[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37664.1

[Show Plain Result]


## Summary of Sequence Search
    1::279
    3::255     5e-56  41%  255 aa  PF03618 DUF299 "Domain of unknown function (DUF299) "
   26::162     8e-04  29%  380 aa  PF11477 PM0188 "Sialyltransferase PMO188"
    1::279

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEESPGIVLFTLL
PF03618         -----------VVSDSTGETAETVGRAALSQFPDVEFNIHRFPFVETEEKLREVLEQIKEEDAIVFYTLV
PF11477         --------------DYTNPRLISWSREILLQYINI----HFFPLIDNRTSAELV-QSLD----------I


                         .         .         *         .         .         .         .:140
query           ESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQH
PF03618         DPELREILKEACEALGVPCVDVLGPLIEPLESELGVKPSPEPGRVHGLDEDYFRRIEAIEFALKHDDGQS
PF11477         YAQSNNRLNINIHGNTAHSFDLIRPILPIYQNYLGKVSIIQLNLYDDGSAEY---VRLYNWSKLPDKEQE


                         +         .         .         .         .         *         .:210
query           VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVR
PF03618         PRGLDEADIILLGVSRTGKTPLSLYLANKGIKVANYPLVPELPLPEELFEVDPKKVFGLTIDPERLNEIR
PF11477         IS--QSKNVLLDYLNGTSPNPTS-----------------------------------------------


                         .         .         .         +         .         .         .:280
query           QNRLLSLGAGAGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMxxxxxxxxxxxxx
PF03618         KERLKNL--GLSESRYASLEQCREELAEAEALFRRNGIPVIDVTNKSIEETAAKIL-------------
PF11477         ---------------------------------------------------------------------