPVKLVHINKCPVLAQANTLRPEDADRLGINRQHCLDNLK
2ccjB           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
2bifA           --------------------------PTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDM
3cmvC           EDRSMDVETISTLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
4dcgA           ---------------------LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDP
3dmdB           VKEAVSEILETSRRIDLIEEIRKAEKPYVIMFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFRAGA
2bbsA           -EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
2c03B           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAA
2c61B           ---RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
3eiuB           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
3eiuA           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
2ccgB           --------------------------SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
2dr3A           --------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
1e9cA           --------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
2c9yA           --------------------------GIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGS
2a2zD           --------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
1aroP           ----------------------------------------------------------------------
2a30D           --------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
2awnD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2b8tA           --------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDTRSI
1cr4A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE
2akaB           MEDLIPLVNRLQDAFSAIGQNADLD-LPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLV
2b8wA           MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMW
2cckA           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
1e98A           --------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
2c04A           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAA
3cmvA           ---------------SLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
3b85A           --------VIRPKTLGQKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRIILTRPAVEAGE
3czpB           ----------QARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERA
3dm5A           -----------KFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGA
1e9fA           --------------------------GALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
1e69A           -----------KGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGS
2akaA           -----------AISDVAYRSMLDDRQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQI
1b0uA           KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRD
2d3wC           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTVKGKDLLALSP
2a30B           --------------------------IKKISIEGNIAAGKSTFVNILKWEVVPEPVARWCNVQSTNVLQM
2d62A           -VKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEEPTRGQIYIEDNLVADPEKG
2d3wD           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGRYEVTGGTVEFKGKDLLALSP
2dr3E           --------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQ-
2czvA           ---------------GVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLS
2axzC           ----------------------------------------------------------------------
2d3wA           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGTLALSPEDRAGE
1e9dA           --------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
2a5gA           --------------------------EMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKN
3dt2A           ----------LAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
3cmxA           --------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
1bg0A           -----NKKTGMGATLLDVIQSGVENLDSGVGIYAPDAESYRTFGPLFDPIIDDYHGGFKLTDKHPPKQWG
3b2qA           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
2awnB           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2c03A           -VILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAA
2ctsA           -----------NLKDILADLKEQARIKTFRQQHGNTAVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIR
3bpbA           -------LVDGLTSSHLGKPDYAKALEQHNAYIRALQVDITLLPPDERFPDSVFVEDCTSRCAIITRPGA
3b2qB           ---RLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
2b8tB           --------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKILPSVE
2d2eA           QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGEILELS
2c61A           PYARLPPKDFIQTGISTIDGTNTLVRGQKLPIFSASGLPHNEIALQIARQASVPGSESAFAVVFAAMGIT
2axpA           -----------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEK
2cgtH           DKSFGAPTITKDGVSVAREIELEDKFNMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGM
1e9rA           -GKLKRMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1e2dA           --------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
3a1wA           ----------------------------KVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGFTY
2d0kA           ----------------------------------------------------------------------
1dhjA           ----------------------------------------------------------------------
3dt7A           ----------LAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
2cjwB           --------------------------YYRVVLIGEQGVGKSTLANIFAGVEDTYERTLMVDGESATIILL
2dr3B           -----------GIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
2awoC           -----------QNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
3c8uA           --------LAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPDGFHLDNR
2bdtA           ---------------------------KLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHVVGGYR
1e0jB           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE
2a2zB           --------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQST
1e3aB           ----------WTQQAAKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGKWDWKGLLPFEM
2bc9A           MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMW
2a5jA           -----------------------------YIIIGDTGVGKSCLLLQFTDKRFQPIGVEFGARMVNIDGKQ
2d2fA           QLEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILEL
2bkhA           ----------FAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANP
2awnC           ---------------------------------ASVQLQNVTVSKDINLDIHEGEF-VVFVGPSGCGKST
3d31A           MIEIESLSRKWKN-FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSP
1e6cA           ---------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTV
1e4yA           -----------------------------IILLGALVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGS
3dt4A           ----------LAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
1e9sF           -GKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1e9sG           -GKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1cr1A           -----SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM---------------
3dtbB           -----------AEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
2b8tC           --------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVFKPKIDSRTG
1ai4B           ---------------AKQALTINWYYADVNGNIGYVHTGAYPDRQSGHDPRLPVPGTGMNPKVYNPQSGY
2a1fF           ----------------------------------------------------------------------
1e3mA           ------------------------------------LVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVV
1dkiA           LLDSKGIHYNQGNLLTPVIEKVKPGEQSFVGQHAATGSVATATAQIMKYHNYPNKGLKDYTYTLSSNNPY
2d4hA           MCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQKGIWMWCVP
1dhiA           ----------------------------------------------------------------------
3bo6B           -HSLHNQMRQMPMSHFREALDAPDYSGMRQSGFFAMSQGFQLESHGGDVFMHAHRENPQCKGDFAGDKFH
2bwjA           ------------------GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTELLREELASESE
3cr7C           --------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
3dhwC           MIKLSNITKVFHQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSE
421pA           --------------------------EYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
1e0jA           -HLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE
3cmtD           --------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
2bbsB           --TTEVVMENVTAFWVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
2b92B           MCLIENTNGRLMNPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMW
1e9sJ           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1e9sD           -GKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1d6jA           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
1e2fA           --------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
3czpA           ----------QARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERA
2a30A           --------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPNVQSTNVLQM
3d7wA           ----------SNNIPLLRQSTVPVSEGQRFVLVELTNAGGDTITAAIDVTNLYVVAYEAGNQSYFLSD--
3dauA           ----------------------------------------------------------------------
3bgwA           ---DGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKEN
1e9sB           ----KRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
2anbA           ------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
2c9oC           ---------------IVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEI
1draA           ----------------------------------------------------------------------
3cnlA           ----------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAKGIQWFSLENGVKILDTP
2c0bL           ----------------------------------------------------------------------
3dt4C           -----------AEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQ
3d3kA           --------YELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPQRPTVACGPHVKGAQGISCGRH
2a2zA           --------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQ--
2d4hB           MCLIENTNGRLMALKILSAITQ---PMVVVAIVGLYRTGKSYLMNWMWCVPHPKKPGHILVLLDTEGLGQ
2bkiA           -----------AIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRI-VEAN
3cddF           ----------STITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQR
2b8wB           MCLIENTNGRLMANEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMW
1dyhA           ----------------------------------------------------------------------
2a1fD           ----------------------------------------------------------------------
1cr0A           LSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKS---------------TFVRQQALQWGTAM
3cmvE           --------------LDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
3cddD           -----VLKAGGKIYQGWTKIGIASGAFDLETYKFNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWV
2bbtB           -ELFEKAKQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
2d4uA           -------------------------------PLGSGGLFFNALKNCKENFTVLQTIRQQQSTLNGSWVAR
2drcA           ----------------------------------------------------------------------
3bgwD           ----------PSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKEN
2bx2L           ----------------------------------------------------------------------
2cckB           -----------------------------ITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVTGEE
2awoA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
3bb1B           ---------------LLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSGPRPVMVSRS
1cr2A           -----SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEE
3bwdD           --------------------------FIKCVTVGDGAVGKTCLLISYTSNTFPFSANVVLGLWDTAGEDY
2dr3D           --------VKTGIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEH-PVQ
3d3qA           --------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDIGTA
1dg3A           MCLIENTNGRLMAPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKHTKGIWMWCVPHPKKPGHI
2ancD           --------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
4dfrA           ----------------------------------------------------------------------
1eilA           ----------------------------------------------------------------------
3ecpA           -----------------------------------------------SALHRAADWAKSVFSSAAL----
2an9A           ------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
2bjbA           ----GLRVDGVGSELTVSGRIEPGPGARVD--CGLAG----TVLRFVPPLAALGSVPVTFDGDQARGRPI
1e3mB           ----------------------------------------------------------------------
3cr7A           --------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
3ec1A           --------------------------------------------------------VITTSYFPGTTLDM
1afrA           ---------------VHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDGVRD
1e2gA           --------------------------GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEI
3cr7D           --------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
1ak2A           --------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGS
2bhjA           -------------------------------------------------IKNWGSGEILHDTLHHKA---
3adkA           --------------------EEKLKKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGS
3bczC           -------------------EASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCA
1akeA           -----------------------------IILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGS
2dr3C           ---------------------------------RRVKTGIPGVDEILHGGIPERNVVLLS-GGPGTGKTI
3ch4B           -------------------APLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQY-
1bglA           ----------------------------------------------------------------------
1e9rE           -GKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3clvA           ---------------------MEKKSSYKTVLLGESSVGKSSIVLRLTKDTFHENTNTTIGAVNLNDNYN
2c7cH           ----------------------------------------------------------------------
3cddC           ----------------------------VLKAGGKIYQGWTKIGITRSLEASGAQYKAFIEPIKQGQACT
1d6jB           ----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRAYRLDGDNIRFGLN
3cmwC           -------------SLSLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
1e9rD           -GKLKRMTREKAKQVTVAGVPMPRDEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
2c4rL           ----------PRAGGISRRIELKEALASLELPEGMGLIVRTAGVGKSAEALQ--WDLSFRLKHWEAIKKA
2awoD           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
1e59A           --------------------------GESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFA
2cvfA           -------MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLV
3bk7A           ---------------------GEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQY
3bh0A           -SADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKEN
3di4A           -------KTGEVLVPPREGRCFEVKAGQFFRISSVEGPQVGDLNL-----HNLHDLTERFFSGKTRALHG
2dr3F           -----------GIPGVDEILHGGIPERNVVLLSGGPGTGKTIFSQQFLWNGLKMGEPGIYVALEEHPVQV
3dffA           ----------------------------------------------LAISPHLDDAVL-SFGAGLAQAAQ
3dfpC           ----------------------------------------------------------------------
2awnA           -VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2aunA           ----------------------------------------------------------------------
4atjA           ----------------------------------------------------------------------
3d3qB           --------------------------PFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSQVYQGDGTAK
2aumA           ----------------------------------------------------------------------
3da4A           -----------------FAKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNISPMKINQI
2ccjA           ---------------------------AFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGE
2ausC           ----------------------------------------------------------------------
3bb1A           ----NTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
2ahwD           -----------VPVLSAQEAVNYIPDEATLCVLGGILEATTLITALADKYKQTQTPNLSIISPTGLGDRA
2aumB           ----------------------------------------------------------------------
2eg5G           -----------CVRELLRANLPNINKCIKVADLGCASGPNTLLTVRDIVVGQLERPTIQIFLNDLFPNDF
2aunB           ----------------------------------------------------------------------
2a1fE           ----------------------------------------------------------------------
1e9sM           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3dlbB           ---------------------VWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRILC
3cr7B           --------------------------GLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNIRFG
1e4vA           -----------------------------IILLGAPVAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGS
1drbA           ----------------------------------------------------------------------
3bb1E           ----NTFAPATQTKLLLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
1av6A           ---------------------LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDP
2ancB           ------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPG
3dfnC           ----------------------------------------------------------------------
3dfoD           ----------------------------------------------------------------------
1e9rF           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
5dfrA           ----------------------------------------------------------------------
3crmA           --------------------------PPAIFLMGPTAAGKTDLAMALADALPCELISVDSALYRGMDIGT
3a00A           ---------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGE
2dftC           -----------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSI
2bofX           -----------------------------------------------------NMSSAEWVRNNPNDPRT
2ck3C           IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYV-
3dymA           ----------------------------------------------------------------------
1cjaA           ---------------------------------------TTSAPEVLTKSTMQQLGSLMALDVIVNNSDR
3dfnA           ----------------------------------------------------------------------
3dfqA           ----------------------------------------------------------------------
1accA           ---------------IIFNGKDLNLVERRIAAVNPSTTKPDMTLKEALKIFNEPNGNLQYQGKDITEFDF
3e8aC           --------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA
3dfoC           ----------------------------------------------------------------------
1e9sL           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1cs4C           --------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAI
2b8tD           --------------------------GWIEFITGPMFAGKTAELIRRLHRLEYADVKYLVKPKSIRNIQS
2ancF           ------------------------AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTTGVDVFLDIDWQGA
1e9sH           ----KRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3dfqC           ----------------------------------------------------------------------
3cnnA           ----------KGEPRKVLLKKLSFDRLARVLIVGVPNTGKSTIINKLKGKRAGIQWFSLENGVKILDTPG
2ahvA           -----------VPVLSAQEAVNYIPDEATLCVLGGILEATTLITALADKYKQTQGLGDRADRGISPLAQ-
1e2kA           --------------------------LLRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASET
2dflA           -----------GSQALDGLLAGGIETRTMTEFFGEFGSGKTQLCHQLSVNVQLPPEKGGLSGKAVYIDTE
3dftD           ----------------------------------------------------------------------
1eamA           ---------------------LQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDP
3cbnA           ------------------------------------------------------RYTLRARGHPNV----
2boeX           ----------------------------------------------------------------------
3dfpD           ----------------------------------------------------------------------
1adoA           ----------------------------------------------------------------------
1culC           --------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAI
3dfqD           ----------------------------------------------------------------------
1e9sI           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1bmfC           IIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVA
3dm9B           -----------TSRRIDLIEEIRKAEKPYVIFVGFNGSGKTTTIAKLANWLKNHGFSVVIAASDTFEQLE
3bjdB           -----------------------------------------TRNFSLPQLQNLPIEEARIVADALAVHAT
2bhvA           ----------------------------------------------------------------------
2bkeA           VKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKTQL-------CHQLSVNVQLPPEKGGLSGK
3dyoA           ----------------------------------------------------------------------
2b0lC           ----------------------------------------------------------------------
3be4A           --------------------------KHNLILIGAPGSGKGTQCEFIKKEAHLSTGDMLREAIKNGIGLE
3cioD           -----------------HFAMMETENNILMITGATPDSGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYS
2a1fC           ----------------------------------------------------------------------
3dfnD           ----------------------------------------------------------------------
3c15C           --------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA
3dftC           ----------------------------------------------------------------------
1cfrA           ------------------------------DIISKSGEGNKYTINSAIAFV-AYASHIDINTTEFSKVLS
3czjA           ----------------------------------------------------------------------
2dftA           -----------------------------AVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSI
1aldA           ----------------------------------------------------------------------
2bbtA           -EGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQN
3bb1F           -SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
1dp0A           ----------------------------------------------------------------------
3cmuA           --------------------AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
2d4uB           ----------------------------------------------------------------------
2bhvD           ----------------------------------------------------------------------
3bb1C           -----------KLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
1cjtC           --------------------------THRLLLLGAGESGKSTIVKQMRILHVGEKATKVQDIKNNLKEAI
6aldA           ----------------------------------------------------------------------
1c9kC           -----------------------------ILVTGGARSGKSRHAEALIGDAPQVLYIATSQILHHKDGRP
3b55A           ----------------------------------------------------------------------
3c7kA           -----------------------------LLLLGAGESGKSTIVKQMKIIFSGEDVKQYKPVVYSNTIQS
3cm0A           --------------------------GQAVIFLGPPGAGKGTQASRLAQELGFKKLSTGDILRDHVARGT
3cueF           -----------------------YDYLFKLLLIGNSGVGKSCLLLRFSDDYISTIGVDFKIKTVELDGKT
3d1mB           ----------------------------------------------------------------------
2bv7A           ---------------CLGSPVFTPIKADISAVYDTNPTKFRTLQNILEVEKEMYGAEWP--------KVG
1e9sE           -----RMTREKAKQVTVAGVPMPRDAEPRLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
2e85A           ----------------------------------------------------------------------
1dekB           -----------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPI--------
2czvB           -----------MDIRDKEAYELAKEWFEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTV
1e9rG           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1cjuC           --------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA
3d1mA           ----------------------------------------------------------------------
1dvrA           --------------------------SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGT
1e9rB           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3ed8A           -------TDFKEDGNILGHKLEYNFNSHNVYITATRGTQKNGIKANFTVRHNVEDGSVQLADHYQ----Q
1azsC           -----------------------YRATHRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA
2c9gA           VMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMTIDLMNNAIVEHYL-----------------------
2d7vA           VAALSSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEK---
3cmvB           ---------------SLDIAAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
1e2nA           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYRVLGA
1e2iB           ------------------------PTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV--
3a00B           ---------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGE
3c14C           --------------------------THRLLLLGAGESGKSTIVKQMRILHVNGEKATKVQDIKNNLKEA
1e1qB           -----------QTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVA
1e2hB           -----------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG
2dpyB           -----------DTGVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKI
1dekA           -----------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAW
3bv4A           ----------------------------------------------------------------------
2cbzA           -ITVRNATFTWADPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQ
2e85B           ----------------------------------------------------------------------
1ckvA           ----MGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKIEVDC
2bboA           EVVMENVTAFWEETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQF
3bb1H           -----------KLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMVSR
3bjqB           ----------------------------------------------------------------------
3bb1G           -SGINTFAPATQTLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSIS-PFQSEGPRPVMVS
2cdnA           --------------------------HMRVLLLGPPGAGKGTQLAEKLGIPQISTGELFRRNIEEGTKLG
3brwA           ----------FLGKEHFNYYSLDTALGHLVFSLKYDVIGDQEHLRLL--------------------LRT
2d7vB           ----SSCHLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEK---
1ek0A           -----------------------------LVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVT
1e2iA           -----------------------MPTLLRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQ
1cjvC           --------------------------THRLLLLGAGESGKSTIVKQMRILHVEKATKVQDIKNNLKEAIE
1bccF           ----------------------------------------------------------------------
3dvlD           -----------------------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEETPQD
3b9qA           IKDALKESVLEMLAKSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAAGDTFRAAA
3dm5B           -----VYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGA
2aexA           ----------------------------------------------------------------------
3bm2B           ----------------------------------------------------------------------
1e2kB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG
2dpyA           --------------VRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIGERGREVKD
1e9sA           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
1e2lA           -----------------------MPTLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIAN
1e2lB           --------------------------LLRVYIDGPHGMGKTTTTQLLVA---------LGSRDDIVYVPE
3dkvA           -----------------------------IVLMGLPGAGKGTQAERIVE--KYGIPHISTGDMFRAAMKE
3dfdA           -------------EGNVVPFIFKAITTDRIDELEKENTTKELDSQRFYARIAVETTVYP--------TFK
1e2mB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG
2bwjB           ---------------------EDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTELLREELASESE
1dw9A           --------------LADAILLSKAKKDLSAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDED
2c5mD           ----------------------------------------------------------------------
1e2jA           --------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVTYWRVLGASETIANIY
1chdA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3b85B           ----------------QKHYVDAIDTNTIVFGLGPAGSGKTYLAAKAVQALQSKQVSRII------LTRP
1e2jB           -----------------------MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTY-WRVL
3ci2A           ----------------------------------------------------------------------
1e9sK           -----RMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSK
3cddA           ----------YQGWTKIGITRSLEASGAFDLETYKFLGNDAQYKAFIEP---------IKQGQACTVDIG
1e2nB           --------------------------LLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLG
1e2mA           ------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETI
2a5vA           --------VIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVR-------DVVE
2dx7A           --------RDQEHP-KVIIFNNPQIPDRTAYILGKGEDPRPQLIWTAKRLEECGADFIIMPANTAH----
2a78A           -----------------------------VIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVL
3cphA           -----------------------------ILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGITVDINGKK
3do6A           -LYPYGHYIAKIDHRFLKSLENHEDGKLILVTATPAGEGKTTTSIGLSSLNRIGKKSIVTLR--------
2bwjD           ----------------------DLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTELLREELASESE
3bs4A           -----------------------KKHSLILIHEEDASSRGKDILFYILSRKLKSDNLVGMFSISYPLQLI
3c85A           -------------------------------------------------LINPGHAQVLILGGRIGTGAY
1d6aA           -----------SNIGKISGVMSFTEKTEAEFLLVAIQMVSEAARFKYIEN-QVKTNFNRAFNPNPKVLNL
2bhvC           ----------------------------------------------------------------------
1e2hA           ------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETI
3cbqA           -----------------------------VMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERR--
2c95B           ---------------------EKLKKTNIIFVVGGPGSGKGTQIVQKYGYTHLSTGDLLRSEVSSGS--A
3bb1D           -----------KLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIGERVVSISPFQSEGPRPVMSRS
1dwmA           ----------------------------------------------------------------------
3cr8B           ----------------------------------------------------------------------
1ckeA           ------------------------AIAPVITIDGPSGAGKGTLMAEALQWHLLDSGAI-YRVLALAALHH
1agpA           -----------------------------LVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
2awiA           ----------------------------------------------------------------------
2a5vB           --------VIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVR-------DVVE
2atxA           -----------------------------CVVVGDGAVGKTCLLMSYAN---------------------
3cqcA           LKQGNAIMRKSKKHEAAKEVFVKIPQDSIAEIYLPAEDDN------------------------------
221pA           -----------------------------LVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEESYRKQVVI
2cxxB           ----------------------------TIIFAGRSNVGKSTLIYRLTG---------------------
1e6vC           ----------------------------------------------------------------------
3bfkB           ----------------------------KIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIGVEFATKSIQ


                         .         .         *         .         .         .         .:140
query           DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGE
2d3wB           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
2dwpA           VKQYSSYNFFRPDNEEAMKVRKQCALA------------------ALRDVKSYLAKEGGQIAVFDATNTT
3b5jA           NWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISREGYNTIVGEQGAGLSGGQ
3dmdC           IEQLEEHAKRIGVKVIKHSYGADPAAVAYD-------------------AIQHAKARGIDVVLIDTAGRS
2dwoA           VKQYSSYNFFRPDNEEAMKVRKQCALA------------------ALRDVKSYLAKEGGQIAVFDATNTT
3cmvH           YARKLGVDIDNLL---CSQPDTGEQALEICDALARSGADSVAALTPKAEIEG--EIGDSHMGLAARMMSQ
3cmvG           YARKLGVDIDNL---LCSQPDTGEQALEICDALARSGADSVAALTP--------KAEIEGLAARMMSQAM
1d1cA           NLEAFGNAKTTRNNNSSRFGKFIEIQFNNAGFISGASIQSYLLEKSR--VVFQSETERNYHIFYQLLAGA
3b60A           ASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIERMAYAMDFINKMDNGLDTIIGENGVLLSGGQ
2ccgA           EIR------------KIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEVVLCDRYIDSSLAYQGYAR
1bifA           VKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFL------------------SEEGGHVAVFDATNTT
3c95A           ILRENPQVREKYNGFFSDADRAAMKIVLETEPRNLPALDITFVDKRIEKLLF---NYRARNFPGTLDYAE
2ccjB           EIRKIVLEGNDMD---IRTEAMLFAASRREHLVLKVIPALKEGKVVL-------CDRYIDSSLAYQGYAR
2bifA           VKTYKSFEFFLPDNEEGL-------------KIRKQCALAALNDVRK-----FLSEEGGHVAVFDATNTT
3cmvC           YARKLGVDIDNL---LCSQPDTGEQALEICDALARSGADVIVVD---SVAALTPKAEIEGLAARMMSQAM
4dcgA           ILNGLRDVTLVTRFVDEEYLRSIKKQLHPLLSNYALQNVMISILNPVASSLKWRCPFAQWIKDFYIPHGN
3dmdB           EQLEEHAKRIGVKVIKHSYGADPAAVAYDA--------------------IQHAKARGIDVVLIDTAGRS
2bbsA           SWIMPGTIKENIIGVS-----------------YDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQ
2c03B           REQLRLLGEKVGVPVLEVMDGESPESI-------------------RRRVEEKARLEARDLILVDTAGRL
2c61B           NEEAQYFMSDFEKTGALERAVVFLNLADVLVILTDITNYAEALRQMGYPGYMYTDLATLYERAGIVKGAK
3eiuB           NEEAQYFMSDFEKTGALERAVVFLNLADDPTDITNYAEALRQMGAAGYPGYMYTDLATLYERAGIVKGAK
3eiuA           NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERILTDITNYAEALRQMGPMYTDLATLYERAGIVKGAK
2ccgB           EIRKI---------VLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVV-LCDRYIDSSLAYQGYAR
2dr3A           RQNMAQFGWD-----------------------VKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLTDIRE
1e9cA           GKLLSSYLQK----KSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVT-LVVDRYAFSGVAYTGAKENFSL
2c9yA           ELGKKLK--ATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGVRQAEMLDDLMEKRKEKLDSVIEFSI
2a2zD           NVLQMERWSFTFQTYACLSRIRAQLASLNEK-PVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH
1aroP           ---------------------NDFSDIELAAI--PFNTLADHYGERLAREQLALEHESYEMGEARFRKMF
2a30D           NYEKPERWSFTFQTYACLSRIRAQLASLNGKPVLFFERSVYSDRYIF-ASNLYESECMNETEWTIYQDWH
2awnD           AERGVGMVEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVE-AMTLADKIVVLDAGR
2b8tA           RNI-QSRTGTSLPSVEVESAPEILNYIMSGIDEVQFFDDRICEVANILAENVVIISGLDKNFKGEPFGPI
1cr4A           TAE-----------DLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGN---DTFHLYDSFAEAETDR
2akaB           NSTTEYAEFLHCKGKKFTDFEEVRLEIEAKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIE
2b8wA           CHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVGTINQQAMDQLYYVTELTHRIRSKSVSFFPDFV
2cckA           EIRKIVLEDMDIRTEAMLFAASRREHLVLKVIPALKEG----------------KVVLCDRYIDSSLAYQ
1e98A           GKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVV-----DRYAFSGVAFTGAKENFSL
2c04A           REQLRLLGEKVGVPVLEVM--------------DGESPESIRRRVEEKAR-----LEARDLILVDTAGRL
3cmvA           YAR--------------------------------KLGVDIDNLLCSQPDTGEQALEICDALARSGAVDV
3b85A           KLGFLPGDPYLRPLHDALRDVEPEVIPKEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQKFLTRLGF
3czpB           QPYLWRFWRHIPARRQFTIFDRSWYGRRIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQT
3dm5A           YHQLRQLLDRYHIEVFGNPQEKDAIK-----LAKEGVDYFKSKGVDIIIV--------------DTAGRH
1e9fA           GKLLSSYLQKKS----DVEDHSVHLLFSAN-RWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
1e69A           AYVELVFEENGEEITVARELKRTGENTYYLNGSPVRLKDIRDRFAGTGLGISIRKPGRRDQKLSLLSGGE
2akaA           LQANPILEAFGNAKTTRNNNSSRFGKQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGAT
1b0uA           KDGQLKVLTMVFQHFNLWSHMTVLENV-MEAPIQVLGLSKHDARERALKYLAKVGERAQGKYPVHLSGGQ
2d3wC           EDRAGEGIFMAFQYPVEIPGVSNQFFRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
2a30B           MYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH
2d62A           VFVPPKERDVAVFQSYALYPHTVYDNIAFPLKLRKVPKQEI--DKRVREVAELGLTELLNRKPRELSGGQ
2d3wD           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGE
2dr3E           VRQNMAQFGWDVKPYEEKGMFAMVDAFTAGIGKEYEKYIVHDLT----------------------DIRE
2czvA           NPKPSLVRDTVQKFKSYLIYVESNDLRVIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYE
2axzC           --------------------------------KTITSDLKHLYDKRTTFIDYEIVSNLLNVLPYEEVSSI
2d3wA           GIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPLLTRSVNVGFSGGE
1e9dA           GKL----LSSYLQKKSDVEDHSVHLLFSA-NRWEQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSL
2a5gA           VKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCADRDRIDLHRIINDREMRDAIILIFANKQDLPDAMK
3dt2A           GNL--RAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGEPLAPGVTITSWKNKE
3cmxA           YAR---KLGVDIDNLLCSQPDTGEQALEICSVAALTPKAEARMMSQAMRKLNLKQSNTLLIFINQIRNPE
1bg0A           DINTLVGLDPAGISTRVRCGRSLQGYPFNPCLTAEQY-KEMEEKVSSTLSSMEDELKGTYYPLTGMSKAT
3b2qA           NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPR-MALTAAEYLAYEHGMHVLVILTDITNYAEA
2awnB           AERGVGMVFQSYALYPHLSVAENMSF----GLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQ
2c03A           REQLRLLGEKVGVPVLEVMDGESPES-------------------IRRRVEEKARLEARDLILVDTAGRL
2ctsA           FRGYSIPCQKMLPKAKGGEEPLPEGLFVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMS
3bpbA           ESRRGETEIIEETVQRFYPGKVERIEAPGTVEAGDIMMVGDHFYIG--------ESARTNAEGARQMIAI
3b2qB           NEEAQYFMSDFEKTGALERAVVFLNLALVILTDITNYAEALRQMGRGYPGYMYTDLATLYERAGIVKGAK
2b8tB           VESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEP----FGPI
2d2eA           PDERARKGLFLAFQYPVVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGE
2c61A           NEEAQYFMSDFEKTGALERAVVFLNLADDPAVERIVTPR-MALTAAEYLAYEHGMHVLVILTDITNYAEA
2axpA           LFEHFNDEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVSVIKKRLRVRGDEYIEGKD
2cgtH           NPMDLKKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDEL-DVVEGMQFDRGYLSPYF
1e9rA           FGR---DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETA-KKLA
1e2dA           GKLLSSYLQKKSD---VEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRY-AFSGVAFTGAKENFSLD
3a1wA           KGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTA
2d0kA           ----------------ISLIAALAVDRVIGNE------NALPWNLPADL-----AWFKRNTLNKPVIYGR
1dhjA           ------------------------ISLIAALAVDRVIGM--ENAMPWNLPASL-AWFKRNTLDKPVIMGR
3dt7A           GNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKE
2cjwB           DMW-ENHDHMQVGDAYLIVYSITDRAS-FEKASELRIQLRRARQTEDIPIILVGNKSDLVRREVSVSEGR
2dr3B           RQNMAQF--------------------------GWDVKPYEEKGMFAMVDAFTAGIGEKYIVHDLTDIRE
2awoC           AERGVGMVALYPHLSVAENMSF--------GLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQ
3c8uA           LLE----------PRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYP------LFDRARDIAIA---GA
2bdtA           PALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIR-FIILWTNREELLRRDALRK
1e0jB           TA---EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETD----RLLAKLAY
2a2zB           NVLQMERWSFTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH
1e3aB           NPKVYNPQSGYIANWNNSPQKDIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSD
2bc9A           CVPHPKKPGHILVLLDT----------------EGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTIN
2a5jA           IKLQIWDGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQ-HSSSNMVIMLIGNKSDLES
2d2fA           SPDERARKGLFFQYPVEVPGVTIANFLRLKLGREVGVAEFWTKVKKALELLDWDESYLSRYLNEGFSGGE
2bkhA           LL-----EAFGNAKTVRNNNSSRFGKHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAS
2awnC           LLRMIAGLGVGMVFYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAE-VLQLAHLLDRKPKALSGGQ
3d31A           EKHDIAFVYQNYSLFPHMNVKKNLEF-------GMRMKKIKDPKRVLDTARDLKIEHLLDRNPLTLSGGE
1e6cA           AVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAASLQAHQRPTLTG
1e4yA           ELGKQAKDIMDAGKLVTDELVIALVKE-----------------------RIAQEDCRNGFLLDGFPRTI
3dt4A           GNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKE
1e9sF           FGRDKDIILNPYDQ--RTKGWSFFNEI---------------------RNDYDWQRYALSVVPRGKTDEA
1e9sG           FGR---DKDIILNPYDQRTKGWSFFNE--------------------IRNDYDWQRYALSVVPRGKTDEA
1cr1A           GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFELFGNDTFHLYDSFAEAETDR
3dtbB           GNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKE
2b8tC           TSLPSVEVESAPEILNYIMSNSFNDEIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKGEPFGPI
1ai4B           IANWNNSPQKDYPASDLFRVTEIDRLLEQKPRLTADQAWDVIRQTSRQDLNLRLFLPTLQAATSGLTQSD
2a1fF           ------------------------------------------------------------------SQPI
1e3mA           EQVLNEPFI--ANPLNLSPQRRLIITGPNGGKSTYRQTA-LIALAYIGSYVPAQKVEIGPIDRIFTRVGF
1dkiA           FNHPKNLFAAISTRQYNWNNILPTYSG-------RESNVQKMAISELMADVGISVDMDYGPSSGSAGSSR
2d4hA           HPKKPGHILVLLDTEGLGDVENQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTSKSSPDES
1dhiA           ----------------ISLIAALAVDRVIG----ME--NAMPWNLPASL-----AWFKRNTLDKPVIMGR
3bo6B           ISVQREQVPQAFQALSGLLFSVDSPIDKWKVTDMERVDQQSRVAVGAQFTLYVKPDQENSQYSASSLHNT
2bwjA           RSKLIRDIMERG--DLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDC
3cr7C           LNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTRDPKGLYKKAREGVI
3dhwC           STKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLS-LVGLGDKHDSYPSNLSGGQ
421pA           DGETCLTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLA
1e0jA           TAE--DLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDS-----FAEAETDRLLAKLAY
3cmtD           YAR---KLGVDIDNLLCSQPDTGEQALEIC----DALARSGAVDVDSVAALTPKMGLAARMMSQAMRMKN
2bbsB           SWIMPGTIKENIIGVSYD---------------EYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQ
2b92B           CVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIVYNSIGTINQQAMDQLYYVTELTHRIRSKSSFVSFF
1e9sJ           FGRDKDIILN---PYDQRTKGWSFFNE-------------IRNDYDWQRYALSVVPRGK-------TDEA
1e9sD           FGRDKDIILNPYD---QRTKGWSFFNEIRNDYDWQRY--------------------ALSVVPRGKTDEA
1d6jA           LNKDLGFSEADRNENIRRIA-----------EVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGE
1e2fA           GKLLSSYLQKKSDVEDHSVHLLFSAN-----RWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSL
3czpA           QPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEIEQLSEYGIIVVKFWLAIDKQT
2a30A           MYEKPERWSFTFQTYACLSRIRAQLASLNAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH
3d7wA           ---------APAGAETQDFSGTTSSSQ------PFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPG
3dauA           ----------------ISLIAALAVDRVIG----ME--NAMPWNLPADLAWF-----KRNTLNKPVIMGR
3bgwA           IKRLIVTAGSINAQKIKAA-------------RRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIW
1e9sB           FGRDKDIILN---PYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE-TAKKLA
2anbA           EVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGV-----DVFLDIDWQGAQQIR
2c9oC           KKTEVL-MENFRRAIGLRIKETKKKEIDVTLHDLDVAGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDI
1draA           ----------------ISLIAALAVDRVIG----ME--NAMPWNLPAEL-----AWFKRNTLDKPVIMGR
3cnlA           GILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIIESSFSEF--FEDFARKRGLLKKGGV
2c0bL           -AAESRPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAARPDFSSKIKLYTGEIPLFS
3dt4C           GNL--RAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTSWKNKE
3d3kA           LANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPEN---VFLRDQP
2a2zA           STNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKEKPVLFFERSVYS---DRYIFASNLYESECMN
2d4hB           NDSWIFLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSDSADFVSFFPDVWTLRDFSLDLEADGQP
2bkiA           PLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAS
3cddF           IQIEQGETPHELLARLALTSDTFGNLVITRASKTKAGVSLILGDNVK-AARGRFSWRQRFSKFTIKAAGI
2b8wB           CVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVY----NSIGTINQQAMDQLYYVTE
1dyhA           ----------------ISLIAALAVDRVIGMENAMPW--NLPADLAW---------FKRNTLDKPVIMGR
2a1fD           ----------------------------------------------------------------------
1cr0A           GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETD
3cmvE           YARKLGVDIDNL---LCSQPDTGEQALEICDA-LARSGAVDVIVVDSVAALT-PKAEIEGLAARMMSQAM
3cddD           PSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVITDVGEPFQRIQIEQGE
2bbtB           SWIMPGTIKENIIGVSY----------------DEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQ
2d4uA           NTLNRAGIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQSTAAEIKRNYDIYHNAL
2drcA           ----------------ISLIAALAVDRVIG----ME--NAMPFNLPADL-----AWFKRNTLDKPVIMGR
3bgwD           IKRLIVTAGSINAQKIKAARRDFASE-------DWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQT
2bx2L           ---------------------------------DNPKVLELARQHIAALGRPD-FSSKIKLYTGEIPLFS
2cckB           IRKIVLEGDMDIRTEAMLFAASRREHLVLKVIPALKEGKDRYIDSSLAYQGYARGIGVEEVRALNEFAIN
2awoA           AERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQV----AEVLQLAHLLDRKPKALSGGQ
3bb1B           RAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAITDSFGKGIWN
1cr2A           TAEDLIGLHNRVRLRQSD---------------SLKREIIENGKFDQWFDELFGNDTFHLYDSFEAETDR
3bwdD           NRLRPLSYRGADVFILAFS---LISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHAV
2dr3D           VRQNMAQFGWDVKPYEEKGMFAMVDA--------------------FTAGIGKSKEYEKYIVHDLTDIRE
3d3qA           KVTTEEEGIPHPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYNYAFEISEDKKQVKLKLKELE
1dg3A           LVL-LDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYLTHRIRSKSDSADFVSFF
2ancD           EVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREA-----IEQVLATGVDVFLDIDWQGAQQIR
4dfrA           ----------------ISLIAALAVDRVIGMENAMPW------NLPADLAWF-----KRNTLDKPVIMGR
1eilA           -----------------------------------------------------AWDHFLTKSVGLMAAGS
3ecpA           ----------------GDPRRTARLVNQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNVSAEAIRKAGA
2an9A           EVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGV-----DVFLDIDWQGAQQIR
2bjbA           APLLDRELGVAVDGTGLPFRVRGNGSLAGGTVAIDASASSQFVS--------------GLLLSAASFTDG
1e3mB           -------EPFIANPLNLSPQRRLIITGPNGGKSTYRQTALIALAYIGSYVPAQKVEIGPIDRIFTRVGTF
3cr7A           LNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVTRDPKGLYKKAREGVI
3ec1A           IEIP-LESGATLYDTPGIINHHQMAHFVDARDLKIITPKREIHPRVYQLNEGQTLFFGGLARLDYIKGGR
1afrA           ETGASPTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEK--TIQYLIGSGMDPRTENSPYLGFIY
1e2gA           GKL----LSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYA-FSGVAFTGAKENFSL
3cr7D           LNKDLGFSRRIAEVAKLFADSNSIAITSFIYRKDRDTARQLHEVAEEFVEVYAEQRDPKGLYKKAREGVI
1ak2A           GKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSI
2bhjA           --TSCLGSIMNPKSLTRPLEELLPHAIEYYGSFKEAKIEEHLARLEAVTKEI-ETTGTYQLTLDELIFAT
3adkA           ARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVKQGEEF-ERKIGQPTLLLYVDA
3bczC           AYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGFERSLQTDEDEHSI
1akeA           ELG--KQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDV
2dr3C           FSQQFLWNGLKMGEPGIYVALEEHPVQVRQNMAQFGWDVKPYEEKGMFAMVAGIGEYEKYIVHDLTDIRE
3ch4B           AQEHGLNFQYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTVALEQSRQQRGWVFTPGVD
1bglA           ---------------------------------------------------------APLDNDIGVSEAT
1e9rE           FGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALS-----------------------VVPRGKTDEA
3clvA           ENNIKFDIWDTAGQERYASIVPLYYRGATCAIVVFDISNSNTLDRAKTWVNQLKISSNYIIILVANKIDK
2c7cH           -----------------NSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDEL-DVVEGMQFDRGYLSPYF
3cddC           -VDIGGERVITGYVDDWVPSYDESTSVSGRDKTADLVNQTLTQIADIVCKPFGNTDVGEPFQRIQIEQGE
1d6jB           KDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVATPGEETGLPFVEVYVDV
3cmwC           YAR---KLGVDIDNLLCSQPDTGEQALEIC-DALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAA
1e9rD           FGRDKDIILNPYDQRTKGWSFF-----------------------NEIRNDYDWQRYALSVVPRGKTDEA
2c4rL           AES--RPAPFLIHQESNVIVRAFRDYLRQDIGEILIDNPKVLELARQHIAARPDFSSKIKLYTGEIPLFS
2awoD           AERGVGMVEPSVFLLDEPLDAALRVQMRIEISRLIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYH
1e59A           YTSVLKRVLDELDQAWLPVEKSWKLNE-RHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDE
2cvfA           QMAETRGLNPEE---ALSRFILFTPSDFKEQRRVIGSLKKTNFALVVVDSITAHYRAEENRSGLLWIARK
3bk7A           IKA--------------EYEGTVYELLSKIDSSKLNSNFYKTELLK-----PLGIIDLYDRNVEDLSGGE
3bh0A           IKRLIVTAGSINAQKIKAARRDFASE-------DWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQT
3di4A           THVTTGERLWSNLPYLRPATIIEDTLGWYGIDQYGGSVHDVIGTRCDPYTGNLLAGGHYHHCCHGLPLHE
2dr3F           RQNMAQFGWDVK---------------------PYEEKGMFAMVDAFTAGIGKSKEYEKYIVHDLTDIRE
3dffA           DGANVLVYTVFAGAAQPPYSPAAQRHTIWGLAPDDDAVLYRRKEDIAALDHLRVAHRHGRFLDSIYRKLP
3dfpC           -----------------------------------------------------------HSHPALTPEQK
2awnA           AERGVGMVFQSYALEVIN---------------QRVNQVAEVLAIGRTLVAEPSVFLLDEPLSNLDAALR
2aunA           -----------------QPIDGRVALIAPASAI-ATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTV
4atjA           --------------TSFRTEKDAFGNANSAGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGP
3d3qB           VTTEEEGIPHYIDILPPDASFSAYEFK---KRAEKYIKDITRRGKVPIIAYIQSLLYNYAFEDKKQVKLK
2aumA           -----------------QPIDGRVALIAPASAI-ATEVLEATLRQLEVHGVDYHLGRHVEARYRYLAGTV
3da4A           KDIIKSGVVGTFPVSTKFTHATGDYNVITSWTYNGVVRSYDDKYDFNASTHRGIIGESLTRLGAMFSGKE
2ccjA           EIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPAL----------KEGKVVLCDRYIDSSLAYQGYAR
2ausC           -------------------REVIVKDDKAETNPKWGFPPDKRPIELHIQYGVINLDKPPGPT----SHEV
3bb1A           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRYRVDNLDKLVAKAITDSFGKGIWN
2ahwD           DRGISPLAQEGLVKWALCISDLAEQNKIIAPQGVLTQTLRAAAAHQPGIISDIGIGTFVDPRQQGGKLNE
2aumB           --------------QTWQPIDGRVALIAPASAIATEVLEATLRQLEV-HGVDYHLGRHVEARYRYLAGTV
2eg5G           NSVFKLLPSFYRKLEKENG-RKIGSCLIGAMPGSFYSRLFPEESMHFLHSCPSGLVTEIGTNKGSIYSSK
2aunB           ------------------TWQPIDGRVALIAPASAIATEVLTLRQLEVHGVDYHLGRHVEARYRYLAGTV
2a1fE           ----------------------------------------------------------------------
1e9sM           FGR---DKDIILNPYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLA
3dlbB           EMSLEAWLAQGHPLPKRVRN-----------AYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQ
3cr7B           LNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDRDTARQLHEVETGLPFPVEVAEQRDP
1e4vA           ELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNG---FLLDGFPRTIPQADAMKEAGINVDYVLEFD
1drbA           ----------------ISLIAALAVDRVIG----------MENAMPWNLPAC-LAWFKRNTLDKPVIMGR
3bb1E           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDKLVAKAITDSFGKGIWN
1av6A           ILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISIL---NPVASSL
2ancB           EVHGEHYFFVNHDEFKEMISRDAFLE-----HAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIR
3dfnC           -----------------------------------------------------------HSHPALTPEQK
3dfoD           -----------------------------------------------------------HSHPALTPEQK
1e9rF           FGRDKDII--LNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEW--ASYGRLLLRETAKKLA
5dfrA           -----------------------------------------AVDRVIGPWNLPAAWFKRNTLDKPVIMGR
3crmA           AKPSRELLARYPHRL--IDIRDPAESYSAA----EFRADALAAMAKATARGRIPLLVGGTMLYYKALLEG
3a00A           VNGKDY---NFVSVDEFKSMIKNNEFIEWAQFSGNYY-----------GSTVASVKQVSKSGKTCILDID
2dftC           ADIFATDGEQEFRRIEEAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGDRAEKY
2bofX           -PVIRDRIAS-------VPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVSNAPGRDCGAPSHSAY
2ck3C           -----------AIGQKRSTVAQLVKRLTDADAMKYTI--------------VVSATASDAAPLQYLAPYS
3dymA           ---------------------------------QSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSE
1cjaA           LTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGE--RVRELLRTLIAHPGHESSQFHSIRDIITLYT
3dfnA           -----------------------------------------------------------HSHPALTPEQK
3dfqA           -----------------------------------------------------------HSHPALTPEQK
1accA           N----------------FDQ-QTSQNIKNQLAELNATNIYTVLDKIK----LNAKMNILIRDKRFHYDRN
3e8aC           IET---IVAAMSNLVPPVELANPENQFRVDYILSVMN---------------------------------
3dfoC           -----------------------------------------------------------HSHPALTPEQK
1e9sL           FGR---DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEELLRETAKKLALIGTPSMR
1cs4C           EVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDF---------------------------------
2b8tD           RTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAENGFVVIISGLDKNFKG
2ancF           QQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTD
1e9sH           FGRDKDIILN---PYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLA
3dfqC           -----------------------------------------------------------HSHPALTPEQK
3cnnA           ILYKNIFSEDLAAKLLLVGSLPVERIEDQRIFERAFEIFARSIGIESSFSEF--FEDFARKRGLLKKGGV
2ahvA           EGLVKWALCGHWGQSPRISDLAEQNKIIAYNYPQGVLTQTLAAAHQPGIISDIGIGTFVDPRQQGGKLNE
1e2kA           IANI---YTTQHRLDQGEISAGDAAVV----------------MTSAQITMGMPYAVTDAVLAPHIGGEA
2dflA           --------------GTFRWERIENMAKAL----GLDIDNVMNNIYYIRAINTDHQIAIVDDLQELVSKDP
3dftD           -----------------------------------------------------------HSHPALTPEQK
1eamA           ILNGLR--------DVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNP
3cbnA           -TAGHRTTFEVTV----DPEIGETADCIIGVSSSDSISTLRESLVRVILRTENGYDEIRGYGHPELTLDH
2boeX           ------------------PNMSSAEWVRNNPNDPRTPVDRIASVPQGT-----WFAHHNPG---QITGQV
3dfpD           -----------------------------------------------------------HSHPALTPEQK
1adoA           -----------------------------------------------------------HSHPALTPEQK
1culC           ETIVAAMLVPPVE---LANPENQFRVD-------------------------------------------
3dfqD           -----------------------------------------------------------HSHPALTPEQK
1e9sI           FGRDKDIILN--PYDQRTKGWSFFNEI-------RNDYDWQRYALSVVPRGKTD--------------EA
1bmfC           IGQ-----------KRST---------------VAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYS
3dm9B           EHAKRIGVKVIKHSYGADPAAVAYDAIQHA--------------------------KARGIDVVLIDTAG
3bjdB           SRQIDSGLKGDRQAYAAYQQLLYVLSLS---------DDVATAQTRRWLARA-IYRVEERFPAADLSRAL
2bhvA           -----------TADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGK-AVLIPKGSKVIGYYSNNNKMGE
2bkeA           AVYIDTEGTFRWERIENAKA-------------LGLDIDNVNNIYYIRAINTDHQIAIVDDLQELVSKDP
3dyoA           ---------------------------------GFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEAT
2b0lC           ----------------------------------------------------------------------
3be4A           AKSIIESGNFV---GDEIVLGLVKEKFDLGVCVNLDGFPRTIPQAEGLAKILSEIGDSLTSVIYERISGR
3cioD           HNL-FTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELRQLLEWANDHYDLVIVDTPP
2a1fC           ------------------------------------------------------------------SQPI
3dfnD           -----------------------------------------------------------HSHPALTPEQK
3c15C           IETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPD---------------------------------
3dftC           -----------------------------------------------------------HSHPALTPEQK
1cfrA           GLRDFNDEAIRLGGK---ISDGSFNKCNGDWYEWLIGIRAIEFFLESETCLSEFIYDLRSKLSNLITSNP
3czjA           ---------------------------------LSQMWIGDKKQLLTPLRDQFTRAPLDNDI--GVSEAT
2dftA           ADDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAEGVRRTGGNDRAEKY
1aldA           ------------------------------------------------------------QYPALTPEQK
2bbtA           SWIMPGTIKENIIGVSYD---------------EYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQ
3bb1F           SRAGFTLNIIDTPGLIEGGYINDMALNSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWN
1dp0A           ---------------------------------GFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEAT
3cmuA           YAR---KLGVDIDNLLCSQPDTGEQALEIC-DALARSGAVDVIVVDSVAALTPKAEIEGEI----GDSHM
2d4uB           ------GIRYMMDQNNIGSGSTVAELMESASISLKQAEKNWADYEALPRDPRQSAAAEIKRNYDIYHNAL
2bhvD           ---------------KMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMGE
3bb1C           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKASFGKGIWN
1cjtC           EVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDF---------------------------------
6aldA           -----------------------------------------------------------------TPEQK
1c9kC           AH-----WRTARHLDTLITADLAPDDAILLECITTMVTNLLFALGDPEQWDYAAMERIDDEIQILIAACQ
3b55A           ------------------------------------------------------EAHAKPLKTTNPTASL
3c7kA           LAAIVRAMDTLGVEYGDK----------------------------------------------------
3cm0A           PLG--ERVRPIMERGDLVPDDLILELIELAERVIFDGFPRTLAQAEALDRLLSETGTRLLGVVLVEVPEE
3cueF           VKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQ-ESFNGVKMWLQEIDRYSTVLKLLVGNKCDLKD
3d1mB           -------------------------------------------------QFIPNVAEKTLGASGRYEGKI
2bv7A           ATLALMWLKRGLRFIQVF-------------LQSICDGERDENHPNLIRVNATKAYEMA----LKKYHGW
1e9sE           FGR---DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLL----RETAK
2e85A           ---------------------SAVTDVLLCVGNSMMGDDGAGP------LLAEKCAAAPKGNWVVIDGGS
1dekB           KDALAYAWGVF----AANTDYPLTRKE---------FEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKS
2czvB           QKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYE
1e9rG           FG---RDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLL----RETAK
1cjuC           IETIVAAMSNLV---PPVELANP-----------------------------------------------
3d1mA           -------------------------------------------------QFIPNVAEKTLGASGRYEGKI
1dvrA           QLGLEAKKIM--DQGGLVSDDIMVNMIKNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAIELKV
1e9rB           FGRDKDIILN---PYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRET-AKKLA
3ed8A           NTPIGDGPVLLPDNHYLSYQTVLSK---------------------------------------------
1azsC           IETIVAAMSNL---VPPVELANPENQFRVDYILSVMN---------------------------------
2c9gA           ----------------------------------------------------------------------
2d7vA           -HHLAHEN--CFIANSVETEVVTE----------------------------------------------
3cmvB           YARKLGVDIDNL---LCSQPDTGEQALEICDALARSGADSVAAL------------TPKAEIEGEISHMG
1e2nA           SETIANIYTTQHRLDQGEISAGDAAVVMTS---AQITMGMPYAVTDAVLAPGGEAGSPPALTLIFDRHPI
1e2iB           -------LGASETIANIYTTQHRLDQGEI--SAGDAAVVMTSAQI-----TMGMPYAVTDAVLAPHIGGE
3a00B           VNGKDYNFVSVDEFKSMIK--------------NNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDID
3c14C           IETIVAAMSNLV---PPVELANPENQ--------------------------------------------
1e1qB           IGQKRSTVAQLVK-RLTDADAMKYTIVVSATASDAAPLQYLAPYYDDLSKQAVAYRQMSLLLRRPPGREA
1e2hB           ASETIANIYTTQHRLDQAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPAFDRHPIAALLCYPAAR
2dpyB           ENILGPDGRARSVVIAAPADVSPLLRMQGAAYIAEDFRDRGQHVLLIMDSLTRYAMAQREIA--LAIGEP
1dekA           GFAANTDYPLTRKDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVIN
3bv4A           -----------------------------------------------------------------TPEQK
2cbzA           AWIQNDSLRENILFGCQLEEP------------YYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQ
2e85B           -----------------------------------------------------KCAAAPKGNWVVIDGGS
1ckvA           -DEISELLGRQFNVYDFLVDVSST----------------------------------------------
2bboA           SWIMPGTIKENIIFGVSYDEY------------RYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSEGQ
3bb1H           SRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDSFGKG
3bjqB           ----------------------------------------------------------------------
3bb1G           RSRAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKLLYVDRLDAYRVDNLDKLVAKAITDSFGKGIWN
2cdnA           VEAKRYLDAGDLVPSDLTNEL-VDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDA-VLEFR
3brwA           KCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLG
2d7vB           -HHLAHEN--CFIANSVETEVVTE----------------------------------------------
1ek0A           IKFEIWDTAGQERFASLAPYYRNAQAALVVYDVTKPQSFIKARHWVKELHESKDIIIALVGNKIDLQEGG
1e2iA           HRLDQGEISAGVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHP-IAALLCYPAARYLMGS
1cjvC           TIV-------------------------------------------------------------------
1bccF           -WYYNAAGFNKY---GLMRDDTIYENDDVKEAIRRLPENLYDDRMFR----IKRALDLNMRQQILPKEQW
3dvlD           IIKNARSFGWDLAKLVDEGKLFILDA---------------------------SPDPEGQEVVGGFDLSA
3b9qA           SDQLEIWAERTGCEIVVAE--------------KAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSL
3dm5B           YHQLRQLLDRYHI--------------------EVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGR
2aexA           ----------------------------------------------------------------------
3bm2B           ----------------INRR-SASRLAEPAPTGEQLQNILRAGRAPDWHFFVIEGEGRERFSAVLAAGSD
1e2kB           ASETIANIYTTQH-RLDQGEISAGDAAVVM-----------TSAQITMGMPYAVTDAVLAP----HIGGE
2dpyA           ENILGPDGRARSVVIAAPADVSPLLRM-QGAAYATRIAE-------------------------------
1e9sA           FGR-------------------------------------------------------------------
1e2lA           IFTTQHRLDQGEISAGDAAVVMTSAQITMGMP-YAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLC
1e2lB           PMTYWRVLGASETIANIFTTQHRLDQ---GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSP
3dkvA           ETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMG--RPIDY
3dfdA           AKELREAYKTEDPVEVAKRVLSVGGEY-------------------------------------------
1e2mB           ASETIANIYTTQHRLDQGAVVMTSAQITMGAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAAR
2bwjB           RSKLIRDIMER---GDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMD
1dw9A           SRGCIDDRIPTDPTYRFYELQVYGTTLKALVHEKFGDGIISAINFKLDVKKV-ADPEGGERAVITLDGK-
2c5mD           ----------------------------------------------------------------------
1e2jA           TTQHRLDQGEISAGDAAVVMTSANITMGMAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMG
1chdA           ----------------------------------------------------------------------
1d8jA           -------------------------------------------------DTHPLTLDEILDETQHLDIGL
3b85B           AVEAGEKLGFLPDPYLRPLHDALRDV--EPEVIPKLEAGIVEVAPLAYRGRTLNDAFVILDEAQNTTPAQ
1e2jB           GASETIANIYTTQHRLDQGEISAGDAAVVM-TSANITMGMPYAVTDAVLAPH------------------
3ci2A           ----------------------------------------------------------------------
1e9sK           FGR---DKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGR------------
3cddA           GERVITGYSYDESTITISSGRDKTADLVDCSID-YPSGDIVCKPFGIKVIV--NTDVGEPFQRIQIEQGE
1e2nB           ASETIANIYTTQHRLDQSAGDAAVVMTSAQITMGMPYDAVLAPHIGGEAGSPPALIFDRHPIAALLCYPA
1e2mA           ANI----YTTQHRLDQGEISAGDAAVV------------MTSAQITMGMPYAVTDAVLAPHIGGEAGSPP
2a5vA           RVAPSVLLGRRDG--LSRVDEFEQRHVHETVAILMARSSAISERIAG-----------------------
2dx7A           ---------------AFVEDIRKAIKIPIISMIEETAKKVKELGFKKAGLLATTGTIVSGVYEKEFSKYG
2a78A           DGEEVQIDILDTAGQEDYAAIRDNYFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLED
3cphA           VKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME
3do6A           ----------------------------------------------------------------------
2bwjD           RSKLIRDIMER---GDLVPSGIVLELL-------------------------------------------
3bs4A           IRI-LSRFGVDVIKYLENHRLAIVDTFSFHGIMPGVWYLEGMLSSETLPIKYAKAVEDHKKVW-MDLNLF
3c85A           DELRARYISLGIEIREEAAQQHRSEGRNVISGDATDPDFWERILDTGHVKLVLLAPNQTALEQLQRRNYK
1d6aA           QETWGK---ISTAIHDAKNGVLPKPLELVDASGAKWIVLRVDEIKPDVALLNYVGGSC------------
2bhvC           -----------TADKMIPAFLISSQIAGKVIAQVESDIFAHMGKAVLIPKGSKVIGYYSNNNKMG---EY
1e2hA           ANIY------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2c95B           RGKKLSEIMEK---GQLVPLETVLDMLRDAMVAKVNTSKGFLIDYPREVQQGEEFERRIGQPTLLLYVDA
3bb1D           RAGFTLNIIDTPGLIEGGYINDMALNIIKSFLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDGKGIWN
1dwmA           ----------------------------------------------------------------------
3cr8B           -------------------------------------------------TLVNLIDPEKRE-ALKHEALS
1ckeA           HVDVASEDALVPLASHL----------DVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVR
1agpA           DGETCLLDILDTAGQEEYSAMRDQYMRTGEGAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLA
2awiA           ------------------------------------------------FKIGSVLKQIRQELNYH-----
2a5vB           RVAPSVLLGRRDG--LSRVDEFEQRHVHETVAILMARSSAISERIAG-----------------------
2atxA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
221pA           DGETCLLDILDTAGQEEY----------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1e6vC           -----------------------------------------------------------------KYMNP
3bfkB           LKN------NKIIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNI


                         +         .         .         .         .         *         .:210
query           QQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET
2d3wB           KKRNDILQMAVLEPELCILDESDSLD-IDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQ
2dwpA           RERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCY--EASY
3b5jA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTV-KNADRIIVMEK
3dmdC           ETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVQARQFNEAVKIDGIILTKLDADARGGAALSISYVI
2dwoA           RERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQP
3cmvH           AMRKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGENVVGSEKNKIAAPFKQAEFQILYG
3cmvG           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAKEGENVVGSETRVKVVKNKIAAPFKQAEFQI
1d1cA           TAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFK--ITRQAMDIVGFSQEEQMSIFKIIAGILHLGN
3b60A           RQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTI-EQADEIVVVED
2ccgA           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHNES
1bifA           RERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYES
3c95A           QQRWLEHRRQVFTPE--FLQGYADELQMLVQQEKVALLKALWQYADEIV---------------------
2ccjB           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNNRLDQEDLKFHEKVIEGYQEIIQRFKSVNA
2bifA           RERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYES
3cmvC           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYG
4dcgA           KMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYP-NQEYDYFHM
3dmdB           ETNRNLMDEMKKIARVTKPNLVIFVGDALAGNAIVQARQFNEAVKIDGIILTKLDADARGGAALSISYVI
2bbsA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILVTSKMEHLKKADKILILHE
2c03B           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEASVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVT
2c61B           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARE-----LHRKGIYPPINVLPSLSRLMNSGIGAGK
3eiuB           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINVLPSLSRLMNSGIGAGK
3eiuA           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINVLPSLSRLMNSGIGAGK
2ccgB           GIGVEEVRALNEFAINGLYPDLTIYLNVSAVGRERIIKNSLDQEDLKFHEKEGYQEIIHNESQRFKSVNA
2dr3A           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMAILQLKRVLAGTGCTSIFVSQVSGFGPGVVDGIIRLDL
1e9cA           DWCKQPDVGLPKPDLVLFLQLQLADAAK----RGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA
2c9yA           PDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITG--EPLIRRSDDNEKALKIRLQAYHTQTTPLI
2a2zD           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDV
1aroP           ERQLLITTLLPKMIARINDWFEEVKAKRGKRPTAFQFLQEIKPEAVAYITIKTTLACLTSADNTTVQAVA
2a30D           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDV
2awnD           VAQVGKPLELYHYPADRFVAPKMNFLPVKVTATAIDQVVELPMPNRQQVWLPVESRDVQVGANMSLGIRP
2b8tA           AKLFTYADKITKLTAICNECGAE------ATHSLRKIDGKHADYNDDIVKIGQEFYSA---VCRHHHKVP
1cr4A           LLAKLAYMRSGLGCDVIILDHISIRKMID--NLMTKLKGFAKSTGVVLVVIDLRGGALRQLSDTIIALER
2akaB           FQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLD-LMDEGTDARDVLEN
2b8wA           WTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQL
2cckA           GYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSEDLKFHEKVIEGYQEIIRFKSVNAD
1e98A           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN----GAFQERALRCFHQLMKDTTLNWKMVDA
2c04A           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEASVARAFDEKVGVTGLVLTKLDGDAGGAALSARHVTG
3cmvA           IVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLANLKQSNTLLIFINQGGNALKFYASVRLDIRR
3b85A           GSKVVTGDGLRLVR-HILRGVDDVHFSELTSSDV-VRHQLVGH---------------------------
3czpB           QERF-KEREKTPYKRYKITEEDWRNRDKWQYVDAVGDVDRTSTEIAPWTLVEANDKRFARVKVLRTINDA
3dm5A           KEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFEATPIGSIIVTKLDGSAKGGGALSAVAAT
1e9fA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRYENG-----------AFQERALRCFHQLMKDTTLNWKMVDA
1e69A           KALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHN-KIVMEAADLLHGVNG
2akaA           AEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEF---KITRQAMDIVGFSQEEQMSIFKIIAGILHLGN
1b0uA           QQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQ
2d3wC           KKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRSFIIVTH--YQRILDYIKPDYVHVLYQ
2a30B           DWMNNQFGQSLELDGIIYLQATPETCLHRIQGIPLEYLKLHYKHESWLLHRTLKTNFDYLQEVPILTLDV
2d62A           RQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQV---EATGDRIAVNK
2d3wD           KKRNDILQMAVLEPELCILDESDGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQ
2dr3E           FIEVLRQAIRDINAKRVVVDSVTTLYINKARSIILQLKRVLAGTGCTSIFVSQVSVGVEHGVDGIIRLDL
2czvA           RAMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDL---ISLGVVIGMEIPQAKAS---ISMYPEI------
2axzC           IKPYPIVDSFGKDYDLTIQTVLKNALTISINRNLKEAQYYIKTIKNISLEINYLKQIYQFLTDKNIDSYL
2d3wA           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQ
1e9dA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN----GAFQERALRCFHQLMKDTTLNWKMVDA
2a5gA           PHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLT-------------------------------
3dt2A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYEALSHGVFVGAAMRAAAEHK
3cmxA           TTTGGNALKFYASV-RLDIRRIGAVKEGENVVGSETRVK-----VVKNKIAAPFKQAEFQILYGEGINFY
1bg0A           QQQLIDDHFLFKEGDRFLQTANACRYWPTGRGIFHNDAKTFLEDHLRIISMQKGGDLVYKRLVTAVDNIE
3b2qA           LRQMGA---ARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGD-DITHPIPDLSGYI
2awnB           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMREISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2c03A           QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVTGLVLTKLDGDARGGAALSARHVTG
2ctsA           QLSAAITALNSESNFARAYA--------------------------------------------------
3bpbA           LEKHGLSGSVVRLEKVLGLKTGLAYLEHNNLLAAGEFVSKPEFQDFNIIEIPEE----ESYAANCIWVNE
3b2qB           GSVTQIPILSMPGDDITHPIPDLSGYITEGQIVVARELH-----RKGIYPPINVLPSLSRLMNSGIGAGK
2b8tB           AKLFTYADKITKLTAICNECGAEATHSLRKIDG-------KHADYNDDIVKIGCQEFYSAVCRHHHKVP-
2d2eA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPFGALVITHYQRILNYIQPDKVHVMMD
2c61A           LRQMGAARNEVPGRRGYPGYMYTDLATLYERAGIVKGAKGSVTQIPILSMPGDD-ITHPIPDLSGYITEG
2axpA           IDSILELYREVSNAGLHTYSWDTGQWSSDIAKDIIFLVEL------------------------------
2cgtH           INKPETGAVELESPFILLADKKISNIREMLPVLEAVAKGKPLLIIAEDVEGEALATLVVNTMRGIVKVAA
1e9rA           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESL------------------------------------
1e2dA           WCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFH-----QLMKDTTLNWKMVDA
3a1wA           IDEAKKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIV-------------------------------
2d0kA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAAGDVPEIFVIGGGRVYEQFLPKAQKLYLTHI
1dhjA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3dt7A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIGGRRPAGVPLVYESWQHGVFVGAAMRAAAEHK
2cjwB           AAVVFDCKFIETSAAVQHNVKE-------------------LFEGIVRQVRLRR-DSKEKNERRLAYQKR
2dr3B           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSIIKRVLAGTGCTSIFVSQVSVGERGFGGPVEHGVD
2awoC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3c8uA           AEVGPECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPEARLVQRWLDHGLNHDAAVARAQGNDLANA
2bdtA           KGERCL--ELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFI---------------------
1e0jB           MRSGLGCDVIILDHISIVVSASGESDERKMIDNMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVS
2a2zB           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQLHYKHESWLLHRTLKTNFDYLQEVPILTLDV
1e3aB           PRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDGPT
2bc9A           QQAMDQLYYVTELTHRIRSKSDFVSFFPDFVWTLRDFSLDLEADPDEYLTYSLKLKKGTSQKDETFNLPR
2a5jA           RRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINAKEIYRKIQQGL---------------------
2d2fA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPFGALVITHYQRILNYIQPDKVHVMMD
2bkhA           EDIRERLHLSSPNFRYLNRGCTRANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIGL
2awnC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEIRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3d31A           QQRVALARALVTNPKILLLDEPLSALDPRTQENAEMLSVLHKKNKLTVLHITHDQTEARIMADRIAVVMD
1e6cA           RPIAEEMEAVLREREALYQDVAHYVVDAAIVCELMQTMRL------------------------------
1e4yA           PQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPS--GRVYHVKFNPPKVEGKDDVTGEELTTRKD
3dt4A           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGRRPAGVPLVYESWQHGVFVGAAMRAAAEHK
1e9sF           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIA----------------------------------
1e9sG           EEWASYGRLLLRETAKKLALIGTPSMREWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD
1cr1A           LLAKLAYMRSGLGCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVVICHLKGALRQLSDTIIALER
3dtbB           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGVIFGGRRPAGVPLVYEALS-WQHGVFVGAAMRSEA
2b8tC           AKLFTYADKITKLTAICNECGAEATHS------LRKIDGKHADYNDDIVKIGCQEF-YSAVCRHHHKVPN
1ai4B           PRRQLVETLTRWDGINLLNDDGKTWQQPGSAILNVWLTSMLKRTVVAAVPMPFDKWYSASGYETTQDGPT
2a1fF           YK-----RILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNR
1e3mA           VETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACALANKIKALTLFATHYFELTQLPEKEGVANVH
1dkiA           VQRALKENFGYNQSVHQINRG------DFSKQDWEAQIDKELSQNQPVYYQG-----VGKVGGHAFVID-
2d4hA           ADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQL
1dhiA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3bo6B           RQFIECLESRLSESGLMPGQYPESDVHPENWKYVSYRNELRSGRDGGEMQSQ------------------
2bwjA           SADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINATPEDVFLQLCTAIDS
3cr7C           KEFTGISAP-YEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKGY------------------------
3dhwC           KQRVAIARALASNPKVLLCDEATSALDPATTRILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISN
421pA           ARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLV-------------------------------
1e0jA           MRSGLGCDVIILDHISIVVSASGESDERKMIDNLTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVS
3cmtD           PETTTGGNALKFYASVRLDIRRIGAVKEGE----NVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFY
2bbsB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2b92B           PDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLIRKFFPKKKCFVFDRPVHRRKLAQ
1e9sJ           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIADLRGFLEGTLAESLFAGSNEASKALTSARFVLSD
1e9sD           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD
1d6jA           ETGLPFVEVYVDVPVEAPYEAPAVKNYELPVQDAVKQIDYLDTKGYLP----------------------
1e2fA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYEN---GAFQERALRCFHQLMKDTTLNWKMVDAS
3czpA           QERF-KEREKTPYKRYKITEEDWRNRDKDQYVDAVGDVDRTSTEIAPWTLVEANDKRFARVKVLRTINDA
2a30A           DWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDV
3d7wA           GQTKTQ--ARSILILIQMISEAARFN------PILWRARQYINSGASFLPDVYMLELWGQQSTQVQHSTD
3dauA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3bgwA           SKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSD
1e9sB           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFGSNEASKALTSARFVLSDKLPEHVTMPDGDFS---
2anbA           QKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAAEYDYLIVNDDFDTALTDLKTIIRAER
2c9oC           ECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI--IRTMLYTPQEMKQIIKI
1draA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3cnlA           PDIERALMLFFGKAGRVSFERPE-----------------------------------------------
2c0bL           HYQIESQIESAFQREVRLPSGGSIVIDSTEAEETAFNTNLEAADEIARQLRDLGGLIVIDFIDMTPVRHQ
3dt4C           WRPQDEEPCAHPNSRFCTPASQCPIIDPAWESPEGIIFGGRRPAGVPLVYESWQHGVFVGAAMRAAAEHK
3d3kA           WYKAAVAWANQNRAPVLSIDPPVHIDAKW-SLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSFG
2a2zA           ETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHR
2d4hB           LTPDEYLTYSLKLKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYSNSKTKTLSGGIQVNGP
2bkiA           EDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNR-------------------------------
3cddF           KADVTDSEIGRYRPLIIVNEEVTTAEGAAKRGQWERQRS-IGKSNAEYTVTGWRIPQLWNINTLVPVIDE
2b8wB           LTHRIRSKSSVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTSLKLKKGTSQKDETFNLPRLCIRKFFPK
1dyhA           HTWESIGRPLPGRKNIILSSQPGTDDRVWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
2a1fD           ---PIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNR
1cr0A           RLLAKLAYRSGLGCDVIILDHISIRK--MIDNLMTKLKGFAKSTGVVLVVICHLKDLLRQLSDTIIALER
3cmvE           RKLAGNLKQSNTLLIFINQGGNALKFYASVRLDIRRIGAVKEGNVVGSETRVKVVKNKIAAPFKQAEFQI
3cddD           TPHELLAR-LAKQRGVLLTSDTFGNLVITRASKTKAGVSL--ILGDNVKAARGR----FSWRQR------
2bbtB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK-MEHLKKADKILILHE
2d4uA           AELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNHDIAVSD----------------------
2drcA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3bgwD           KRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKARELDVVVIALSQLSRQVEQRQDKRPMLSD
2bx2L           HYQIESQIESAFQREVRLPSGGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEI--ARQLRLRDL
2cckB           GLYPDLTIYLNVSAEVGRERIIKNRLDQEDLKFHEKVIEYQEIIRFKSVNADQPLENVVEDTYQ------
2awoA           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3bb1B           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLASDIPVVLIENSGRCNSDEKVLPNGIAWIP
1cr2A           LLAKLAYMRSGLGCDVIILDHISIRKM--IDNLMTKLKGFAKSTGVVLVVICHLKSALRQLSDTIIALER
3bwdD           PITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQ---------------------------
2dr3D           FIEVLRQAIRDINAKRVVVDSVYINKPAMARSIILQLKRVLAGTGCTSIFVSQVSVGERGFGGPVEHGVD
3d3qA           EYLASFDKESAKDIHPNNRKRVLRAIEYKLLSSRKKVQQFTENYDTLLIGIESRETLYLRINKRVDILGH
1dg3A           PDFVWTLRDFSLDLQPLTPDEYLTYSLKLKKGTSQKDET-------------------------------
2ancD           QKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAER
4dfrA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
1eilA           AGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDAALERMADKLRQAGVAFTRGDEALM--QQRKVMGLL
3ecpA           MQTVKLAQE----FPELLAIEDTTSLSYRHQVAEELGKL-GSIQDKSRGWWVHSVLLLEATTFRTVGLLH
2an9A           QKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEEYDYLIVNDDFDTALTDLKTIIRAER
2bjbA           LTVQHTGSSLPSAPHIAMTAAMLRQAGVDIDSTPNRWQVRPGPVAARRWDIEPDLTNAVAFLSAAVVSG-
1e3mB           VETETANILHNATEYSLVLDEIGRGTSTYDGLSLAWACNLANKIKALTLFATHYFELTQLPEKEGVANVH
3cr7A           KEFTGISAPYEAANPEVHVKNYELPVQDAVKQIIDY---LDTK-GYLP----------------------
3ec1A           RSFVCYMANELTVHR-TKLEKADSLYANQLGELLSPPSKRY---AAEFPPLVPRSLSVKERKTDIVFSGL
1afrA           TSFQERATFISHGNTARQAKEHGDIKLAQICGTIAA------DEKRHETAYTKIVEKLFEIDPDGTVLAF
1e2gA           DWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGA--------FQERALRCFHQLMKDTTLNWKMVDA
3cr7D           KEFTGISAP-YEAPANPEVHVKNYELPVQ--DAVKQIIDYLDTKGYLP----------------------
1ak2A           PDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLRSDDNKKALKIRLEAYHTQTTPLVEYYS
2bhjA           KMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHIYATNNGNIRSAITVFPQRSDGKHDFRLWN
3adkA           GPETMTKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVVFSQVCTHLD-
3bczC           EHLPYTAKAESHKDEFTIIPVLVGALSESKEQEFGKLFSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDK
1akeA           PDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKTAPLIGYYSKEAEAGNTKYAKVDG
2dr3C           FIEVLRQAIRDINAKRVVVDSVTTLYINKPASIILQLKRVLAGTGCTSIFVSQVSG-VEHGVDGIIRLDL
3ch4B           DAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIR-------------------------------
1bglA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLTTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
1e9rE           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSARFVLSD
3clvA           NFQVDILEVQKYAQDNNLLFIQTSAKTGTNIKNIFYMLAEEIYKN-------------------------
2c7cH           INKPETGAVELESPFILLADKKISNIREMLPVLEAVAAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAA
3cddC           TPHELLAR-LAKQRGVLLTSDTFGNLVITRASKT---KAGVSLILGDNVKAARGRFSWRQRFSKFTIKAD
1d6jB           PVEVAEQRAPYEAPANPEVHVKNYELPVQAVKQIIDYLDYLPA---------------------------
3cmwC           RMMSQAMRKLAGNLKQ------------------------------------------------------
1e9rD           EEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGGTLAESLFAGSNEASKALTSARFVLSD
2c4rL           HYQIESQIESAFQREGSIVIDSTEALTAIDINSARGDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDF
2awoD           YPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPM------PNRQQVWLPVESRDVQVGANMSLGIRP
1e59A           RYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNS-LRALVKYLDNMSE
2cvfA           HNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITER
3bk7A           LQRVAIAATLLRDADIYLLDEPSAYLDVEQRAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLIVFE-
3bh0A           KRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSD
3di4A           AELVHDVLNVFCTGGQYFKASPVRPGDYLEFFAEIDLLGNLSACPGGDC-----SSEASCHPLLVEIFAP
2dr3F           FIEVLRQAIRDINAKRVVVDSVTTLYINKPAMARSQLKRVLAGTGCTSIFVSQVSGFGPGVEDGIIRLDL
3dffA           DGRWLTAHVEGRQKLAVNDHSPDSDHDLV-GEVADDIRSIIDEFDPTLVVTCAA---IGEHPDHEATRDA
3dfpC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
2awnA           VQMRIEISRLHK------------------------------RLGRTMIYVTHDQVEAMTLADKIVVLDA
2aunA           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLPAIH
4atjA           SWRVPLGRRDSLQAFLANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSN
3d3qB           KELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTDTLLIGIESRETLYLRINKRVDILGH
2aumA           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADIS------VLLSAFHRH
3da4A           YQILLPGEIHIKES--------------------------------------------------------
2ccjA           GIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIKNSNRLDQEDLKFHEKVIEGYQEIIHRFKSVNA
2ausC           VAWIKRILNLEKAGHGGTLDPKVSGVLPVALERATRVVQALLPAGKEYVALMHL-HGDVPEDKIRAVMKE
3bb1A           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK--SDIPVVLIENSGRCNKNDSDEK-VLPN
2ahwD           VTKEDLIKLVEFDNKEYLYYKA------------------------------------------------
2aumB           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFADISVLLSAFHRHGLPAIH
2eg5G           ASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRML----------------------------------
2aunB           EQRLEDLHNAFDMPDITAVWCLRGGYGCGQLLPGLDWGRLEAASPRPLIGFSDISVLLSAFHRHGLPAIH
2a1fE           ---PIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNR
1e9sM           LIGTPSMRELFHWTTIATFDDL------------------------------------------------
3dlbB           GREGGRVAWVADPK---DPRKPIPHLTGLLVPVGSLALLPWEERRRRTREIASWIGRRLGLGTPEAVRAQ
3cr7B           KGLYKKAREGVIKEFTGISAPYEAPANPEVHVKNYELVQDAVKQIIDYL---------------------
1e4vA           VPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRTAPLIGYYSKEAEAGNTKYAKVDG
1drbA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3bb1E           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKKASDIPVVLIENS-GRCNKNDSDEKVLPN
1av6A           KWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVR
2ancB           QKMPHARSIFILPPSKIELDRRLRGRGQIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAER
3dfnC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3dfoD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1e9rF           LIGTPSMRELFHWTTIATFDDL------------------------------------------------
5dfrA           HTWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHI
3crmA           LPYTVAQLAIAPEQRQVLHARIAQRFRQMLEQGFIAEVELHARSDLHAGLPSIRAVGYRQVWDYLDGKLS
3a00A           MQGVKSVKAIPELNARFLFIAPPSVTGAHDKVIVNDDLDKAYK-ELKDFIF-------------------
2dftC           RALMAKRAPLYRRVATMRVDTNRRNPGA-VVRHILSR---------------------------------
2bofX           RSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETAYAGKALKAGSSQARIYFDAGHSAWHSP
2ck3C           GCSMGEYFRDNGKHALIIYDDLSKQAVAY-RQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGG
3dymA           ATRIDPNAWVEKAAGHYQAEAALLQCTADTLADAVLITTHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
1cjaA           GYDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQELSISPQAIPFI-------------------
3dfnA           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3dfqA           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1accA           NIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILS-----GYIVEIE-DTEGLKEVINDRYDMLNI
3e8aC           ----------------------------------------------------------------------
3dfoC           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1e9sL           ELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNG
1cs4C           ----------------------------------------------------------------------
2b8tD           EPFGPIAKLFTYADKITKLTAICNE-CGAEATHSLRKIDGKHADYNDDIVKIGCQEFYSAVCRHHHKVPN
2ancF           LKTIIRAERLRMSRQKQRHDALISKL--------------------------------------------
1e9sH           LIGTPSMRELFHWTTIATFDDL------------------------------------------------
3dfqC           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3cnnA           PDIERALMLFFGKAGRVSFERP------------------------------------------------
2ahvA           VTKEDLIKLVEFDNKEYLYYKA------------------------------------------------
1e2kA           GPPPALTLIFDRHPIAALLCYPLMGSMTPQAVLAFVLIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGER
2dflA           SIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLRLAEVYDIAVIITNQVMHTLYHVPGIRIQLKK
3dftD           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1eamA           VASSLKWRCPFPDQWIKDFYIPNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYAKKMYYLNK
3cbnA           PTDIVCRKSDYICSRTLIRADKAAFDLDENLVRDLR--------KGRELKVEII----------------
2boeX           DALMSAAQAAGKIPILVVSNAPGRDCGGAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVL
3dfpD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1adoA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1culC           ----------------------------------------------------------------------
3dfqD           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1e9sI           EEWASYGRLLLRETAKKLALIG------------------------------------------------
1bmfC           GCSMGEYFRDNGKHALIIYDDLSKQAVAY-RQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGG
3dm9B           RSETNRNLDEKKIARVTKPNLVIFVGDALAGNAIVEQARFNEAVKIDGIILTKLDADARGGAALSISYVI
3bjdB           EQEIAAQSRERHPSQVFSGSASRAQLQVFLRHQWFRTFRLYRDAADLLVNLTDVDEAAA--LARYLYGEL
2bhvA           YRLDVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG-----VPLLLSTLTNGLLAFGDYLLMQLMRQ
2bkeA           SIKLIVVDSVTSHFRAEYPGRENLAVRQQKLNKHLHQLRLAEVYDIAVIITNQVVPGI---RIQLKKSRG
3dyoA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLTTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
2b0lC           --------HHMSKAVVQMAISSLSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVILESAGVIES
3be4A           CTHPASGRIYHVKYNPPKQPGIDDVTGEPLVWRDDDNAEAVVRLDVFHKQTAPLVKFYEDLGILKRVNAK
3cioD           MLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQRLEQAGVNIKGAIL--------------------
2a1fC           YK-----RILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNR
3dfnD           KELSDIAHRIVAPGKGILAANESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
3c15C           ----------------------------------------------------------------------
3dftC           KELSDIAHRIVAPGKGILAASESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1cfrA           DFSIIDIRGRREELKSMLKDISFSNISLSTISEIDNLYKFIDYAELEHIKSFLSVKTTFRPDRRLQLAHE
3czjA           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
2dftA           RALMAKRAPLYRRVATMRVDTNRRNPGA-VVRHILSR---------------------------------
1aldA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
2bbtA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
3bb1F           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLK-KDIPVVLIENSGRCNKNDSDEK--VLPN
1dp0A           RIDPNAWVERWKAAGHYQAEAALLQCTADTLADALITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
3cmuA           GLAARMMSQAMRKLAGNLKQ--------------------------------------------------
2d4uB           AELIQLLGAGKINE---FFDQPTQGYQDGFEKQYVAYMEQNDR--LHDIAVSDN----------------
2bhvD           YLDIVWSRIITPHGINIMLTNGYNGLVGELIERNFQRYGITFGDYLLMQLMRNQILRDKSKIAPIVVIRE
3bb1C           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLKSD-IPVVLIENSGRCNKNDSDEK--VLPN
1cjtC           ----------------------------------------------------------------------
6aldA           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
1c9kC           RCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAAD---EVWLVVSGIGVKI-----------
3b55A           NDLKPL--KNVGSASIVGLGEATHGAHEV-FTKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLT---
3c7kA           ----------------------------------------------------------------------
3cm0A           ELVRRILRRAELEGRSDDNEETVRRRLEVYREKTEPVGYYEARGVLKRVDGLGTPDEVYARIRAA-----
3cueF           KRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS-----------------------
3d1mB           TRNSERFKELTPNPDIIFKDEEDRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYE
2bv7A           IVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKVRLFLVNYTATIDVIYE----------------
1e9sE           KLALIGTP--------------------------------------------------------------
2e85A           APENDIVAIRELRPTRLLIVDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFL
1dekB           PIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKF
2czvB           RAMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDL---ISLGVVIGMEIPQA-------------------
1e9rG           KLALIGTPSMRELFHWTTIA--------------------------------------------------
1cjuC           ----------------------------------------------------------------------
3d1mA           TRNSERFKELTYNPDIIFKDEENTGADRLMTQRCKDKLNALAISGVKLRVTEGWDEDGHHSEES--LHYE
1dvrA           DDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKRLAAYHAQTEPIVD-
1e9rB           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIR
3ed8A           ----------------------------------------------------------------------
1azsC           ----------------------------------------------------------------------
2c9gA           ----------------------------------------------------------------------
2d7vA           ----------------------------------------------------------------------
3cmvB           LAARMMSQAMRKLAGNLKQSNT------------------------------------------------
1e2nA           AALLCYPAARYLMGSMTPQAVLAFVALIPHIDRLAKRQRPGERLDLAMLAAIRRVYGLL--ANTVRYLQC
1e2iB           AHAPPPALTLIFDRHPILLCYPAARYLMQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLA
3a00B           MQGVKSVKAIPELNARFLFIAPPSGAHDK--VIVNDDLDKAYKELKDFIFAEK-----------------
3c14C           ----------------------------------------------------------------------
1e1qB           YPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAPTNVISITDGQIFLETELFYK------
1e2hB           YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIRLAKRLDLAMLAAIRRVYGLL--ANTVRYLQC
2dpyB           PATKGYPPSVFAKLPALV----------------------------------------------------
1dekA           NIEDQWSVRRLMQALGTDLIVN---NFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDA--ARAM
3bv4A           KELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHET
2cbzA           KQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMKNKTRILVTHSMSYLPQVDVIIVMSG
2e85B           APENDIVAIRELRPRLLIVDATDMGLNPGEIRIIDPD-----DIAEMFMMTPLNYLIDQLKEDIGEVIFL
1ckvA           ----------------------------------------------------------------------
2bboA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
3bb1H           IWNKAI----VALTHAQFSPPDGL----PYDEFFSKRSEALLQVVRSGASLK-----KDSDIPVVLIENS
3bjqB           QARVVD---------PILSTHARGYRQSTLIGKKLFPVAPVAQYGGKILTFGKEAYNTKRNTKRIDFGYE
3bb1G           KAIVALTHAQFSPPDGLPYDEFFSKRSEALLQVVRSGASLSDIPVVLIENSGR----CNKNDSDEKVLPN
2cdnA           VSEEVLLERLKGRGRADDTDDV---ILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALG-
3brwA           ATS--EEELFSTNEESPAFVEFLEFLGQKVKLQDFKLDVTHGQTGTESVYCNFRNKEIMTEGDAQQLQRK
2d7vB           ----------------------------------------------------------------------
1ek0A           ERKVAREEGKLAEEKGLLFFETS-AKTGENVNDVFLGGEKIPL---------------------------
1e2iA           MTPQAVLAFVALIPPTLPGT--------------------------------------------------
1cjvC           ----------------------------------------------------------------------
1bccF           TKYEEDVPYLEPYLKEVI----------------------------------------------------
3dvlD           LIERINYAIQKYRARRVSIDSVTSDASSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYEEFVSD
3b9qA           MEELIACKKAVGKIVSGAPNEILLVLDGNTGLMLPQAREFNEVVGITGLILTKLDGSARGGCVVSVVEEL
3dm5B           HKEDKALIEMKQISNVIHPHEVILVIDGTIGQQAYQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAAT
2aexA           -------------DELAHRCSSFMAPPVTDLGELRRRPETQAQVCQALAQVDGGANFSVDRWERKEGLQD
3bm2B           DKAIDKARNAPFRAPLIITVVAKVPRWEQESAAVAQAAVAQGFGGIWRSGALTE----SPVVREAFGCRE
1e2kB           AHAPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAV--------------------------------
2dpyA           ----------------------------------------------------------------------
1e9sA           ----------------------------------------------------------------------
1e2lA           YPAARYLMGSMTPQAVLAFVA-------------------------------------------------
1e2lB           PALTLIFDRHPIAALLCYPAARYLSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKR------
3dkvA           VINIQVDKEELMERLTGRRICS------------------------------------------------
3dfdA           ----------------------------------------------------------------------
1e2mB           YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTVR------
2bwjB           CSADTMTNRLLQMRSSLPVDDTTKTIAKRLYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAID-
1dw9A           ----------------------------------------------------------------------
2c5mD           KSCGLHVTSIKIDP-YINIDAGLTKDNNLTTGKIYQKERKGDYLGKTVQVVPHITDAIQEWVMRQALEPQ
1e2jA           SMTPQAVLAFVALIPPTLPGTNIVLGEDRHIDRLAKRQRPGERLDLAMLAAIRRVYGLL--ANTVRYLQC
1chdA           ---------LLSSEKLIAIGASTGGT-----EAIRHVLQPLPLSSPAVIITHMPPGFTRSFAERLNKLCQ
1d8jA           KQKQWLMTEALVNPKIEVIDGKYAFKPK------------------------------------------
3b85B           KFL----TRLGFGSKVVTGDSGLRLVRHILRGVDVHFSELTSSDVVRHQLVGHI----VDAYE-------
1e2jB           ----------------------------------------------------------------------
3ci2A           -------------------------LVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVD
1e9sK           ----------------------------------------------------------------------
3cddA           TPHELLARLAKQRGGNLVITRASKTKAGVSLILGDNVKAARGRFSWRQRFKFTIKAAKADVTDSEIGRYR
1e2nB           ARYLMGSMTPQAVLAFVIPPTLPGTNIVLGALPEDRHIDRLAKLDLAMLAAIRRVYGLLANTQCGGSWRE
1e2mA           ALTLIFDRHPIAALLCYPAARYLMGMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGE-
2a5vA           ----------------------------------------------------------------------
2dx7A           VEIMTPTEDEQKDVMRGIYEGVKAGNLKLGRELLLKTAKILEERGAECAGCTEVSVVLKQDDLKVPLIDP
2a78A           KRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLM-------------------------------
3cphA           TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLV------------------
3do6A           ----------------------------------------------------------------------
2bwjD           ----------------------------------------------------------------------
3bs4A           EGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYKKYPRGTNFWLWEGVKDKRVLLSVYRRAD
3c85A           GQIAAIAEYPD-QLEGLLESGVDAAFNIYSEAGSGFARHVCKQLEPQFTSI-------------------
1d6aA           ----------------------------------------------------------------------
2bhvC           RLDIVWSRIITPHGINIMLTNAYNGLVGELIERNFQRYG-------------------------------
1e2hA           ----------------------------------------------------------------------
3cbqA           ----------------------------------------------------------------------
2c95B           GPETMTQRLLKRGETSGRVDDNEETIKKRLET--------------------------------------
3bb1D           KAIVALTHA-------------------------------------------------------------
1dwmA           ------------------------------GNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVN
3cr8B           LPSLDLDWQQQCELE-MLMTGAYSPLTGFMTRAQCARVESAFWPSPITLTSRDRALADRRPGERLARDGE
1ckeA           EALLRRQRAFRELPGLIADAPVKIFLDASSEERAHRRMLLQVKGFSVNFERLLAEIKLVPAADALVLDST
1agpA           ARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTVREIRQ---------------------------
2awiA           QIDLYSG---ISKSVYIKVEPISVEELSKFSE--------------------------------------
2a5vB           ----------------------------------------------------------------------
2atxA           ----------------------------------------------------------------------
3cqcA           ----------------------------------------------------------------------
221pA           ----------------------------------------------------------------------
2cxxB           ----------------------------------------------------------------------
1e6vC           NYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEME-------------------------------
3bfkB           VILL-VGNKSDLKHLRVINDNDATQYAKKEKLAFIE----------------------------------


                         .         .         .         +         .         .         .:280
query           GRIVLEGPASELKHNARVREAYLGR
2d3wB           GRIVKSGDFTLVKQLEEQGYGWLT-
2dwpA           QPLDPDKCDRDLSLI----------
3b5jA           GKIVEQGKHKEL-------------
3dmdC           DAPILFVGVGQGYDDLRPFEK----
2dwoA           LDPDKCDRDLSLIKV----------
3cmvH           EGINFYGELVDLGVKEKLIEKA---
3cmvG           LYGEGINFYGELVDLGVKEKLI---
1d1cA           IKFEKGAGEGAVLKDKTAL------
3b60A           GIIVERGTHSELLAQHGVYAQLHKM
2ccgA           QRFKSVNADQPLEDTYQTIIKYL--
1bifA           LDEEQDRDLSYIKIMDVGQSYV---
3c95A           -------------------------
2ccjB           DQPLENVVEDTYQTIIK--------
2bifA           LDEEQDRDLSYIKI-----------
3cmvC           EGINFYGELVDLGVKEKLIEKA---
4dcgA           YFMLRTVYCNKTFPTTKAKVLFLQQ
3dmdB           DAPILFVGVGQGYDDEWFLERIFG-
2bbsA           GSSYFYGTFSELQNLRPDFSSKL--
2c03B           GKPIYFAGVSEKPEGLEPFYP----
2c61B           TREDHKAVSDQMYA-----------
3eiuB           TREDHKAVSDQMYAG----------
3eiuA           TREDHKAVSDQMYAG----------
2ccgB           DQPLENVVEDTYQT-----------
2dr3A           DEIDGELKRSLIVWKMRGTSHSMRR
1e9cA           SKSIEAVHEDIRVLSEDAIATATEK
2c9yA           EYYRKRGIHSAIDASQTPDVVF---
2a2zD           NEDFKDKYESLVEK-----------
1aroP           SAIGRAIEDEARFGR----------
2a30D           NEYE---------------------
2awnD           EHLLPSDIADVILEGEVQVVEQLGN
2b8tA           NRPYLNSNSEEFIKF----------
1cr4A           NQLVLVRILKCRFTGDTGIAGYMEY
2akaB           KLLPLRGYIGVVNRSQKDIDGK---
2b8wA           EKLQDEELDPEFVQQVADFCSYIFS
2cckA           QPLE------NVVEDTYTIIKYLEK
1e98A           SKRIEAVHEEIRVLSEDAIRTATEK
2c04A           KPIYFAGVSEKPEYPERLAGRILGM
3cmvA           IGAVKEGENVVGSET----------
3b85A           -------------------------
3czpB           -------------------------
3dm5A           GAPIKFIGTGEKIDDIEPFSRLLGL
1e9fA           SKSIEAVHEDIRVLSEAIATATEKP
1e69A           VSAIVPV------------------
2akaA           IKFEKGAGEGAVLKD----------
1b0uA           GKIEEEGDPEQVFGNPQSPQQFLKG
2d3wC           GRIVKSGDFTLVKQLEEQGYGWL--
2a30B           NEYE---------------------
2d62A           GELQQVGTPDEVYYKPVNT------
2d3wD           GRIVKSGDFTLVKQLEEQGYGWL--
2dr3E           DEIDGELKRSLIVWKMRGTSHSMR-
2czvA           -------------------------
2axzC           NAVNIINIFKIIGKEDIHRS-----
2d3wA           GRIVKSGDFTLVKQLEEQGYGWL--
1e9dA           SKSIEAVHEDIRVLEDAIATATEKP
2a5gA           -------------------------
3dt2A           GKVIMHDPFAMRPFFGYNFGKYLA-
3cmxA           GELVDLGVKEKLIEKAGAWYSY---
1bg0A           SKLPFSHDDRFGFLTFCPTNLG---
3b2qA           TEGQIVVLHRKGIYPP---------
2awnB           GRVAQVGKPLELYHYPADRFVA---
2c03A           KPIYFAGVSEKPEYPERLAGRILG-
2ctsA           -------------------------
3bpbA           RVIMPAGYPRTREKIARLGYRVIE-
3b2qB           TREDHKAVSDQMYAG----------
2b8tB           NRPYLNSNSEEFI------------
2d2eA           GRVVATGGPELALELEAKGYEWLKE
2c61A           QIVVARELHRKGIYPP---------
2axpA           -------------------------
2cgtH           VKAPGFGDRRKAMLQDIAT------
1e9rA           -------------------------
1e2dA           SKSIEAVHEDIRVSEDAIATATEKP
3a1wA           -------------------------
2d0kA           DAEVEGDTHFPDYEPDDWESVF---
1dhjA           DAEVEGDTHFPDYEPDDWESVS---
3dt7A           GKVIMHDPFAMRPFFGYNFGKYLAH
2cjwB           KE-----------------------
2dr3B           GIIRLDLDEIDGELKRSLIVW----
2awoC           GRVAQVGKPLELYHYPA--------
3c8uA           RAIEAARLPADL-------------
2bdtA           -------------------------
1e0jB           ITDLRGSGALRQLSD-TIIALERNQ
2a2zB           NEDFKDKYESLVEK-----------
1e3aB           GSLNISVGAKILYEA----------
2bc9A           LCIRKFFPKKKCFVFDR--------
2a5jA           -------------------------
2d2fA           GRVVATGGPELALELEAKGYEWLKE
2bkhA           DDEEKLDLFRVVAGV----------
2awnC           GRVAQVGKPLELYHYPADR------
3d31A           GKLIQVGKPEEIFEK----------
1e6cA           -------------------------
1e4yA           DQEETVRKRLVEYHQMTAPGYYSK-
3dt4A           GKVIMHDPFAMRPFFGYNFGKYLAH
1e9sF           -------------------------
1e9sG           KLPE---------------------
1cr1A           NQLVLVRILKCRFTG----------
3dtbB           KVIMHDPFAMRPFFG-YNFGKY---
2b8tC           RPYLNSNSEEFIKF-----------
1ai4B           GSLNISVGAKILYEAVQ--------
2a1fF           VVGDHMGMLATVMNGLAMRDSL---
1e3mA           LDALEHGDTIAFHSVQD--------
1dkiA           GADGRNFYHVNWGWGGVSDGFF---
2d4hA           EKLQDEELDPEFVQQVADFCSYIFS
1dhiA           DAEVEGDTHFPDYEPDDWESVF---
3bo6B           -------------------------
2bwjA           IFL----------------------
3cr7C           -------------------------
3dhwC           GELIEQDTVSEVFSH----------
421pA           -------------------------
1e0jA           ITDLRGSGALRQLSD-TIIALERNQ
3cmtD           GELVDLGVKEKLIEKAGAWYSY---
2bbsB           GSSYFYGTFSELQNLRDSFDQFSAE
2b92B           LEKLQDEELDPEFVQ----------
1e9sJ           KLPEHVTMPDGDFSI----------
1e9sD           KLPEHVTMPDG--------------
1d6jA           -------------------------
1e2fA           KSIE---------------------
3czpA           -------------------------
2a30A           NEYE---------------------
3d7wA           GVFNNPIALAIAPGVIVTL------
3dauA           DAEVEGDTHFPDYEPDDWESVF---
3bgwA           LRESLEQDADIIEFLYR--------
1e9sB           -------------------------
2anbA           LRMSRQKQRHDALISKLLAD-----
2c9oC           RAQTEGINISE--------------
1draA           DAEVEGDTHFPDYEPDDWESVF---
3cnlA           -------------------------
2c0bL           RAVENRLREAVRQDRAR--------
3dt4C           GKVIMHDPFAMRPFFGYNFGKYLAH
3d3kA           CKFVI--------------------
2a2zA           TLKTNF-------------------
2d4hB           RLESLVLTYVNAISSGDL-------
2bkiA           -------------------------
3cddF           IGLDEELIASILFSE----------
2b8wB           KKCFVFDRPVHRRKLAQLEKLQ---
1dyhA           DAEVEGDTHFPDYEPDDWESVF---
2a1fD           VVGDHMGMLATVMNGLAMRDSLFR-
1cr0A           NQLVLVRILKCRFTGDTGIAGYM--
3cmvE           LYGEGINFYGELVDLGVKEKLI---
3cddD           -------------------------
2bbtB           GSSYFYGTFSELQNLRPDFSSKLMD
2d4uA           -------------------------
2drcA           DAEVEGDTHFPDYEPDDWESVF---
3bgwD           LRESGQLEQDADIIEFLYRDDY---
2bx2L           GGLIVIDFIDMTPVRHQRA------
2cckB           -------------------------
2awoA           GRVAQVGKPLELYHYPADR------
3bb1B           HLVQITEVALNKSESIFVDKNLI--
1cr2A           NNLVLVRILKCRFTGDTGIAGYM--
3bwdD           -------------------------
2dr3D           GIIRLDLDEIDGELKRSLIVWK---
3d3qA           GLFNEVQHLVEQGFEASQSQA----
1dg3A           -------------------------
2ancD           LRMSRQKQRHDA-----LISKLLA-
4dfrA           DAEVEGDTHFPDYEPDDWESVF---
1eilA           CLQDPFGLPLEIYYG----------
3ecpA           QEWWMRPDDPADADEKESGKWL---
2an9A           LRMSRQKQRHDALISKLL-------
2bjbA           GTVRITGWPRVSVQPAD--------
1e3mB           LDALEHGDTIAFHSVQD--------
3cr7A           -------------------------
3ec1A           GWVTCNDPGAQLVHAPKGVDVFI--
1afrA           ADMMRKKISMPAHL-----------
1e2gA           SKSIEAVHEDIRVSEDAIATATEKP
3cr7D           -------------------------
1ak2A           KRGIHSAIDAS--------------
2bhjA           SQLIRYAGYQMPDGTIRGDAAT---
3adkA           -------------------------
3bczC           GSIIEQLDPVSFSNYLKKYHNT---
1akeA           TKPVAEVRADLEK------------
2dr3C           DEIDGELKRSLIVWKMRGTSHSMRR
3ch4B           -------------------------
1bglA           EVASDTPHPARIGLNC---------
1e9rE           KLPEHVTMPDGDFSI----------
3clvA           -------------------------
2c7cH           VKAPGFGDRRKAMLQ----------
3cddC           SAGLPTVGGIKAD------------
1d6jB           -------------------------
3cmwC           -------------------------
1e9rD           KLPEHVTMPDGDFSI----------
2c4rL           IDMTPVRHQRAVENRLRE-------
2awoD           EHLLPSDIADVILEGEVQVVEQLGN
1e59A           EEILELNIPTGVPLVKPLKRYYLG-
2cvfA           G------------------------
3bk7A           GEPGRHGRALPPMGMREGMNRFL--
3bh0A           LRELEQDADIIEFLYRDDYYDKE--
3di4A           AEGLGDWPSPSV-------NGYDRS
2dr3F           DEIDGELKRSLIV--WKMRGTSHSM
3dffA           ALFATHEKNVPVRLWEDLPYAV---
3dfpC           LYQKAD-------------------
2awnA           GRVAQVGKPLELYHYPA--------
2aunA           GPVATGLGLQE--------------
4atjA           TGLPDPTL-----------------
3d3qB           GLFNEVQHLVEQGFEASQSQAI---
2aumA           GLPAIHGPVATG-------------
3da4A           -------------------------
2ccjA           DQPLENVVEDTYQ----TIIKYLEK
2ausC           FEGEIIQRTRKVYYIEILEIDG---
3bb1A           GIAWIPHLVQTI-------------
2ahwD           -------------------------
2aumB           GPVATGLGLEQ--------------
2eg5G           -------------------------
2aunB           GPVA---------------------
2a1fE           VVGDHMGMLATVMNGLAMRDSL---
1e9sM           -------------------------
3dlbB           AYRLSIPKLMGRRAV----------
3cr7B           -------------------------
1e4vA           TKPVAEVRADLEK------------
1drbA           DAEVEGDTHFPDYEPDDWESVFSEF
3bb1E           GIAWIPHLVQTITEVAL--------
1av6A           NKVV---------------------
2ancB           LRMSRQQRHDALISK----------
3dfnC           LYQKADD------------------
3dfoD           LYQKADD------------------
1e9rF           -------------------------
5dfrA           DAEVEGDTHFPDYEPDDWESVFSEF
3crmA           YAEMTERGIIATRQLAK--------
3a00A           -------------------------
2dftC           -------------------------
2bofX           AQMA---------------------
2ck3C           GSLTALPVIETQAGD----------
3dymA           EVAS---------------------
1cjaA           -------------------------
3dfnA           LYQKADD------------------
3dfqA           LYQKADD------------------
1accA           SSLRQDGKTFIDFKK----------
3e8aC           -------------------------
3dfoC           LYQKADDGRPFPQ------------
1e9sL           GNLFITWREDMGPALRPLISAWVDV
1cs4C           -------------------------
2b8tD           RPYLNSNSEEFIKF-----------
2ancF           -------------------------
1e9sH           -------------------------
3dfqC           LYQKADDGRPFPQ------------
3cnnA           -------------------------
2ahvA           -------------------------
1e2kA           LDL----------------------
2dflA           SRGN-RRIARVVDA-----------
3dftD           LYQKADD------------------
1eamA           IVRNKVVVNFDYPNQE---------
3cbnA           -------------------------
2boeX           ETMAYAGKALKAG------------
3dfpD           LYQKADD------------------
1adoA           LYQK---------------------
1culC           -------------------------
3dfqD           LYQKADD------------------
1e9sI           -------------------------
1bmfC           GSLTALPVIETQAGD----------
3dm9B           DAPILFVGVGQ--------------
3bjdB           GEEDEKGSHPRLLA-----------
2bhvA           SGMGINQVVNQI-------------
2bkeA           NRRIARVVDAPHLPEGEVVFALTEE
3dyoA           EVASDTPHPARIGLNCQLAQ-----
2b0lC           RSLGMKGTYIKVLNNKFLIELE---
3be4A           LPP----------------------
3cioD           -------------------------
2a1fC           VVGDHMGMLATVMNGLAMRDSL---
3dfnD           LYQK---------------------
3c15C           -------------------------
3dftC           LYQKADD------------------
1cfrA           GSLM---------------------
3czjA           EVAS---------------------
2dftA           -------------------------
1aldA           LYQKADD------------------
2bbtA           GSSYFYGTFSELQNL----------
3bb1F           GIAWIPHLVQTITEVAL--------
1dp0A           EVAS---------------------
3cmuA           -------------------------
2d4uB           -------------------------
2bhvD           GSRVFISPNTDIFFPNEVIAEFL--
3bb1C           GIAWIPHLVQTITEVALNKSES---
1cjtC           -------------------------
6aldA           LYQKADD------------------
1c9kC           -------------------------
3b55A           GKGNPSQHLTPVFKTDWIRQYNANP
3c7kA           -------------------------
3cm0A           -------------------------
3cueF           -------------------------
3d1mB           GRAVDITTSDRDRSKYGMLARLAVE
2bv7A           -------------------------
1e9sE           -------------------------
2e85A           GIQPDIVGFYYPMTQPIKD------
1dekB           NSGYDYYIVPDTRQDHEMDA-----
2czvB           -------------------------
1e9rG           -------------------------
1cjuC           -------------------------
3d1mA           GRAVDITTSDRDRSKYGMLARLAVE
1dvrA           -FYKKTGIWAGVDASQPPATVW---
1e9rB           SWLEDPNGGNLFITWRE--------
3ed8A           -------------------------
1azsC           -------------------------
2c9gA           -------------------------
2d7vA           -------------------------
3cmvB           -------------------------
1e2nA           GGSWREDWGQLSGPRPHIGDT----
1e2iB           MLAAIRRVYGLLANTVRYLQCG---
3a00B           -------------------------
3c14C           -------------------------
1e1qB           -------------------------
1e2hB           GGSWREDWGQLSGPQSNAG------
2dpyB           -------------------------
1dekA           GATVIHVVRPGQKSNDTHIT-----
3bv4A           LYQK---------------------
2cbzA           GKISEMGSYQELLARDGAFAEFLRT
2e85B           GIQPDIV------------------
1ckvA           -------------------------
2bboA           GSSYFYGTFSELQNLQPDFSSKLMS
3bb1H           GRCNKNDSDEKVLPNG---------
3bjqB           GDPYSIVPSALEAKV----------
3bb1G           GIAWIPHLVQTITEVALNKSESI--
2cdnA           -------------------------
3brwA           RHIGNDIVAVVFQDENTPFVP----
2d7vB           -------------------------
1ek0A           -------------------------
1e2iA           -------------------------
1cjvC           -------------------------
1bccF           -------------------------
3dvlD           NVVILRNVLEGERRRRTLE------
3b9qA           GIPVKFIGVGEAVEDLQPFEAFVNA
3dm5B           GAPIKFIGTGEKIDDIEPFSRLLGL
2aexA           GCVFEKAGVSISVVHGN--------
3bm2B           QDKIVGFPQLVPDPTPFVTYFH---
1e2kB           -------------------------
2dpyA           -------------------------
1e9sA           -------------------------
1e2lA           -------------------------
1e2lB           -------------------------
3dkvA           -------------------------
3dfdA           -------------------------
1e2mB           -------------------------
2bwjB           -------------------------
1dw9A           -------------------------
2c5mD           VCVIELGTVGDIESMPFIE------
1e2jA           GGSWREDWGQLSGPRPHIGDTLF--
1chdA           ISVKEAEDGERVLPG----------
1d8jA           -------------------------
3b85B           -------------------------
1e2jB           -------------------------
3ci2A           KLDNIAQ------------------
1e9sK           -------------------------
3cddA           PLIIVNEEVTAEGAAKR--------
1e2nB           DWGQLSGPQSNAGPRPHIGD-----
1e2mA           -------------------------
2a5vA           -------------------------
2dx7A           MDVIAEVAVKVAL------------
2a78A           -------------------------
3cphA           -------------------------
3do6A           -------------------------
2bwjD           -------------------------
3bs4A           YVLKTRS---SLGENGIKRELLV--
3c85A           -------------------------
1d6aA           -------------------------
2bhvC           -------------------------
1e2hA           -------------------------
3cbqA           -------------------------
2c95B           -------------------------
3bb1D           -------------------------
1dwmA           DHGVVTS------------------
3cr8B           GYMLAILTLSDVWKD----------
1ckeA           TLSIEQ-------------------
1agpA           -------------------------
2awiA           -------------------------
2a5vB           -------------------------
2atxA           -------------------------
3cqcA           -------------------------
221pA           -------------------------
2cxxB           -------------------------
1e6vC           -------------------------
3bfkB           -------------------------