[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39735.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bjuC.bssp"
#ERROR : Can't open dsspfile "1bbuA.bssp"
#ERROR : Can't open dsspfile "3bjuD.bssp"
#ERROR : Can't open dsspfile "3e9hA.bssp"
#ERROR : Can't open dsspfile "1e1tA.bssp"
#ERROR : Can't open dsspfile "2d6fD.bssp"
#ERROR : Can't open dsspfile "1e1oA.bssp"
#ERROR : Can't open dsspfile "1bbwA.bssp"
#ERROR : Can't open dsspfile "1c0aA.bssp"
#ERROR : Can't open dsspfile "1asyA.bssp"
#ERROR : Can't open dsspfile "11asA.bssp"
#ERROR : Can't open dsspfile "3bjuB.bssp"
#ERROR : Can't open dsspfile "1b8aA.bssp"
#ERROR : Can't open dsspfile "2du5B.bssp"
#ERROR : Can't open dsspfile "2du3B.bssp"
#ERROR : Can't open dsspfile "3bjuA.bssp"
#ERROR : Can't open dsspfile "1adjA.bssp"
#ERROR : Can't open dsspfile "3dsqB.bssp"
#ERROR : Can't open dsspfile "3dsqA.bssp"
#ERROR : Can't open dsspfile "3bamA.bssp"
#ERROR : Can't open dsspfile "3cmqA.bssp"
#ERROR : Can't open dsspfile "1bhmB.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "2du5A.bssp"
#ERROR : Can't open dsspfile "2du3A.bssp"
#ERROR : Can't open dsspfile "2dq3A.bssp"
#ERROR : Can't open dsspfile "2bamB.bssp"
#ERROR : Can't open dsspfile "1eiyA.bssp"
#ERROR : Can't open dsspfile "2e3cA.bssp"
#ERROR : Can't open dsspfile "2du7A.bssp"
#ERROR : Can't open dsspfile "2du4A.bssp"
#ERROR : Can't open dsspfile "2dq2A.bssp"

## Summary of PDB Search
:351
    2e-25  21%  3bjuC  [x.x.x] LYSYL-TRNA SYNTHETASE
    6e-25  25%  1bbuA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    4e-24  20%  3bjuD  [x.x.x] LYSYL-TRNA SYNTHETASE
    9e-24  26%  3e9hA  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-22  24%  1e1tA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    2e-19   8%  2d6fD  [x.x.x] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT E
    4e-19  24%  1e1oA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    2e-15  25%  1bbwA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    3e-15  23%  1c0aA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
    3e-14  17%  1asyA  [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
    1e-13  13%  11asA  [d.104.1] ASPARAGINE SYNTHETASE
    4e-13  28%  3bjuB  [x.x.x] LYSYL-TRNA SYNTHETASE
    6e-12  18%  1b8aA  [b.40.4 - d.104.1] PROTEIN (ASPARTYL-TRNA SYNTHETASE)
    2e-10  10%  2du5B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-10  10%  2du3B  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-10  29%  3bjuA  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-08  12%  1adjA  [d.104.1 - c.51.1] HISTIDYL-TRNA SYNTHETASE
    3e-08  16%  3dsqB  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    8e-08  29%  3dsqA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    1e-07   6%  3bamA  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BAMHI)
    1e-07  10%  3cmqA  [x.x.x] PHENYLALANYL-TRNA SYNTHETASE, MITOCHONDRIAL
    2e-07   8%  1bhmB  [c.52.1] PROTEIN (BAMHI (E.C.3.1.21.4))
    3e-07  24%  1b70A  [d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    5e-07  14%  2du5A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    5e-07  14%  2du3A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-06  15%  2dq3A  [x.x.x] SERYL-TRNA SYNTHETASE
    3e-06   7%  2bamB  [c.52.1] PROTEIN (ENDONUCLEASE BAMHI)
    6e-06  26%  1eiyA  [a.2.7 - d.104.1] PHENYLALANYL-TRNA SYNTHETASE
    9e-06  20%  2e3cA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    2e-05  19%  2du7A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-05  17%  2du4A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    3e-04  11%  2dq2A  [x.x.x] SERYL-TRNA SYNTHETASE
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxFASPWWDPARYLDRKPFLRARSAVTXXXXXXXXXXXXXXVETAILQLSPGNETHLHAPRTEFKGP
3bjuC           -----------DLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELD
1bbuA           -----YRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPGGAAARPFITHH----
3bjuD           -----------------------IIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKP----FITYH
3e9hA           --------------MNPESKKTFITRSLIIQSMRRYLDSHGYLEVETPMMHAVAGGAAARPFITHHNALD
1e1tA           --------------ANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALD
2d6fD           ------------DEFHTMRKQVIDGSNTGGFQRTGLVATDGHLETPQGTVKIENLCLEEDAARRIRETGD
1e1oA           ---------YLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHH----
1bbwA           -----YRQRYLDLISNDESRNTFKVRSQILSGIRQFMVNRGFMEVETPMMQVIPAARPFITHHNALDL--
1c0aA           --------------RYLDLRRPEKTRAKITSLVRRFMDDHGFLDIETPML-----TKATPEGARDYLVPS
1asyA           ------------------------------------------------------------SEGGSSVFEV
11asA           --------------------------------------------VQAPILSRVGDGTQDNLSGAEKAVQV
3bjuB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2du5B           -----------------FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDR
2du3B           -----------------FSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDR
3bjuA           ----------------------------------------------------------------------
1adjA           ----------------------LRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKE
3dsqB           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------NWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSA
3cmqA           ----------------------------------------------------------------------
1bhmB           --------------------------------------------VYKEFIENSELKRVGMEFETGNISSA
1b70A           -----------------LFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPEGP
2du5A           ------------------------------------------------------------DEVFPEFKEL
2du3A           ------------------------------------------------------------DEVFPEFKEL
2dq3A           --------------------------------------------ICPPHLVKPEILIGTGQLPKFEEDLY
2bamB           ----------------------NWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSA
1eiyA           ----------------------LHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPEGP
2e3cA           ----------------------ENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQ
2du7A           --------------------------------------------LNVSNEMGLKVLETAFPEFKDLKPES
2du4A           -----------------------------------------------------------YLATLPKFKEL
2dq2A           ----------------------VILDLALIRFALDRLIEKGFTPVIPPYMVRRFVEEGSTSFEDFEDVIY


                         .         .         *         .         .         .         .:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVXXXXXXX
3bjuC           M----NLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKM
1bbuA           NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
3bjuD           NELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKM
3e9hA           ----MTLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENL
1e1tA           L----DMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDLIELTESL
2d6fD           GVVFRLDRLGILVEITTDPSMSDPQQVAYQIGQILRST--RVKRGLGTIRQDLNISIRDGARVEVK----
1e1oA           NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISV-HNPEFTMMELYMAYADYHDLIELTESL
1bbwA           -----DMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGI-SVHNPEFTMMELYMAYADYKDLIELTESL
1c0aA           RVHKGKFYLPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTA----------
1asyA           TYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRENSNTHRHMTEFTGLDMEMAFEVLDTLSELFVFI
11asA           KVKALPAQFEVVHSLAKWKHDFSAGEGLYTHMKALRPDELSPLHSVYVDQWDWERVMGDGERQFSTLKST
3bjuB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2du5B           KPISSTLTLRSHMTTGWFITLSHIADKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELSVDDGKAVAE
2du3B           KPISSTLTLRSHMTTGWFITLSHIADKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELSVDDGKAVAE
3bjuA           ----------------------------------------------------------------------
1adjA           DRGGRSLTLRPEGTAAMVRAYLEHGMRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILDAEAVVL
3dsqB           --------PNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDM
3dsqA           ----------LYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLE---------
3bamA           HRSMNKLLLGLKHGEIDLAIILMPIKYLTDRVTNFEEPYFELTEGQPFIFIG------------------
3cmqA           -------MLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGE
1bhmB           HRSMNKLLLGLKHGEIDLAIILMPIKYLTDRVTNFEELEFELTEGQPFIFIG------------------
1b70A           EGRLLLRTH-TSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIA---------
2du5A           KPISSTLTLRSHMTTGWFITLSHIADKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELS--VDDGKAV
2du3A           KPISSTLTLRSHMTTGWFITLSHIADKLFSIDRCFRREQGDATRLYTYFSASCVLVDEELS--VDDGKAV
2dq3A           KCERDNLYLIPTAEVPLTNLYREEILYLTAYTPCYRRDIRGIIRQHQFDKVELV----------------
2bamB           HRSMNKLLLGLKHGEIDLAIILMPIKYLTDRVTNFEELEFELTEGQPFIFIG------------------
1eiyA           LGEVEGRLLRTHTSPMQVRYMVAHTFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIA---------
2e3cA           FRVDKNFCLRPMLAPNLYNYLRKDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGS------------
2du7A           TTLT----LRSHMTSGWFITLSSLIKKLFSIDRCFRREQRDRSHLMSYHSASCVVVGE------------
2du4A           KPISSTLTLRSHITLSHIADKLPLPIKLFSIDRCFRREQGEDARLYTYFSASCVLVDE------------
2dq2A           KVEDEDLYLIPTAEHPLAGMHANEILLYVGVSPCFRKEAAGKDTKGIFRVHQFHKVE-------------


                         +         .         .         .         .         *         .:210
query           XXXXXRTTGIGQFSFRGRTADPQAEPEMLTVAAAFARFAGIDLLATIIGGEGXXXXXXXXXXXXXXXXXX
3bjuC           VSGMVKHITGSKVTYHPDGPEGQAYDVDFT--PPFRRINMVEELEKALGLFETEETRKILDDICVAKAVE
1bbuA           FRTLAQDIGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEK----
3bjuD           VSGMVKHITGSKVTYHPDGPEGQAYDRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECP
3e9hA           IAHIATEVLGTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPHMTFG
1e1tA           FRTLAQEVLGTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGL
2d6fD           ------GVQDLDLIPEIVEREVKRQLSLVEIRDTLQERGAVVEDKIFDVSEVFADTESRIISSAESVLAV
1e1oA           FRTLAQEVLGTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGL
1bbwA           FRTLAQDIGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLD-----NFDSAKAIAESIGIHVE
1c0aA           ----------------------------------------------------------------------
1asyA           FSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEI-----------------GD
11asA           VEAIWAGIKAEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDLDAKGRERAI------------------
3bjuB           ----------------------------------------------------------------------
1b8aA           ----------------------------------------------------------------------
2du5B           ALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDIATFGIYSPTALAEYDIPYPVMN
2du3B           ALLRQFGFENFRFRKDEKRSKYYIPDTQTEVFAFHPKLVGSSTKYSDIATFGIYSPTALAEYDIPYPVMN
3bjuA           ----------------------------------------------------------------------
1adjA           LYECLKELGLRRLKVKLSSVG-------------------------------------------------
3dsqB           ARWVLEAAGIREFELVTESSVVGDTVDVMK----------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3cmqA           SLQLFEQSSRSQETHTMEAVKLVEFDLKQTLTRLMAHLDELEIRWVDCYFPFTHPSFEMEINFHGEWLEV
1bhmB           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2du5A           AEALLRQFGFENFRFRKDEKRKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIP
2du3A           AEALLRQFGFENFRFRKDEKRKYYIPDTQTEVFAFHPKLVGSSTKYSDGWIEIATFGIYSPTALAEYDIP
2dq3A           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
2du7A           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XNWSDIFSKVLVDHIEPRLGEGRLTVLCEYPAPEAALARTKADDPRVAERFEVYACGVELANGFGELTDA
3bjuC           CPPPRTTARLLDKLVGEFLEVINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
1bbuA           -SWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
3bjuD           PPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
3e9hA           HIVNEFFEQKVEDKLIQP------TFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDP
1e1tA           GRIVTEIFDEVAEAHL-----IQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
2d6fD           KLRGFDGLIGVEIQPGRRLGTEMADYAKKRGVSGIFHTDELPAYGITEEEVRGLRDAVGASQGDAVVMVA
1e1oA           GRIVTEIFDEVAEAHL-----IQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1bbwA           KSWGLGRIVTEIFEEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1c0aA           ------------------------HHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNG
1asyA           FEDLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYMPDPANPKYSNSYDFFMRGEEILSGAQRIHDH
11asA           -AKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLGDILVWNPVLEDAFELSSMGIRVDAD
3bjuB           --------------------------ICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
1b8aA           --WGEDIDTEGERLLGKYMMENENYFLYQYPSEAKPFYIKYDNKPEICRAFDLEYRGVEISSGGQREHRH
2du5B           LGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVVPQTAVGLKIAQSIVETAEKHASEPSP
2du3B           LGLGVERLAMILYGYDDVRKMVYPQIHGEIKLSDLDIAREIKVVPQTAVGLKIAQSIVETAEKHASEPSP
3bjuA           ---------------------------CDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
1adjA           ----------------------------------------------------------------------
3dsqB           GDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLN---------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3cmqA           LGCGVMEQQLVNSAG------AQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFKQFCVSNINQKVK
1bhmB           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2du5A           YPVMNLVERLAMILYGYDDVRKMVYPQIHGEIKLSDLEIKVKEVPQTAVGLKIAQSIVETAEKHASEPSP
2du3A           YPVMNLVERLAMILYGYDDVRKMVYPQIHGEIKLSDLEIKVKEVPQTAVGLKIAQSIVETAEKHASEPSP
2dq3A           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
2du7A           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEQRLRFTASMDEKERRYGERYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPPADEx
3bjuC           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
1bbuA           EDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFP-----
3bjuD           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTAEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
3e9hA           IDQRQRFEEQLKEREQGNDEAHEMDEDFLEAEYGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFP-----
1e1tA           EDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFP-----
2d6fD           HERVTAENALREVIRRAEMAIQGVPEETRKALDGNTQYLRPLPTSSRMYLETDIPLFR------------
1e1oA           EDQAERFQEQVNAKAAGDDEAMFYDEDYVTALYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFP-----
1bbwA           EDQAQRF------------LDQVYDEDYVTALEGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFP-----
1c0aA           DMQQTVFGILGINEE----EQREKFGFLLDAKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKT---
1asyA           ALLQERM------KAHGLSPEDPGLKDYCDGFYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP-----
11asA           TLKHQLALTGDEDRLELEW-------HQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQAGV-----
3bjuB           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
1b8aA           DILVEQIKEKGLNPES-------FEFYLKAFRYGMPPHGGFGLGAERLIKQMLDLPNIREVILFP-----
2du5B           CSFLAFEGEMMGRNVRVY----------------------------------------------------
2du3B           CSFLAFEGEMMGRNVRVY----------------------------------------------------
3bjuA           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
1adjA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3bamA           ----------------------------------------------------------------------
3cmqA           FQPLSKYPAVINDISFWLPSENYAENDFYDLVTIGGDLVEKVDLIDKFVHPKTHKTSHCYRIYRHMERT-
1bhmB           ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
2du5A           CSFLAFEGEMMGRNVRVY----------------------------------------------------
2du3A           CSFLAFEGEMMGRNVRVY----------------------------------------------------
2dq3A           ----------------------------------------------------------------------
2bamB           ----------------------------------------------------------------------
1eiyA           ----------------------------------------------------------------------
2e3cA           ----------------------------------------------------------------------
2du7A           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
2dq2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           x
3bjuC           -
1bbuA           -
3bjuD           -
3e9hA           -
1e1tA           -
2d6fD           -
1e1oA           -
1bbwA           -
1c0aA           -
1asyA           -
11asA           -
3bjuB           -
1b8aA           -
2du5B           -
2du3B           -
3bjuA           -
1adjA           -
3dsqB           -
3dsqA           -
3bamA           -
3cmqA           -
1bhmB           -
1b70A           -
2du5A           -
2du3A           -
2dq3A           -
2bamB           -
1eiyA           -
2e3cA           -
2du7A           -
2du4A           -
2dq2A           -