[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rpal2:ABE38119.1

[Show Plain Result]


## Summary of Sequence Search
    1::496
   11::169     1e-14  35%  260 aa  PF05138 PaaA_PaaC "Phenylacetic acid catabolic protein"
    1::496

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05138         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVPGEYRAMLRRLIVIQGDTEP
PF05138         -------------------------------------------------MPEEYRKTLIRLILQLADSEL


                         +         .         .         .         .         *         .:210
query           ASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLG
PF05138         VLAQREGEWIGRAPSLEELANIVQDELGHARLLYSLAETL------DGRDEDDLAYLRDEGDF---RNLS


                         .         .         .         +         .         .         .:280
query           AFNEATPDWLSFFMFTYFTDRDGKMQLHSLAQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEA
PF05138         LFNYPTGDWADTGVRGFLVDGAAIMQLTALCRSSYGPLARAAAKILKEEAFHLRHGEEWLLRLGDGTPES


                         .         *         .         .         .         .         +:350
query           MRDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05138         RERA------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05138         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF05138         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxx
PF05138         ------