[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37710.1

[Show Plain Result]


## Summary of Sequence Search
    1::137
    2::142     2e-25  48%  142 aa  PF01878 DUF55 "Protein of unknown function DUF55"
    1::137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNXXXXXXXXXXXXXXX
PF01878         --YWLMKSEPDNFSIDDL--KGFGQTPWDGVRNYQARNFLRAMKPGDLVLFYHSNCKAPGIVGIAEVVSE


                         .         .         *         .         .         .         .:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMxxx
PF01878         YPDPTAENPRWYRVDVKFVRKLKRPVPLKELKAHPELKDMALVRRSRLSVQPVTEEEWKFILEL---