[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37468.1

[Show Plain Result]


## Summary of Sequence Search
    1::89
    1::79      6e-15  57%   83 aa  PF00312 Ribosomal_S15 "Ribosomal protein S15"
    1::89

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
PF00312         -----QEKGKIIKEILRHEGDTGSPEVQVALLTAKINNLTEHLKEHKKDKHSKRGLLKLVSKRRRLLRYL


                         .         .         *         .         .         .         .:140
query           KKKDEARYKALLEKxxxxx
PF00312         KRKDRERYRELIAK-----