[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE40040.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "1ay0A.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "2e6kA.bssp"
#ERROR : Can't open dsspfile "3ea4A.bssp"
#ERROR : Can't open dsspfile "3c38A.bssp"
#ERROR : Can't open dsspfile "2c31A.bssp"
#ERROR : Can't open dsspfile "2ag1A.bssp"
#ERROR : Can't open dsspfile "3e12A.bssp"
#ERROR : Can't open dsspfile "1bfdA.bssp"
#ERROR : Can't open dsspfile "2ef9A.bssp"
#ERROR : Can't open dsspfile "2ef9B.bssp"
#ERROR : Can't open dsspfile "2c3yB.bssp"
#ERROR : Can't open dsspfile "3ecdA.bssp"
#ERROR : Can't open dsspfile "3ecdC.bssp"

## Summary of PDB Search
:344
    9e-54  27%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-53  27%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    4e-53  27%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-52  26%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    9e-52  26%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    9e-52  26%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-51  28%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    7e-51  26%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-50  27%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-49  26%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    7e-48  24%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-47  27%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    4e-47  27%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-45  26%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    8e-38  12%  1ay0A  [c.36.1 - c.36.1 - c.48.1] TRANSKETOLASE
    6e-36  11%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    8e-34  15%  2e6kA  [x.x.x] TRANSKETOLASE
    6e-27  11%  3ea4A  [x.x.x] ACETOLACTATE SYNTHASE, CHLOROPLASTIC
    3e-26   7%  3c38A  [x.x.x] AUTOINDUCER 2 SENSOR KINASE/PHOSPHATASE LUXQ
    4e-25  14%  2c31A  [x.x.x] OXALYL-COA DECARBOXYLASE
    5e-18  19%  2ag1A  [x.x.x] BENZALDEHYDE LYASE
    1e-13  11%  3e12A  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    8e-13  19%  1bfdA  [x.x.x] BENZOYLFORMATE DECARBOXYLASE
    5e-10  13%  2ef9A  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    2e-08  13%  2ef9B  [x.x.x] 2-DEHYDRO-3-DEOXYPHOSPHOOCTONATE ALDOLASE
    3e-07  17%  2c3yB  [x.x.x] PYRUVATE-FERREDOXIN OXIDOREDUCTASE
    2e-04  11%  3ecdA  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
    3e-04  13%  3ecdC  [x.x.x] SERINE HYDROXYMETHYLTRANSFERASE 2
:344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxAAKETGQDRNSGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
2beuA           -------SGIPIYRVMGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1dtwA           -------------------------PHLPKEKVLKLYKSMTLLNTMDRILYESQRQG-RISFYMTNYGEE
2bffA           -------------------------PHLPKEKVLKLYKSMTLLNTMDRILYESQRQG-RISFYMTNYGEE
3dv0A           ---------------------EEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLG-FYAPTAGQE
2bfdA           -------------------------PHLPKEKVLKLYKSMTLLNTMDRILYESQRQG-RISFYMTNYGEE
3dvaE           ---------------------EEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLG-FYAPTAGQE
3dvaA           -------------------------PELSDEQLKELMRRMVYTRILDQRSISLNRQGRLG-FYAPTAGQE
2bfcA           -------------------------PHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTN-YGEE
2bfbA           -----------------------EDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2bfeA           -------------------------PHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRIS-FYMTNYGEE
2bp7A           -------------LDEQGDAQGPWAEDIDPQILRQGMRAMLKTRIFDSRMVVAQRQKKMS-FYMQSLGEE
3dv0G           -------------------------PELSDEQLKELMRRMVYTRILDQRSISLNRQGRLG-FYAPTAGQE
3dv0C           -----------------------AMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLG-FYAPTAGQE
3dv0E           ---------------------EEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLG-FYAPTAGQE
1ay0A           ------------------------------TDIDKLAVST--IRILAVDTVSKANSGHPGAPLGMALWSQ
1cp9B           ----------------------------------------------------------------------
2e6kA           -------------------------------RDLET-LSVNAIRFLAIDAVEKARSGHPGPGAPLALFRE
3ea4A           ----------------------------------KNKTPHVSVCGDVKLALQGMNKVLENRAEELKLDFG
3c38A           ----------------------------FRLAALRIHQDSTAKNASLINALVSRDSSRLDEFFSSVDELE
2c31A           ----------------------------------------------------------------------
2ag1A           ----------------------------------------------------------------------
3e12A           ----------------------------------------------------------------------
1bfdA           ----------------------------------------------------------------------
2ef9A           ----------------------------------------------------------------------
2ef9B           ----------------------------------------------------------------------
2c3yB           ----------------------------------------------------------------------
3ecdA           ----------------------------------------------------------------------
3ecdC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGI
2beuA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1dtwA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bffA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
3dv0A           ASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFS---------RGHFHGNQIPEGVNVLPPQII
2bfdA           GTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
3dvaE           ASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFS---------RGHFHGNQIPEGVNVLPPQII
3dvaA           ASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGN-------QIPEGV--NVLPPQII
2bfcA           GTHVGSAAALDNTDLVFGQFREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bfbA           GTHVGSAAALDNTDLVFGAYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bfeA           GTHVGSAAALDNTDLVFGAAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bp7A           AIGSGQALALNRTDMCFPTYRQQSILMARDVSLVEMICQLLSNERDPLKGRQLPIMYSVREAGFFTISGN
3dv0G           ASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLP---------PQII
3dv0C           ASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLP---------PQII
3dv0E           ASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLP---------PQII
1ay0A           MRMNPTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQFRQLGSRTPGHPEFELPGVEVTTGP
1cp9B           -----------------------------------------------------------------NVWLV
2e6kA           VRHNPLDPDWPDRDRFVLSAGHGSLLYAVLHLTGYDLPLEELKSFRQWGSKTPGHPERGHTPGVEVTTGP
3ea4A           VWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAIISTGVGQHQMWAAQFYNYKKPRQ--WLS
3c38A           LSNAPDLRFISSHDNILWDDGNASFYGIAQQELNKLIRRVA----ISGNWHLVQTPSEGKSVHILMRRSS
2c31A           ----------TPSGMMNYSNSLGVVRDFMLANPDISLVNEGANALDNTRMIVDMLKPRKR--LDSGTWGV
2ag1A           ------------------------------------------------------SEVSRVKPGGFLCHGY
3e12A           ------------------------------------------------------FLCRQTDLLLAAAKTG
1bfdA           ------------------------------------------------------LNMRNPGSYYFCAAGG
2ef9A           ------------------------------------------------------FLCRQTDLLLAAAKTG
2ef9B           ------------------------------------------------------FLCRQTDLLLAAAKTG
2c3yB           ----------------------------------------------------------------------
3ecdA           ------------------------------------------------------VVTSTTHKTLRGPRGG
3ecdC           ------------------------------------------------------VVTSTTHKTLRGP---


                         +         .         .         .         .         *         .:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
2beuA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1dtwA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bffA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
3dv0A           IGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
2bfdA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
3dvaE           IGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPVEKQ
3dvaA           IGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPVEKQ
2bfcA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bfbA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bfeA           LATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bp7A           LATQFVQAVGWAMASAIKGDTKIASAWIGDGATAESDFHTALTFAHVYRAPVILNVVNNQWAISTFQAIA
3dv0G           IGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
3dv0C           IGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
3dv0E           IGAQYIQAAGVALGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
1ay0A           LGQGISNAVGMAMAQANLAADNYTYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSI
1cp9B           GKTKASGAKAILLNGPQFGWFNPAYTYG------IGLHGAGFNINTPFAYPAILFGHNGHVSWGSTAGFG
2e6kA           LGQGISTAVGLALAERKLVVDHYTYVLASDGDL-EGVSGEAASLAGHWGLSKLIVFDDNRISIDGP-TDL
3ea4A           SGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHFLGDPAQED
3c38A           LIIVLNDNFALLENIRSGSNSENLVLAVDTTPLVSTLKGNEPYYVVHSAKDADSIVGQTFLEVESVPTYL
2c31A           MGIGMGYCVAAAAVTGKP-------VIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGGQPGVISCTR
2ag1A           LGSGVGFGTALGAQVADLEAGRRTILVTGDGS--VGYSIGEFDTLVRKQLPLIVIINNQSWGATLHFQQL
3e12A           RAVNVKKGQFLAPWDTKN----VVEKLKFGGGTTFGYNNLVVDFRSLKQWAKVIYDATHSVQLPGGGGMR
1bfdA           LGFALPAAIGVQLAEPER----QVIAVIGDGSANYS--ISALWTAAQYNIPTIFVIMNNGTEAENVPGLD
2ef9A           RAVNVKKGQFLAPWDTKN----VVEKLKFGGAKEIGYNNLVVDFRSLQWAKVIYSVQLPGGLGDKSGGMR
2ef9B           RAVNVKKGQFLAPWDTKN----VVEKLKFGGATTFGYNNLVVDFRSLQWAKVIYSVQLPGGLGDKSGGMR
2c3yB           ----------------------------------------------------------------------
3ecdA           ---------FVLTNDEEIAKKINSAVFGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAG
3ecdC           -------RGGFVLTNDEEIAKKINSAVGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAG


                         .         .         .         +         .         .         .:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
2beuA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRNY
1dtwA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSS-----
2bffA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSAYREVG
3dv0A           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHENEWKKDPLVRF
2bfdA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGSTDHPISRLRHYLL
3dvaE           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDNEWAKKD
3dvaA           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDDPTRYRS
2bfcA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIDHPISRLRHYLL---
2bfbA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRDHPISRLRHYLLS---
2bfeA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHSTDHPISRLRHYL
2bp7A           GGESTFAGRGVGCGIASLRVDGNDFVAVYAASRWAAERARRGLGPSLIEWVTYRAGPHSTSDDPSKYRPA
3dv0G           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTDPTNEWAK---
3dv0C           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTENEWAKKDPLV
3dv0E           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYEWAKKDPLVRFRKFL
1ay0A           SFDEDVAKRYEAYGWEVLYVENGNEDLAGIA-KAIAQAKLSKDKPTLIKMTTTIGYGSLHAGSHSPLKAD
1cp9B           DGVDIFAEQVSPEDPNSYLHQGQWKKMLS----RQETLNVKGEQPITFEIYRTVHGNVVKRDKTTHTAYS
2e6kA           AFTEDVLARYRAYGWQTRVEDVNDLEALR----KAIKLAKLDERPTLIAVRSHIGFGSPKQDSAKHGEPL
3ea4A           EIFPNMLLFAAACGIPAARVTKKA------DLREAIQTMLDTPGPYLLDVICPHQEHVLMIPSGGTFNDV
3c38A           CIQTN-----------------------------------------------------------------
2c31A           LTRGRYDMMMEAFGGKGYVANTP--AELKAALEEAVAS----GKPCLINAMIDPDAG-------------
2ag1A           AVNGSYHGVAAAFGADGYHVDSVE------SFSAALAQALAHNRPACINVAVALDPI-------------
3e12A           EFIFPLIRAAVAVGCDGVFMETHP------EPEKALSDASTQLPLSQLEGII--EAILEIREVAS-----
1bfdA           VPGIDFRALAKGYGVQALKADNLE------QLKGSLQEALSAKGPVLIEVST------------------
2ef9A           EFIFPLIRAAVAVGCDGVFMETHPE------PEKALSDAPTALPLSQLEGII--EAILEIREVAS-----
2ef9B           EFIFPLIRAAVAVGCDGVFMETHPE------PEKALSDAPTALPLSQLEGII--EAILEIREVAS-----
2c3yB           -------------------VATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVM
3ecdA           GVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPETITSGIRLGTPAGTTRGFGAA
3ecdC           GVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTIT--SGIRLGTPAGTTRG


                         .         *         .         .         .         .         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYR
2beuA           WDKQD----HPISRLRHYLLSQGWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVY-
1dtwA           -AYRHPISRLRHYLLSQGW----WDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVY-
2bffA           YWDKQDHPISRLRHYLLSQGW--WDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVY-
3dv0A           RKFLEAKG--------------LWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMFE
2bfdA           SQGW-------------------WDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVY-
3dvaE           PLVRFRKFLEAKGL---------WSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMFE
3dvaA           ELENEWAKKDPLVRFRKFLEAKLWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMF-
2bfcA           -------------------SQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bfbA           --------------------QGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bfeA           L------------------SQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVY-
2bp7A           DDWSHFPLGDPIARLKQHLIKGHWSEEEHQATTAEFEAAVIAAQKEAEQGHIPSAASMFEDVY-
3dv0G           --------KDPLVRFRKFLEKGLWSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMF-
3dv0C           RFRKFLEAKGL------------WSEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMF-
3dv0E           EAKGLW------------------SEEEENNVIEQAKEEIKEAIKKADETPKQKVTDLISIMF-
1ay0A           DVKQLK-SKFGFNPDKSFVVPQEVDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARR-
1cp9B           KARAWDGKELTSLMAWVKQGQAQNWQQWLDQAQNQALTINWYYADKDGN---------------
2e6kA           GPEAVEATRRNLGWPYPPFVVPEEVYRHDREKGRAWQEAWEKAEAYARAYPDL-----------
3ea4A           ITEG-----DGR----------------------------------------------------
3c38A           ----------------------------------------------------------------
2c31A           ----------------------------------------------------------------
2ag1A           ----------------------------------------------------------------
3e12A           ----------------------------------------------------------------
1bfdA           ----------------------------------------------------------------
2ef9A           ----------------------------------------------------------------
2ef9B           ----------------------------------------------------------------
2c3yB           N-TAVKSGYWPLFRYDPRLAGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRS------------
3ecdA           EFREVG---RLILEVFEALTNPEGDHATEQRVRREIFALC------------------------
3ecdC           FGAAFREVGRLILEVFEALTNPEGDHATEQRVRREIFALCER----------------------