[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE37891.1

[Show Plain Result]


## Summary of Sequence Search
    1::519
   93::222     5e-17  39%  268 aa  PF00361 Oxidored_q1 "NADH-Ubiquinone/plastoquinone (complex I),
    1::519

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxKSAQFPAHGWLTEVMETPTPVSALLHAGVINAGGFLLIRFADXXXXXXXXXXXXXXIGG
PF00361         -----------KSAQFPLHFWLPDAMEGPTPVSALILAAMVKAGIYLLLRLSPLLFASPYILPLLLILGL


                         .         *         .         .         .         .         +:350
query           FTAVFGGLVMLTQPAVKTSLAWSTVAQMGFMILECGLALFPVALLHIVAHSLYKAHSFLASGGAVERVAA
PF00361         ITALLGALLALAQTDLKRLLAYSSISHLGYMLGILGLGPYSGALFHLITHALFKALLFLLAGSIIHRTGS


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00361         -----------------------------