[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37723.1

[Show Plain Result]


## Summary of Sequence Search
    1::194
   24::129     2e-15  53%  129 aa  PF02469 Fasciclin "Fasciclin domain"
    1::194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02469         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDG
PF02469         --------------GDGPFTVFAPTNDAFAALPPGTLASL--SSNKDELRKILLYHVVPGYLSSSDLKNG


                         +         .         .         .         .         *         .:210
query           KKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPx
PF02469         STLTTLAGDTLNVTRNGGGVTV----NGNAKVVKADILATNGVIHVIDRVLLP-