[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE39945.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c58A.bssp"
#ERROR : Can't open dsspfile "1eaqA.bssp"
#ERROR : Can't open dsspfile "1eaqB.bssp"
#ERROR : Can't open dsspfile "1a5tA.bssp"
#ERROR : Can't open dsspfile "1eg7B.bssp"
#ERROR : Can't open dsspfile "2chgB.bssp"
#ERROR : Can't open dsspfile "2chgC.bssp"
#ERROR : Can't open dsspfile "2chqA.bssp"
#ERROR : Can't open dsspfile "1a0eA.bssp"
#ERROR : Can't open dsspfile "3do6A.bssp"

## Summary of PDB Search
:346
    1e-09   7%  3c58A  [x.x.x] DNA GLYCOSYLASE
    3e-08  11%  1eaqA  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    3e-08  11%  1eaqB  [b.2.5] RUNT-RELATED TRANSCRIPTION FACTOR 1
    4e-08  28%  1a5tA  [x.x.x] DELTA PRIME
    4e-05  22%  1eg7B  [c.37.1] FORMYLTETRAHYDROFOLATE SYNTHETASE
    7e-05  25%  2chgB  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    2e-04  23%  2chgC  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    3e-04  29%  2chqA  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    9e-04  10%  1a0eA  [c.1.15] XYLOSE ISOMERASE
    0.001  17%  3do6A  [x.x.x] FORMATE--TETRAHYDROFOLATE LIGASE
:346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxDIVAKLPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYRMARFVLAHRD
3c58A           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1eaqB           ----------------------------------------------------------------------
1a5tA           --------------------YPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP
1eg7B           --------------------------------------------ITPTPAGEGKTTTSVGLTDA------
2chgB           ----------------------------------------------------------------------
2chgC           --------IWVEKYRPRTLDVVGQDEVIQRLKGYVERKNIPH-LLFSGPPGTGKTATAIALAR-------
2chqA           ----------------------------------------------------------------------
1a0eA           -------------------KLVKDGVLDKFIEEKYRSFREGIGRDI--------VEGKVDFEK--LEEYI
3do6A           ---------------------KIDHRFLKSLENHEDGKLILVTAVTPTPAGEGKTTTSIGLSSL------


                         .         .         *         .         .         .         .:140
query           PLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVITVDESRETIGFFGSTAAVEGW
3c58A           ---------------PELPEVETVRRELEKRIVKIISIEATYPRMVL-TGFEQLKKELTGKTIQGISRRG
1eaqA           -------------------------------------------------SVEVLADHPGELVRTD--SPN
1eaqB           -------------------------------------------------SVEVLADHPGELVRTD--SPN
1a5tA           QGHKS-------CGHCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGA-------
1eg7B           -LARLGKRVMVCLREPSLGPSFGIKGGAAGG---------------------------------------
2chgB           ----------------------------------------------------------FARTAPIGGAPF
2chgC           -----------DLFGENWRDNFIEMNASDERGIDVVRHKIKEFARTA-------PIGGAPFK--------
2chqA           ---------------------------------------------------------------------F
1a0eA           IDKETIELPSGKQEYLESLINSYIVKTILE----------------------------------------
3do6A           --NRIGKKSIVTLREPS-----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPARVLPTIQSRCRKLMLRPxxxxxxxxxxxxx
3c58A           KYLIFEIGDDISHLRMEGKYRLATLDAPHLTMKFADGQLIYADVRKFGTWELISTDQ-------------
1eaqA           FLSSVLPTHWRSNKTLPIAFKVVALGVPDGTLVTVANYSAELRNATAAKNQVARFND-------------
1eaqB           FLSSVLPTHWRSNKTLPIAFKVVALGVPDGTLVTVANYSAELRNATAAKNQVARFND-------------
1a5tA           KVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAP-------------
1eg7B           ----------------------------------------------------------------------
2chgB           KIIFLDEADALTADAQAALRRTMEMYSKSCRFILSCNYVSRIIEPIQSRCAVFRFKP-------------
2chgC           -IIFLDEADALTADAQAALRRTMEMYSKSCRFILSCNYVSRIIEPIQSRCAVFRFKP-------------
2chqA           KIIFLDEADALTADAQAALRRTMEMYSKSCRFILSCNYVSRIIEPIQSRCAVFRFKP-------------
1a0eA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c58A           ----------------------------------------------------------------------
1eaqA           ----------------------------------------------------------------------
1eaqB           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
1eg7B           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1a0eA           ----------------------------------------------------------------------
3do6A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c58A           ------------------------------------------------------------------
1eaqA           ------------------------------------------------------------------
1eaqB           ------------------------------------------------------------------
1a5tA           ------------------------------------------------------------------
1eg7B           ------------------------------------------------------------------
2chgB           ------------------------------------------------------------------
2chgC           ------------------------------------------------------------------
2chqA           ------------------------------------------------------------------
1a0eA           ------------------------------------------------------------------
3do6A           ------------------------------------------------------------------