[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37597.1

[Show Plain Result]


## Summary of Sequence Search
    1::426
    7::148     1e-21  48%  149 aa  PF00849 PseudoU_synth_2 "RNA pseudouridylate synthase"
    1::426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00849         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00849         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPRGLVVHPAAGHETGTLV
PF00849         ---------------------------------------------------KPAGLVVHPGDPEGRRTVF


                         .         .         .         +         .         .         .:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
PF00849         DLLPK---------GRKPRLGLVHRLDKDTSGLLLLAKDGEAANRLMHQFPSR----KVEKEYLALVHGG


                         .         *         .         .         .         .         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
PF00849         PKKDEGTIDAPIGRDPERRRRGVVLEDGKPAVTEYRVLEGYTGP-----VTLVELTLHTGRTHQIRVHLA


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00849         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxx
PF00849         ------