[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rpal2:ABE40088.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dcfA.bssp"
#ERROR : Can't open dsspfile "3dcfB.bssp"
#ERROR : Can't open dsspfile "2dg7A.bssp"
#ERROR : Can't open dsspfile "3cjdB.bssp"
#ERROR : Can't open dsspfile "3br3A.bssp"
#ERROR : Can't open dsspfile "1a6iA.bssp"
#ERROR : Can't open dsspfile "3colA.bssp"
#ERROR : Can't open dsspfile "3cjdA.bssp"
#ERROR : Can't open dsspfile "3br0B.bssp"
#ERROR : Can't open dsspfile "3br0A.bssp"
#ERROR : Can't open dsspfile "3crjB.bssp"
#ERROR : Can't open dsspfile "3br6A.bssp"
#ERROR : Can't open dsspfile "1bjzA.bssp"
#ERROR : Can't open dsspfile "3crjD.bssp"
#ERROR : Can't open dsspfile "3br5E.bssp"
#ERROR : Can't open dsspfile "3crjA.bssp"
#ERROR : Can't open dsspfile "3dewA.bssp"
#ERROR : Can't open dsspfile "1bj0A.bssp"
#ERROR : Can't open dsspfile "3br5D.bssp"
#ERROR : Can't open dsspfile "3bqzB.bssp"
#ERROR : Can't open dsspfile "3c2bB.bssp"
#ERROR : Can't open dsspfile "2dt5A.bssp"
#ERROR : Can't open dsspfile "3colB.bssp"
#ERROR : Can't open dsspfile "1du7A.bssp"
#ERROR : Can't open dsspfile "3br2D.bssp"
#ERROR : Can't open dsspfile "1bjyB.bssp"
#ERROR : Can't open dsspfile "3dpjA.bssp"
#ERROR : Can't open dsspfile "3bt9B.bssp"
#ERROR : Can't open dsspfile "3bhqA.bssp"
#ERROR : Can't open dsspfile "3br2E.bssp"
#ERROR : Can't open dsspfile "3br2A.bssp"
#ERROR : Can't open dsspfile "3br6B.bssp"
#ERROR : Can't open dsspfile "3br5A.bssp"
#ERROR : Can't open dsspfile "2dg8D.bssp"
#ERROR : Can't open dsspfile "3btiB.bssp"
#ERROR : Can't open dsspfile "3egqA.bssp"
#ERROR : Can't open dsspfile "3br1D.bssp"
#ERROR : Can't open dsspfile "3b6cB.bssp"
#ERROR : Can't open dsspfile "3bruA.bssp"
#ERROR : Can't open dsspfile "2dg8B.bssp"
#ERROR : Can't open dsspfile "3bqzA.bssp"
#ERROR : Can't open dsspfile "3bniA.bssp"
#ERROR : Can't open dsspfile "3bniB.bssp"
#ERROR : Can't open dsspfile "3b6cA.bssp"
#ERROR : Can't open dsspfile "2dg8A.bssp"
#ERROR : Can't open dsspfile "3bruB.bssp"
#ERROR : Can't open dsspfile "3dpjE.bssp"
#ERROR : Can't open dsspfile "3cwrA.bssp"
#ERROR : Can't open dsspfile "2dg8C.bssp"
#ERROR : Can't open dsspfile "3b81A.bssp"
#ERROR : Can't open dsspfile "3cdlA.bssp"
#ERROR : Can't open dsspfile "3br5B.bssp"
#ERROR : Can't open dsspfile "3br3B.bssp"
#ERROR : Can't open dsspfile "2dtzD.bssp"
#ERROR : Can't open dsspfile "2eh3A.bssp"
#ERROR : Can't open dsspfile "3b6aA.bssp"
#ERROR : Can't open dsspfile "3br1B.bssp"
#ERROR : Can't open dsspfile "3b6aB.bssp"
#ERROR : Can't open dsspfile "3c2bA.bssp"
#ERROR : Can't open dsspfile "3e7qB.bssp"
#ERROR : Can't open dsspfile "3ccyA.bssp"
#ERROR : Can't open dsspfile "3bjbC.bssp"
#ERROR : Can't open dsspfile "3dpjB.bssp"
#ERROR : Can't open dsspfile "2d6yA.bssp"
#ERROR : Can't open dsspfile "3egqB.bssp"
#ERROR : Can't open dsspfile "3e7qA.bssp"
#ERROR : Can't open dsspfile "2d6yB.bssp"
#ERROR : Can't open dsspfile "3dpjF.bssp"
#ERROR : Can't open dsspfile "2dtzB.bssp"
#ERROR : Can't open dsspfile "3crjC.bssp"
#ERROR : Can't open dsspfile "3cwrB.bssp"
#ERROR : Can't open dsspfile "3bjbA.bssp"
#ERROR : Can't open dsspfile "3c07A.bssp"
#ERROR : Can't open dsspfile "3c07B.bssp"
#ERROR : Can't open dsspfile "3bjbF.bssp"
#ERROR : Can't open dsspfile "3bjbE.bssp"
#ERROR : Can't open dsspfile "3cdlB.bssp"
#ERROR : Can't open dsspfile "1cjgA.bssp"
#ERROR : Can't open dsspfile "3bjbB.bssp"
#ERROR : Can't open dsspfile "2bjcA.bssp"
#ERROR : Can't open dsspfile "1aerB.bssp"
#ERROR : Can't open dsspfile "3bjbD.bssp"
#ERROR : Can't open dsspfile "3br2B.bssp"
#ERROR : Can't open dsspfile "3bqyA.bssp"

## Summary of PDB Search
:217
    2e-11  14%  3dcfA  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    2e-11  14%  3dcfB  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    4e-11  15%  2dg7A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    4e-10  10%  3cjdB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    4e-10  12%  3br3A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-10  14%  1a6iA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    7e-10  15%  3colA  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    7e-10   9%  3cjdA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-10  12%  3br0B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-10  12%  3br0A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-10  14%  3crjB  [x.x.x] TRANSCRIPTION REGULATOR
    9e-10  11%  3br6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-09  13%  1bjzA  [x.x.x] TETRACYCLINE REPRESSOR
    1e-09  14%  3crjD  [x.x.x] TRANSCRIPTION REGULATOR
    2e-09  12%  3br5E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-09  15%  3crjA  [x.x.x] TRANSCRIPTION REGULATOR
    4e-09  11%  3dewA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    4e-09  15%  1bj0A  [x.x.x] TETRACYCLINE REPRESSOR
    6e-09  12%  3br5D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    8e-09  12%  3bqzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    8e-09  15%  3c2bB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-08   8%  2dt5A  [x.x.x] AT-RICH DNA-BINDING PROTEIN
    2e-08  22%  3colB  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    2e-08  18%  1du7A  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR PROTEIN
    2e-08  12%  3br2D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-08  18%  1bjyB  [a.4.1 - a.121.1] TETRACYCLINE REPRESSOR
    2e-08  14%  3dpjA  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-08  12%  3bt9B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-08  14%  3bhqA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-08  12%  3br2E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-08  12%  3br2A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-08  11%  3br6B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-08  12%  3br5A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-08  20%  2dg8D  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    4e-08  12%  3btiB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-08  16%  3egqA  [x.x.x] TETR FAMILY TRANSCRIPTIONAL REGULATOR
    5e-08  12%  3br1D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-08  21%  3b6cB  [x.x.x] ACTII PROTEIN
    6e-08  11%  3bruA  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    6e-08  20%  2dg8B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    7e-08  12%  3bqzA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    8e-08  13%  3bniA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    8e-08  15%  3bniB  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    9e-08   9%  3b6cA  [x.x.x] ACTII PROTEIN
    9e-08  20%  2dg8A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    1e-07  15%  3bruB  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    1e-07  22%  3dpjE  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-07  12%  3cwrA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-07  20%  2dg8C  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    1e-07  12%  3b81A  [x.x.x] TRANSCRIPTIONAL REGULATOR, ACRR FAMILY
    2e-07  13%  3cdlA  [x.x.x] TRANSCRIPTIONAL REGULATOR AEFR
    2e-07  10%  3br5B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-07  12%  3br3B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-07  12%  2dtzD  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-07  20%  2eh3A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-07  21%  3b6aA  [x.x.x] ACTR PROTEIN
    3e-07  11%  3br1B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-07  13%  3b6aB  [x.x.x] ACTR PROTEIN
    4e-07  13%  3c2bA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    5e-07  11%  3e7qB  [x.x.x] TRANSCRIPTIONAL REGULATOR
    5e-07  14%  3ccyA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    7e-07  15%  3bjbC  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-07  15%  3dpjB  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    7e-07   9%  2d6yA  [x.x.x] PUTATIVE TETR FAMILY REGULATORY PROTEIN
    8e-07  16%  3egqB  [x.x.x] TETR FAMILY TRANSCRIPTIONAL REGULATOR
    1e-06  11%  3e7qA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-06  10%  2d6yB  [x.x.x] PUTATIVE TETR FAMILY REGULATORY PROTEIN
    3e-06  25%  3dpjF  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    3e-06  11%  2dtzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-06  13%  3crjC  [x.x.x] TRANSCRIPTION REGULATOR
    3e-06  11%  3cwrB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    6e-06  14%  3bjbA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-06  16%  3c07A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    8e-06  16%  3c07B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-05  17%  3bjbF  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-05  17%  3bjbE  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-05  16%  3cdlB  [x.x.x] TRANSCRIPTIONAL REGULATOR AEFR
    4e-05  20%  1cjgA  [a.35.1] PROTEIN (LAC REPRESSOR)
    5e-05  16%  3bjbB  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-05  22%  2bjcA  [x.x.x] LACTOSE OPERON REPRESSOR
    1e-04  12%  1aerB  [d.166.1] EXOTOXIN A
    6e-04  15%  3bjbD  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    0.001  26%  3br2B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    0.001  20%  3bqyA  [x.x.x] PUTATIVE TETR FAMILY TRANSCRIPTIONAL REGULATOR
:217

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSESDTRMPRPKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRA
3dcfA           -------------------------------------TQIIKVATELFREKGYYATSLDDIADRIGFTKP
3dcfB           -------------------------------------TQIIKVATELFREKGYYATSLDDIADRIGFTKP
2dg7A           ------------------------------RWDPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRR
3cjdB           -------------------------------------EKLIDLAEAQIEAEGLASLRARELARQADCAVG
3br3A           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
1a6iA           -------------------------------------SKVINSALELLNEVGIEGLTTRKLAQKLGVEQP
3colA           -------------------------------------VKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQS
3cjdA           -------------------------------------EKLIDLAEAQIEAEGLASLRARELARQADCAVG
3br0B           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3br0A           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3crjB           -------------------------------------TEEIQATYRALREHGYADLTIQRIADEYGKSTA
3br6A           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
1bjzA           -------------------------------------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQP
3crjD           -------------------------------------TEEIQATYRALREHGYADLTIQRIADEYGKSTA
3br5E           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3crjA           -------------------------------------TEEIQATYRALREHGYADLTIQRIADEYGKSTA
3dewA           -------------------------------------RSRLEVATELFAQKGFYGVSIRELAQAAGASI-
1bj0A           -------------------------------------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQP
3br5D           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3bqzB           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3c2bB           -------------------------------------NAVLDQALRLLVEGGEKALTTSGLARAANCSKE
2dt5A           ---------------------------KVPEAAI-SRLITYLRILEELEAQGVHRTSSEQLGGLAQVTAF
3colB           -------------------------------------VKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQS
1du7A           -------------------------------------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQP
3br2D           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
1bjyB           -------------------------------------ESVIDAALELLNETGIDGLTTRKLAQKLGIEQP
3dpjA           ------------------------------AVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRG
3bt9B           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3bhqA           ------------------------------TRSARKDREIIQAATAAFISKGY-DGTSEEIATKAGASKQ
3br2E           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3br2A           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3br6B           -------------------------------------DKILGVA-KELFINGYNATTTGEIVKLSESSKG
3br5A           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
2dg8D           -------------------------------------ERILAATLDLIAEEGIARVSHRRIAQRAGVPLG
3btiB           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3egqA           ------------------------TDQS---------VRIIEAA-LRLYKKPPHEVSIEEIAREAKVSKS
3br1D           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3b6cB           -------------------------------------DRIVVTALGILDAEGLDALSMRRLAQELKTGHA
3bruA           -------------------------------------QSLIRAGLEHLTEKGYSSVGVDEILKAARVPKG
2dg8B           -------------------------------------ERILAATLDLIAEEGIARVSHRRIAQRAGVPLG
3bqzA           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3bniA           -------------------------------------TRILDACADLLDEVGYDALSTRAVALRADVPIG
3bniB           -------------------------------------TRILDACADLLDEVGYDALSTRAVALRADVPIG
3b6cA           -------------------------------------DRIVVTALGILDAEGLDALSMRRLAQELKTGHA
2dg8A           -------------------------------------ERILAATLDLIAEEGIARVSHRRIAQRAGVPLG
3bruB           -------------------------------------QSLIRAGLEHLTEKGYSSVGVDEILKAARVPKG
3dpjE           ------------------------------AVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRG
3cwrA           ------------------------------VPDAVVRESIVGAAQRLLSSGGA--AATEGVASEAGIAKK
2dg8C           -------------------------------------ERILAATLDLIAEEGIARVSHRRIAQRAGVPLG
3b81A           -------------------------------------TELANKIWDIFIANGYENTTLAFIINKLGISKG
3cdlA           -------------------------------------ESIVQAAIAEFGDRGF-EITSDRIAARAEVSKR
3br5B           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3br3B           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
2dtzD           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
2eh3A           -------------------------------------ERILEVSKELFFEKGYQGTSVEEIVKRANLSKG
3b6aA           -------------------------------------DRIVVTALGILDAEGLDALSMRRLAQELKTGHA
3br1B           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3b6aB           -------------------------------------DRIVVTALGILDAEGLDALSMRRLAQELKTGHA
3c2bA           -------------------------------------NAVLDQALRLLVEGGEKALTTSGLARAANCSKE
3e7qB           ----------------------NQEVRFSRLEPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVG
3ccyA           --------------------------------------DTIIERAAAFARQGYSETSIGDIARACECSKS
3bjbC           -------------------------------------HVRLEAAIELATEKEL-ARVQHEVAKRAGVAIG
3dpjB           -------------------------------------DQIVAAADELFYRQGFAQTSFVDISAAVGISRG
2d6yA           ---------------------------------------IFEAAVAEFARHGIAGARIDRIAAEARANKQ
3egqB           ------------------------TDQS---------VRIIEAA-LRLYKKPPHEVSIEEIAREAKVSKS
3e7qA           ----------------------NQEVRFSRLEPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVG
2d6yB           -------------------------------------ARIFEAAVAEFARHGIAGARIDRIAAEARANKQ
3dpjF           -------------------------------------DQIVAAADELFYRQGFAQTSFVDISAAVGISRG
2dtzB           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3crjC           -------------------------------------TEEIQAT-----YRALRDLTIQRIADEY--STA
3cwrB           -------------------------------------ESIVGAAQRLLSSGG--AAATEGVASEAGIAKK
3bjbA           -------------------------------------HVRLEAAIELATEKEL-ARVQHEVAKRAGVAIG
3c07A           -------------------------------------RALILETARLFQERGY-DRTTRAIAQEAGVSVG
3c07B           -------------------------------------RALILETARLFQERGY-DRTTRAIAQEAGVSVG
3bjbF           -------------------------------------HVRLEAAIELATEKEL-ARVQHEVAKRAGVAIG
3bjbE           -------------------------------------HVRLEAAIELATEKELARVQH-EVAKRAGVAIG
3cdlB           -------------------------------------ESIVQAAIAEFGDRGF-EITSDRIAARAEVSKR
1cjgA           --------------------------------------------------------TLYDVAEYAGVSYQ
3bjbB           -------------------------------------HVRLEAAIELATEKELARVQH-EVAKRAGVAIG
2bjcA           --------------------------------------------------------TLYDVAEYAGVSVA
1aerB           -------------------------------------WRGFYIAGDPALAYG---YAQDQEPDRGRIRNG
3bjbD           ---------------------------------------RLEAAIELATEKEL-ARVQHEVAKRAGVAIG
3br2B           -------------------------------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKG
3bqyA           -------------------------------------ARTVQTALDLLNESGLDTLTRRLAQ--ADVQAG


                         .         .         *         .         .         .         .:140
query           ALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGDTQX
3dcfA           AIYYYFKSKEDVLFAIVNSIVDEALERFHAIAAGPGGERIHALLVEHTRTILRNLDANTLFYNLSPERER
3dcfB           AIYYYFKSKEDVLFAIVNSIVDEALERFHAIAAGPGGERIHALLVEHTRTILRNLDANTLFYNLSPERER
2dg7A           SYFRYFPDKREVLFGGSELLPPAVRAVLAADPGAAPLTAVLDASQVGAQLVAQVEGAAQRRAVIDASPEL
3cjdB           AIYTHFQDLNALTLEVNGRTFARLGAAVGAVDHPNERLIASHAYLAFA--REHPKLWRALFDVERSDGPV
3br3A           NLYYHFKTKENLFLEILNIEESKWQEQWKSIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
1a6iA           TLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQ
3colA           NVYLYFKNKQALIDSVYARETNRILSTTDLDRLSDSTIDVTTRIRLYVQQVYSLANPDSLTIIQQIKALN
3cjdA           AIYTHFQDLNALTLEVNGRTFARLGAAVGDDH----PNERLIASHAYLAFAREHPKLWRALFDVERSGPV
3br0B           NLYYHFKTKENLFLEILNIEESKWQEQWKSIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
3br0A           NLYYHFKTKENLFLEILNIEESKWQEQWKSIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
3crjB           AVHYYYDTKDDLLAAFLDYLLERFVDSIHDVETTDPEARLNLLLDELLVKPQENPDLSVERSQAPYKEAF
3br6A           NLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKREKFYLYNELSLTTEYYYPLQNAIIEFYTTNSIN
1bjzA           TLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKE
3crjD           AVHYYYDTKDDLLAAFLDYLLERFVDSIHDVETTDPEARLNLLLDELLVKPQENPDLSVERSQAPYKEAF
3br5E           NLYYHFKTKENLFLEILNIEESKWQEQWKSIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
3crjA           AVHYYYDTKDDLLAAFLDYLLERFVDSIHDVETTDPEARLNLLLDELLVKPQENPDLSVALLERSYKEAF
3dewA           SISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVTAYLRWTIQRHRNNPQLLRFYTSELTNAIV
1bj0A           TLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQ
3br5D           NLYYHFKTKENLFLEILNIEESKWQEQWKSIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
3bqzB           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYTNI
3c2bB           SLYKWFGDRDGLLAAITFQQSKVDRVSAPQLADHLE--VFAHDLLDVLAGDLALNRLAIGQASRDGSKLG
2dt5A           QVRKDLSYFGSYGTRGVGYTVPVLKRELRHILGL------------------------------------
3colB           NVYLYFKNKQALIDSVYARETNRILSTTDLDRLSDSTIDVTTRIRLYV----------------------
1du7A           TLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTR-----
3br2D           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
1bjyB           TLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTR-----
3dpjA           NFYYHFKTKDEILAEVIRLRLARTAQLADWQGTGSPRARIASFIDLINRAKITRYGCPVGSLCTELSKLD
3bt9B           NLYYHFKTKENLFLEILNIQESKWQEQWEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
3bhqA           TVYKHFTDKETLFGEVVLSTASQVNDIIESVTTLLSEAIFEGGLQQLARRLVLDEELLKLRRLIIANADR
3br2E           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
3br2A           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
3br6B           NLYFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTTNSIN
3br5A           NLYYHFKTKENLFLEILNIEESKWQEQWKSIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
2dg8D           SMTYHFTGIEQLLREAFGRFTDHIVAVFDEHL--------------------------------------
3btiB           NLYYHFKTKENLFLEILNIEQSKWQEQWEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
3egqA           LIFYHFESKQKLLEEAVHAFRKE---EFNPRSVEEVVDYGIGFIAER-----------------------
3br1D           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
3b6cB           SLYAHVGNRDELLDLVFDIVLTEV----------------------------------------------
3bruA           SFYHYFRNKADFGLALIEAYDTYFARLLDQLDGSLAPLARLRLFTRAEEGARHGFRRGCLVGNLGQAALI
2dg8B           SMTYHFTGIEQLLREAFGRFTDHIVAVFDEHL--------------------------------------
3bqzA           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
3bniA           SVYRFFGNKDALAQRNLERYAERVTERLTEAGDGGWRGALDTVLDEYLAMKRTAPGFSLIDFGRVAERLT
3bniB           SVYRFFGNKRQMADALAQRNLERYAERVTERLTEAGDGGWRGALDTVL----------------------
3b6cA           SLYAHVGNRDELLDLVFDIVLTEVE--VPEPEPGRWAEQVKEMCRSLRRMF--LAHRDLARIAIDRVPLG
2dg8A           SMTYHFTGIEQLLREAFGRFTDHIVAVFDEHL--------------------------------------
3bruB           SFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLRLFTRAEEGARHGFRRGCLVGNLGQEGALP
3dpjE           NFYYHFKTKDEILAEVIRLRLARTAQLADWQGTG------------------------------------
3cwrA           TLYRFASGRADLIGLLVESWIAPIFPGFEAQDAAAALERIVYDIAQAVLSREAVSLFRLASDADLRNRFA
2dg8C           SMTYHFTGIEQLLREAFGRFTDHIVAVFDEHL--------------------------------------
3b81A           ALYHYFSSKEECADAAIENRVAFFSNEVLKEEGLNSIERLKKILLAGIINSPSNKIFHQKLVAIIKYFAP
3cdlA           TVYNHFPSKEELFAELQRLWNCAEVVYRPLVSLREQL--LELLWGKRNLTDSSFLDLARVVVGATIHSPE
3br5B           NLYFKTKENLFLEILNIEESKWQEQWKSEQIKCKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTTNSIN
3br3B           NLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKT
2dtzD           NLYYHFKTKENLFLEILNIEESKWQEQWEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKT
2eh3A           AFYFHFKSKEELITEIIERTHKKIISLFEEN---------------------------------------
3b6aA           SLYAHVGNRDELLDLVFDIVLTEV----------------------------------------------
3br1B           NLYFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYNE-
3b6aB           SLYAHVGNRDELLDLVFDIVLTEVE--VPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPN
3c2bA           SLYKWFGDRDGLLAAITFQQSKVRTFEKAGDSAPQLADHLEVFAHDLLDVLAGDVSLALNRLAIGQLLLE
3e7qB           LINHHYDGKDALVAEAYLAVTGRVMRLLRGAIDTAPGGAR------------------------------
3ccyA           RLYHYFDSKEAVLRDLTTHVDSLLERCRQVLYGSEPKTRFLQIVKLFLEIYATSRDRHVVLTCLDPEDQR
3bjbC           TLYRYFPSKTHLFVAVVDQIDRGVGFKKSADAVYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGK
3dpjB           NFYYHFKTKDEILAEVIRLRLARTAQLADWGTGDSPRARIASFIDLINRAKITRYGCPVGSLCTELSKLD
2d6yA           LIYAYYGNKGELFASVLEKKLDLAISVPVDPDDEGWIDRLLDYHAAHPELLRLL--FWEGEYGTAELPHE
3egqB           LIFYHFESKQKLLEEAVHAFRKE---EFNPRSVEEVVDYGIGFIAER-----------------------
3e7qA           LINHHYDGKDALVAEAYLAVTGRVMRLLRGAIDTAPGGAR------------------------------
2d6yB           LIYAYYGNKGELFASVLEKKLDLAISVPVDPDD------IEGWIDRLLDYHAAHPELLRLLFWEGEYGTE
3dpjF           NFYYHFKTKDEILAEVIRLRLARTAQLADWQG--------------------------------------
2dtzB           NLFKTKENLFLEILNIEESKWQE-QWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTTNSIN
3crjC           AVHYYYDTKDDLLAAFLDYLLERFVDSIHDVETTDPEARLNLLLDELLVKPQENPDLSVALLEAPYKEAF
3cwrB           TLYRFASGRADLIGLLVESWIAPIFPEADPQDAAAALERIVYDIAQAVLSREAVSLFRLASDADLRNRFA
3bjbA           TLYRYFPSKTHLFVAVVDQIDRGESPQDAVYNVLVRATR-------------------------------
3c07A           NAYYYFAGKEHLIQGFYDRIAAEHRAAVREVLARET----------------------------------
3c07B           NAYYYFAGKEHLIQGFYDRIAAEHRAAVREVLARET----------------------------------
3bjbF           TLYRYFPSKTHLFVAVVDQIDRGVGPPGESPQ--------------------------------------
3bjbE           TLYRYFPSKTHLFVAVVDQIDRGVPPGESPQ---------------------------------------
3cdlB           TVYNHFPSKEELFAELQRLWNCYRP---------------------------------------------
1cjgA           TVSRVVNQASHVSAKTREKVEAAMAE--------------------------------------------
3bjbB           TLYRYFPSKTHLFVAVVDQIDRGVGFKKSAESPQDAVYNVL-----------------------------
2bjcA           TVSRVVNQASHVSAKTREKVEAAMAE--------------------------------------------
1aerB           ALLRVYVPRSSLPGFYRTSLTLAAPEAAGERLIGHPLPLRLDAITGPRLETILGWPLAERTVVIP-----
3bjbD           TLYRYFPSKTHLFVAVVDQIDRPPGESPQDAVYNVLVRATRGLLRR------PALSTAIQSTS----TAN
3br2B           NL--------------------------------------------------------------------
3bqyA           ALYRYFAAKQDLLTAAEH----------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXGAIERRLPSEPHNPEQASGLVQAVIQGACMQWLIARNGPLDAFMTEQTRQVLSVL
3dcfA           ERKREREYTEIQRLYAEGVATGELLDVDPTVATATLLGAAIWTYRWYDPEGRLSADEVVEQITRLLLNGY
3dcfB           ERKREREYTEIQRLYAEGVATGELLDVDPTVATATLLGAAIWTYRWYDPEGRLSADEVVEQITRLLLNGY
2dg7A           QERERTKSAAISRAVQDALVRRQVDADTAELVAQLATVAFGSAFRRWIDAEGHADFGSCLDTVTDRLRAV
3cjdB           PQWYGHAAQLFSYITTPLAKIFPESDDAELDLTRTLFSSVHGIVLLGLENRISGVPGEQLKTIRLLLEQV
3br3A           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
1a6iA           YDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHLPPLLREALQIMDSDDGEQAFLHGLESL
3colA           GQDADPNNIVANLLTAAIDAKVIKQL--PVSLHGVVFSTIHTHTTNISKGRYAQDQYTFGDIFQIWDAKQ
3cjdA           PQWYGHAAQLFSYITTPLAKIFPESDDAELDLTRTLFSSVHGIVLLGLENRISGVPGEQLKTIRLLLEQV
3br0B           NSINEKMNKLQNKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3br0A           NSINEKMNKLQNKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3crjB           SDRFRQNDEYVRYLKAVINHGIDETDVDAEHVTRSLLTIIDGARTRAVLDDTEELET-------------
3br6A           EKMNKLQNKYIDAYHVIFKEGNLNSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
1bjzA           TQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHNLPPLLREALQIMDSDDGEQAFLHGLESLIRGF
3crjD           SDRFRQNDEYVRYLKAVINHGIDETDVDAEHVTRSLLTIIDGARTRAVLDDTEELET-------------
3br5E           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3crjA           SDRFRQNDEYVRYLKAVINHGIDETDVDAEHVTRSLLTIIDGARTRAVLDDTEELET-------------
3dewA           SPAIASVIRLLAESIEAGTRGLFRRDLHAVNSALALAGVNYFFLSTLATEGLTSHSPDQDEE--------
1bj0A           YDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHLPPLLREALQIMDSDDGEQAFLHGLESL
3br5D           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTEQNI-NERIKLMNKFSQIFLNGL
3bqzB           NEMNKLENKYIDAYHVIFKEGNLNSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3c2bB           DLLLERGRRQIDRRARGLIEAGRRSFDDAEEAYRSFYGLIVSDLHVRLLGEAPDDFSARAKKAVVAF---
2dt5A           ----------------------------------------------------------------------
3colB           ----------------------------------------------------------------------
1du7A           ----------------------------------------------------------------------
3br2D           NSINEKMNKLQNKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
1bjyB           ----------------------------------------------------------------------
3dpjA           HAAQGQANGLFTLFRDWLQRQFAAGCTTEAPALAHLLARSQGAATLAQSFHDEGFLR-------------
3bt9B           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3bhqA           PQLGRAWYEKGFERLASTASCFLIQTGDPYLAASHLFGLLWIPNEAFT-GSNRRSKAELERHADASVEAF
3br2E           NSINEKMNKLQNKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3br2A           NSINEKMNKLQNKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3br6B           EKMNKLQNKYIDAYHVIFKEGNLNSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3br5A           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTQNIN-------------------
2dg8D           ----------------------------------------------------------------------
3btiB           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3egqA           ----------------------------------------------------------------------
3br1D           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3b6cB           ----------------------------------------------------------------------
3bruA           GVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHF---
2dg8B           ----------------------------------------------------------------------
3bqzA           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3bniA           ELLSGYLGRRPDDDLRRVFLVAQLAFRVAPDGDEKIIEEARELLRAYL----------------------
3bniB           ----------------------------------------------------------------------
3b6cA           PNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEAL-EQSSRVFADQLHGYLKSLPATSFPNL---
2dg8A           ----------------------------------------------------------------------
3bruB           DDFRAALIGVLETWQRRTAQLFLSADHDPDALAEAFWIGWEGAILRAKLELRDPLHSFTRTFGRHFV---
3dpjE           ----------------------------------------------------------------------
3cwrA           NGIERSRRELARWLDQQASAGRLPLPIPAERVADLLLSAVIAEPLRQITLGLREPLP-------------
2dg8C           ----------------------------------------------------------------------
3b81A           IYADIIS---------QGNEEGVFKVKYPLETAEIILTLSHFYLDEDLFKWKKEDSLKLTAFKETLIKIL
3cdlA           RAQVWLEETFSAWIRAAQKDGRLK-PVDPGFAATQHALLKSFAFWPQVTFNAALTPQEQSNVVESALNFL
3br5B           EKMNKLENKYIDAYHVIFKEGNLNSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3br3B           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTE-QNINERIKLMNKFSQIFLNGL
2dtzD           NSINEKMNKLENKYIDAYHVIFEWSINDVNAVSKIAANAVNGIVTFTQ--NINERIKLMNKFSQIFLNGL
2eh3A           ----------------------------------------------------------------------
3b6aA           ----------------------------------------------------------------------
3br1B           -KMNKLENKYIDAYHVIFKEGNLNSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGL
3b6aB           GMVGMERTM-------NLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRNPGTAGVFADQLHGYLKSLP
3c2bA           RGRRQIDRRARGLIEAGRRSGYLRFDDAEEAYRSFYGLIVSDLHVRLLGEAPDKDFSARAKKAVVAF---
3e7qB           ----------------------------------------------------------------------
3ccyA           KALIAKQRELIAYVRDALLQLRPDAANRTLAHVDTLFFGINWTYTWYKADGSVSPDALAERTVQLFL---
3bjbC           VDRAFRQILD--------AAGIEHPTEEDLTALRLLVQLWFGVIQSCLNGRVSIPDA-------------
3dpjB           HAAQGQANGLFTLFRDWLQRQFEAGCTTEAPALAHLLARSQGAATLAQSFHDEGFLR-------------
2d6yA           AERQEHYARKVAAVRDGQERGVITDAIPAPDLLFLLVAANWAVVVPQKRILVGGGDAGTDGLRDSIKKAA
3egqB           ----------------------------------------------------------------------
3e7qA           ----------------------------------------------------------------------
2d6yB           AERQEHYARKVAAVRDGQERGVITDAIPAPDLLFLLVAANWAVVVPQKRILVGGGDAGTDGLRDSIKKAA
3dpjF           ----------------------------------------------------------------------
2dtzB           EKMNKLENKYIDAYHVIFKEGNLNSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFL---
3crjC           SDRFRQNDEYVRYLKAVINHGIDEGDVDAEHVTRSLLTIIDGARTRAVLDDTEELETARQTASEYA----
3cwrB           NGIERSRRELARWLDQQASAGRLPLPIPAERVADLLLSAVIAEPLRQITLGLRLPAWDIAPRVADAVRLI
3bjbA           ----------------------------------------------------------------------
3c07A           ----------------------------------------------------------------------
3c07B           ----------------------------------------------------------------------
3bjbF           ----------------------------------------------------------------------
3bjbE           ----------------------------------------------------------------------
3cdlB           ----------------------------------------------------------------------
1cjgA           ----------------------------------------------------------------------
3bjbB           ----------------------------------------------------------------------
2bjcA           ----------------------------------------------------------------------
1aerB           ----------------------------------------------------------------------
3bjbD           VASVPDAGKVDRAFRQILDAAGIEHPTEEDLALRLLVQLWFGVIQSCLNGRVSIPDA-------------
3br2B           ----------------------------------------------------------------------
3bqyA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YPGHTxx
3dcfA           RR-----
3dcfB           -------
2dg7A           LTG----
3cjdB           -------
3br3A           -------
1a6iA           IRG----
3colA           -------
3cjdA           -------
3br0B           -------
3br0A           -------
3crjB           -------
3br6A           -------
1bjzA           -------
3crjD           -------
3br5E           -------
3crjA           -------
3dewA           -------
1bj0A           IRG----
3br5D           -------
3bqzB           -------
3c2bB           -------
2dt5A           -------
3colB           -------
1du7A           -------
3br2D           -------
1bjyB           -------
3dpjA           -------
3bt9B           -------
3bhqA           LAV----
3br2E           -------
3br2A           -------
3br6B           -------
3br5A           -------
2dg8D           -------
3btiB           -------
3egqA           -------
3br1D           -------
3b6cB           -------
3bruA           -------
2dg8B           -------
3bqzA           -------
3bniA           -------
3bniB           -------
3b6cA           -------
2dg8A           -------
3bruB           -------
3dpjE           -------
3cwrA           -------
2dg8C           -------
3b81A           -------
3cdlA           GWY----
3br5B           -------
3br3B           -------
2dtzD           -------
2eh3A           -------
3b6aA           -------
3br1B           -------
3b6aB           -------
3c2bA           -------
3e7qB           -------
3ccyA           -------
3bjbC           -------
3dpjB           -------
2d6yA           RRIVD--
3egqB           -------
3e7qA           -------
2d6yB           RRI----
3dpjF           -------
2dtzB           -------
3crjC           -------
3cwrB           AP-----
3bjbA           -------
3c07A           -------
3c07B           -------
3bjbF           -------
3bjbE           -------
3cdlB           -------
1cjgA           -------
3bjbB           -------
2bjcA           -------
1aerB           -------
3bjbD           -------
3br2B           -------
3bqyA           -------