[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37731.1

[Show Plain Result]


## Summary of Sequence Search
    1::344
    1::165     2e-34  52%  165 aa  PF02774 Semialdhyde_dhC "Semialdehyde dehydrogenase, dimerisation
    1::116     9e-18  44%  120 aa  PF01118 Semialdhyde_dh "Semialdehyde dehydrogenase, NAD binding
   16::85      6e-04  33%  388 aa  PF01960 ArgJ "ArgJ family"
    1::344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
PF02774         ----------------------------------------------------------------------
PF01118         ---KVAIVGATGYVGQELLRLLLEH--PDVEIVALVASSRAGKKLAFGGEDLTVEDADEEELAGVDIVFL
PF01960         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
PF02774         --------------------------------------------------------------------LK
PF01118         ALPHGVSKELAPKLAAAGCVVIDLSSAFRLDDDAPYGLPEVNREA-------------------------
PF01960         -------------------------------PDLALIVSDVPASAAGVFTTNKFKAAP------VLVSRE


                         +         .         .         .         .         *         .:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
PF02774         PLHDAFGIERVIVSTYQAVSGAGRKPKPGVFGS-----------------EIAFNLIPYIDGFEHRGEPK
PF01118         ----------------------------------------------------------------------
PF01960         HLASGGKARAVVVNSGNANACTGEQGLEDAREMAEAV---------------------------------


                         .         .         .         +         .         .         .:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
PF02774         EELKMLAETRKILGFTPKVSATCVRVPVFRGHSETVYVELEKPVDLEEAYELLYAAPEPFVRDNPE-GRY
PF01118         ----------------------------------------------------------------------
PF01960         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02774         PTPKAVAGTNFVDVGRIRKDPRGPRGLVVFSVIDNLLK--------------------------
PF01118         ----------------------------------------------------------------
PF01960         ----------------------------------------------------------------