[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38048.1

[Show Plain Result]


## Summary of Sequence Search
    1::456
   19::283     4e-62  51%  285 aa  PF04107 GCS2 "Glutamate-cysteine ligase family 2(GCS2)"
    1::456

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLG
PF04107         --------------------------------------------------------------------LR


                         .         .         *         .         .         .         .:140
query           WEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAHLAQVREVATPLGIGFLGLGM
PF04107         WSPELEDGALIGLK--PGGGIVSEEPGGQLELSTAPLETLAELEAELLAHLRVLREAAAELGLGLLGLGT


                         +         .         .         .         .         *         .:210
query           TPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATAL
PF04107         HPFWLWSDQPITPKPRYRAMREYFGRVGTLGLQMMTFGCHVQVGLDDGPEAD-ARKLNAARALLPVLLAL


                         .         .         .         +         .         .         .:280
query           FANSPFTEGKPNGFLSFRSEIWRDTDNARSGMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGS
PF04107         SANSPFLEGRDTGWASTRIPIFEQTPD--TGPLPFVFDDGFGFERYVEYLLDTGMIFVRR----------


                         .         *         .         .         .         .         +:350
query           SFRDFFDGKNEKLPGERPTLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSL
PF04107         --RDWWDGR----PSPRPGTLELRVHDTTL--PVRLKAYLEARLLDALPWRRLDALPALWVGLLYDD--L


                         .         .         .         .         *         .         .:420
query           DAAWEIVKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04107         ENAWRATR--------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF04107         ------------------------------------