[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38106.1

[Show Plain Result]


## Summary of Sequence Search
    1::494
    4::160     2e-26  46%  160 aa  PF00990 GGDEF "GGDEF domain"
    1::494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00990         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00990         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00990         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00990         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDSLTGLINRRKFDTLIEREWRRA
PF00990         -----------------------------------------------DPLTGLPNRRAFEERLERLLARA


                         .         .         .         .         *         .         .:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
PF00990         RREGRPLALLLLDLDHFKRINDTYGHAAGDEVLREVARRLREAL-REGDLVARLGGDEFAILLPGTDLEE


                         .         .         +         .         .         .         .:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEXXXXXXXXXXXXGRNCxxxxxxxxxx
PF00990         ALEAAERARRLIEALSFGQERVTVSIGVA-LYPDDGEDAEELLKRADQALYRAKKAGRNC----------


                         *         .         .         .         .         +         .:560
query           xxxx
PF00990         ----